[llvm-branch-commits] [llvm] 8f777e2 - [Clang][C++23][WIP] P2071 Named universal character escapes

Corentin Jabot via llvm-branch-commits llvm-branch-commits at lists.llvm.org
Tue Apr 5 07:53:50 PDT 2022


Author: Corentin Jabot
Date: 2022-04-05T16:53:10+02:00
New Revision: 8f777e24ad391babeb5104d8775b0b4c47560ef2

URL: https://github.com/llvm/llvm-project/commit/8f777e24ad391babeb5104d8775b0b4c47560ef2
DIFF: https://github.com/llvm/llvm-project/commit/8f777e24ad391babeb5104d8775b0b4c47560ef2.diff

LOG: [Clang][C++23][WIP] P2071 Named universal character escapes

! Missing tests, some cleanup still needed.

* Add a function in LLVM to map a name to a codepoint.
This using a try to minimize memory usage,
while allowing fast access.

* Add an utility to regenerate this data.

* Support named escape sequences with an extension warning.
I have not yet dealt with C++23 conformance extension warning,

Differential Revision: https://reviews.llvm.org/D123064

Added: 
    llvm/lib/Support/UnicodeNameToCodepoint.cpp
    llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
    llvm/utils/UnicodeData/CMakeLists.txt
    llvm/utils/UnicodeData/UnicodeNameMappingGenerator.cpp

Modified: 
    clang/include/clang/Basic/DiagnosticLexKinds.td
    clang/include/clang/Lex/Lexer.h
    clang/lib/Lex/Lexer.cpp
    clang/lib/Lex/LiteralSupport.cpp
    clang/test/Lexer/char-escapes-delimited.c
    clang/test/Parser/cxx11-user-defined-literals.cpp
    clang/test/Preprocessor/ucn-pp-identifier.c
    clang/test/Sema/ucn-identifiers.c
    llvm/CMakeLists.txt
    llvm/include/llvm/ADT/StringExtras.h
    llvm/include/llvm/Support/ScopedPrinter.h
    llvm/include/llvm/Support/Unicode.h
    llvm/lib/Support/CMakeLists.txt
    llvm/lib/Support/ScopedPrinter.cpp
    llvm/lib/Support/StringExtras.cpp
    llvm/unittests/Support/UnicodeTest.cpp

Removed: 
    


################################################################################
diff  --git a/clang/include/clang/Basic/DiagnosticLexKinds.td b/clang/include/clang/Basic/DiagnosticLexKinds.td
index 0f424b02c812a..c5566f1336767 100644
--- a/clang/include/clang/Basic/DiagnosticLexKinds.td
+++ b/clang/include/clang/Basic/DiagnosticLexKinds.td
@@ -128,7 +128,7 @@ def warn_utf8_symbol_zero_width : Warning<
   "some environments">, InGroup<DiagGroup<"unicode-zero-width">>;
 
 def ext_delimited_escape_sequence : Extension<
-  "delimited escape sequences are a Clang extension">,
+  "%select{delimited|named}0 escape sequences are a Clang extension">,
   InGroup<DiagGroup<"delimited-escape-sequence-extension">>;
 def err_delimited_escape_empty : Error<
   "delimited escape sequence cannot be empty">;
@@ -138,6 +138,10 @@ def err_delimited_escape_invalid : Error<
   "invalid digit '%0' in escape sequence">;
 def err_hex_escape_no_digits : Error<
   "\\%0 used with no following hex digits">;
+def err_invalid_ucn_name : Error<
+  "'%0' is not a valid Unicode character name">;
+def note_invalid_ucn_name_loose_matching : Note<
+  "characters names in unicode escape sequences are sensitive to case and whitespaces">;
 def warn_ucn_escape_no_digits : Warning<
   "\\%0 used with no following hex digits; "
   "treating as '\\' followed by identifier">, InGroup<Unicode>;
@@ -145,10 +149,10 @@ def err_ucn_escape_incomplete : Error<
   "incomplete universal character name">;
 def warn_delimited_ucn_incomplete : Warning<
   "incomplete delimited universal character name; "
-  "treating as '\\' 'u' '{' identifier">, InGroup<Unicode>;
+  "treating as '\\' '%0' '{' identifier">, InGroup<Unicode>;
 def warn_delimited_ucn_empty : Warning<
   "empty delimited universal character name; "
-  "treating as '\\' 'u' '{' '}'">, InGroup<Unicode>;
+  "treating as '\\' '%0' '{' '}'">, InGroup<Unicode>;
 def warn_ucn_escape_incomplete : Warning<
   "incomplete universal character name; "
   "treating as '\\' followed by identifier">, InGroup<Unicode>;

diff  --git a/clang/include/clang/Lex/Lexer.h b/clang/include/clang/Lex/Lexer.h
index c64a5756ac419..8eb5b5b04e805 100644
--- a/clang/include/clang/Lex/Lexer.h
+++ b/clang/include/clang/Lex/Lexer.h
@@ -749,6 +749,11 @@ class Lexer : public PreprocessorLexer {
   void codeCompleteIncludedFile(const char *PathStart,
                                 const char *CompletionPoint, bool IsAngled);
 
+  llvm::Optional<uint32_t>
+  tryReadNumericUCN(const char *&StartPtr, const char *SlashLoc, Token *Result);
+  llvm::Optional<uint32_t> tryReadNamedUCN(const char *&StartPtr,
+                                           const char *SlashLoc, Token *Result);
+
   /// Read a universal character name.
   ///
   /// \param StartPtr The position in the source buffer after the initial '\'.

diff  --git a/clang/lib/Lex/Lexer.cpp b/clang/lib/Lex/Lexer.cpp
index 6e8072fb1b2d9..85b226bee99f9 100644
--- a/clang/lib/Lex/Lexer.cpp
+++ b/clang/lib/Lex/Lexer.cpp
@@ -37,6 +37,7 @@
 #include "llvm/Support/MathExtras.h"
 #include "llvm/Support/MemoryBufferRef.h"
 #include "llvm/Support/NativeFormatting.h"
+#include "llvm/Support/Unicode.h"
 #include "llvm/Support/UnicodeCharRanges.h"
 #include <algorithm>
 #include <cassert>
@@ -3114,27 +3115,28 @@ bool Lexer::isCodeCompletionPoint(const char *CurPtr) const {
   return false;
 }
 
-uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
-                           Token *Result) {
+llvm::Optional<uint32_t> Lexer::tryReadNumericUCN(const char *&StartPtr,
+                                                  const char *SlashLoc,
+                                                  Token *Result) {
   unsigned CharSize;
   char Kind = getCharAndSize(StartPtr, CharSize);
-  bool Delimited = false;
-  bool FoundEndDelimiter = false;
-  unsigned Count = 0;
-  bool Diagnose = Result && !isLexingRawMode();
+  assert((Kind == 'u' || Kind == 'U') && "expected a UCN");
 
   unsigned NumHexDigits;
   if (Kind == 'u')
     NumHexDigits = 4;
   else if (Kind == 'U')
     NumHexDigits = 8;
-  else
-    return 0;
+
+  bool Delimited = false;
+  bool FoundEndDelimiter = false;
+  unsigned Count = 0;
+  bool Diagnose = Result && !isLexingRawMode();
 
   if (!LangOpts.CPlusPlus && !LangOpts.C99) {
     if (Diagnose)
       Diag(SlashLoc, diag::warn_ucn_not_valid_in_c89);
-    return 0;
+    return {};
   }
 
   const char *CurPtr = StartPtr + CharSize;
@@ -3161,14 +3163,14 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
         break;
       if (Diagnose)
         Diag(BufferPtr, diag::warn_delimited_ucn_incomplete)
-            << StringRef(&C, 1);
-      return 0;
+            << StringRef(KindLoc, 1);
+      return {};
     }
 
     if (CodePoint & 0xF000'0000) {
       if (Diagnose)
         Diag(KindLoc, diag::err_escape_too_large) << 0;
-      return 0;
+      return {};
     }
 
     CodePoint <<= 4;
@@ -3182,7 +3184,13 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
       Diag(StartPtr, FoundEndDelimiter ? diag::warn_delimited_ucn_empty
                                        : diag::warn_ucn_escape_no_digits)
           << StringRef(KindLoc, 1);
-    return 0;
+    return {};
+  }
+
+  if (Delimited && Kind == 'U') {
+    if (Diagnose)
+      Diag(StartPtr, diag::err_hex_escape_no_digits) << StringRef(KindLoc, 1);
+    return {};
   }
 
   if (!Delimited && Count != NumHexDigits) {
@@ -3195,15 +3203,14 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
             << FixItHint::CreateReplacement(URange, "u");
       }
     }
-    return 0;
+    return {};
   }
 
   if (Delimited && PP) {
-    Diag(BufferPtr, diag::ext_delimited_escape_sequence);
+    Diag(BufferPtr, diag::ext_delimited_escape_sequence) << /*delimited*/ 0;
   }
 
   if (Result) {
-    Result->setFlag(Token::HasUCN);
     if (CurPtr - StartPtr == (ptr
diff _t)(Count + 2 + (Delimited ? 2 : 0)))
       StartPtr = CurPtr;
     else
@@ -3212,6 +3219,104 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
   } else {
     StartPtr = CurPtr;
   }
+  return CodePoint;
+}
+
+llvm::Optional<uint32_t> Lexer::tryReadNamedUCN(const char *&StartPtr,
+                                                const char *, Token *Result) {
+  unsigned CharSize;
+  bool Diagnose = Result && !isLexingRawMode();
+
+  char C = getCharAndSize(StartPtr, CharSize);
+  assert(C == 'N' && "expected \\N{...}");
+
+  const char *CurPtr = StartPtr + CharSize;
+  const char *KindLoc = &CurPtr[-1];
+
+  C = getCharAndSize(CurPtr, CharSize);
+  if (C != '{') {
+    if (Diagnose)
+      Diag(StartPtr, diag::warn_ucn_escape_incomplete);
+    return {};
+  }
+  CurPtr += CharSize;
+
+  bool FoundEndDelimiter = false;
+  bool Invalid = false;
+  llvm::SmallVector<char, 30> Buffer;
+  while (C) {
+    C = getCharAndSize(CurPtr, CharSize);
+    CurPtr += CharSize;
+    if (C == '}') {
+      FoundEndDelimiter = true;
+      break;
+    }
+
+    if (!isAlphanumeric(C) && C != '_' && C != '-' && C != ' ')
+      break;
+
+    if ((C < 'A' || C > 'Z') && !llvm::isDigit(C) && C != ' ' && C != '-') {
+      Invalid = true;
+    }
+    Buffer.push_back(C);
+  }
+
+  if (!FoundEndDelimiter || Buffer.empty()) {
+    if (Diagnose)
+      Diag(StartPtr, FoundEndDelimiter ? diag::warn_delimited_ucn_empty
+                                       : diag::warn_delimited_ucn_incomplete)
+          << StringRef(KindLoc, 1);
+    return {};
+  }
+  llvm::Optional<char32_t> Res;
+
+  if (!Invalid)
+    Res = llvm::sys::unicode::nameToCodepointStrict(
+        StringRef(Buffer.data(), Buffer.size()));
+
+  if (!Res) {
+    if (Diagnose)
+      Diag(StartPtr, diag::err_invalid_ucn_name)
+          << StringRef(Buffer.data(), Buffer.size());
+    return {};
+  }
+
+  if (Diagnose && PP) {
+    Diag(BufferPtr, diag::ext_delimited_escape_sequence) << /*named*/ 1;
+  }
+
+  if (Result) {
+    if (CurPtr - StartPtr == (ptr
diff _t)(Buffer.size() + 4))
+      StartPtr = CurPtr;
+    else
+      while (StartPtr != CurPtr)
+        (void)getAndAdvanceChar(StartPtr, *Result);
+  } else {
+    StartPtr = CurPtr;
+  }
+  return *Res;
+}
+
+uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
+                           Token *Result) {
+
+  unsigned CharSize;
+  llvm::Optional<uint32_t> CodePointOpt;
+  char Kind = getCharAndSize(StartPtr, CharSize);
+  if (Kind == 'u' || Kind == 'U')
+    CodePointOpt = tryReadNumericUCN(StartPtr, SlashLoc, Result);
+
+  else if (Kind == 'N')
+    CodePointOpt = tryReadNamedUCN(StartPtr, SlashLoc, Result);
+
+  if (!CodePointOpt)
+    return 0;
+
+  uint32_t CodePoint = *CodePointOpt;
+
+  if (Result) {
+    Result->setFlag(Token::HasUCN);
+  }
 
   // Don't apply C family restrictions to UCNs in assembly mode
   if (LangOpts.AsmPreprocessor)

diff  --git a/clang/lib/Lex/LiteralSupport.cpp b/clang/lib/Lex/LiteralSupport.cpp
index 6e6fd361ebf94..66de5dcb0a0b6 100644
--- a/clang/lib/Lex/LiteralSupport.cpp
+++ b/clang/lib/Lex/LiteralSupport.cpp
@@ -27,6 +27,7 @@
 #include "llvm/Support/ConvertUTF.h"
 #include "llvm/Support/Error.h"
 #include "llvm/Support/ErrorHandling.h"
+#include "llvm/Support/Unicode.h"
 #include <algorithm>
 #include <cassert>
 #include <cstddef>
@@ -233,7 +234,8 @@ static unsigned ProcessCharEscape(const char *ThisTokBegin,
       HadError = true;
       if (Diags)
         Diag(Diags, Features, Loc, ThisTokBegin, EscapeBegin, ThisTokBuf,
-             diag::err_delimited_escape_missing_brace);
+             diag::err_delimited_escape_missing_brace)
+            << std::string(1, 'o');
 
       break;
     }
@@ -309,7 +311,8 @@ static unsigned ProcessCharEscape(const char *ThisTokBegin,
           << tok::r_brace;
     else if (!HadError) {
       Diag(Diags, Features, Loc, ThisTokBegin, EscapeBegin, ThisTokBuf,
-           diag::ext_delimited_escape_sequence);
+           diag::ext_delimited_escape_sequence)
+          << /*delimited*/ 0;
     }
   }
 
@@ -337,7 +340,7 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
     char Kind = *I;
     ++I;
 
-    assert(Kind == 'u' || Kind == 'U');
+    assert(Kind == 'u' || Kind == 'U' || Kind == 'N');
     uint32_t CodePoint = 0;
 
     if (Kind == 'u' && *I == '{') {
@@ -351,6 +354,21 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
       continue;
     }
 
+    if (Kind == 'N') {
+      assert(*I == '{');
+      ++I;
+      auto Delim = std::find(I, Input.end(), '}');
+      assert(Delim != Input.end());
+      auto Res = llvm::sys::unicode::nameToCodepointStrict(
+          StringRef(I, std::distance(I, Delim)));
+      assert(Res);
+      CodePoint = *Res;
+      assert(CodePoint != 0xFFFFFFFF);
+      appendCodePoint(CodePoint, Buf);
+      I = Delim;
+      continue;
+    }
+
     unsigned NumHexDigits;
     if (Kind == 'u')
       NumHexDigits = 4;
@@ -372,23 +390,20 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
   }
 }
 
-/// ProcessUCNEscape - Read the Universal Character Name, check constraints and
-/// return the UTF32.
-static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
-                             const char *ThisTokEnd,
-                             uint32_t &UcnVal, unsigned short &UcnLen,
-                             FullSourceLoc Loc, DiagnosticsEngine *Diags,
-                             const LangOptions &Features,
-                             bool in_char_string_literal = false) {
+static bool ProcessNumericUCNEscape(const char *ThisTokBegin,
+                                    const char *&ThisTokBuf,
+                                    const char *ThisTokEnd, uint32_t &UcnVal,
+                                    unsigned short &UcnLen, bool &Delimited,
+                                    FullSourceLoc Loc, DiagnosticsEngine *Diags,
+                                    const LangOptions &Features,
+                                    bool in_char_string_literal = false) {
   const char *UcnBegin = ThisTokBuf;
-
   // Skip the '\u' char's.
   ThisTokBuf += 2;
-
-  bool Delimited = false;
-  bool EndDelimiterFound = false;
   bool HasError = false;
 
+  Delimited = false;
+  bool EndDelimiterFound = false;
   if (UcnBegin[1] == 'u' && in_char_string_literal &&
       ThisTokBuf != ThisTokEnd && *ThisTokBuf == '{') {
     Delimited = true;
@@ -396,7 +411,8 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
   } else if (ThisTokBuf == ThisTokEnd || !isHexDigit(*ThisTokBuf)) {
     if (Diags)
       Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
-           diag::err_hex_escape_no_digits) << StringRef(&ThisTokBuf[-1], 1);
+           diag::err_hex_escape_no_digits)
+          << StringRef(&ThisTokBuf[-1], 1);
     return false;
   }
   UcnLen = (ThisTokBuf[-1] == 'u' ? 4 : 8);
@@ -457,6 +473,97 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
                      : diag::err_ucn_escape_incomplete);
     return false;
   }
+  return !HasError;
+}
+
+static bool DiagnoseInvalidUnicodeCharacterName(
+    DiagnosticsEngine *Diags, const LangOptions &Features, FullSourceLoc Loc,
+    const char *TokBegin, const char *TokRangeBegin, const char *TokRangeEnd,
+    llvm::StringRef Name) {
+  FixItHint Hint;
+  Diag(Diags, Features, Loc, TokBegin, TokRangeBegin, TokRangeEnd,
+       diag::err_invalid_ucn_name)
+      << Name << Hint;
+  auto Res = llvm::sys::unicode::nameToCodepointLooseMatching(Name);
+  if (!Res)
+    return false;
+  Diag(Diags, Features, Loc, TokBegin, TokRangeBegin, TokRangeEnd,
+       diag::note_invalid_ucn_name_loose_matching)
+      << FixItHint::CreateReplacement(
+             MakeCharSourceRange(Features, Loc, TokBegin, TokRangeBegin,
+                                 TokRangeEnd),
+             Res->Name);
+  return false;
+}
+
+static bool ProcessNamedUCNEscape(const char *ThisTokBegin,
+                                  const char *&ThisTokBuf,
+                                  const char *ThisTokEnd, uint32_t &UcnVal,
+                                  unsigned short &UcnLen, FullSourceLoc Loc,
+                                  DiagnosticsEngine *Diags,
+                                  const LangOptions &Features) {
+  const char *UcnBegin = ThisTokBuf;
+  assert(UcnBegin[1] == 'N');
+  ThisTokBuf += 2;
+  if (ThisTokBuf == ThisTokEnd || *ThisTokBuf != '{') {
+    if (Diags) {
+      Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
+           diag::err_delimited_escape_missing_brace)
+          << StringRef(&ThisTokBuf[-1], 1);
+    }
+    ThisTokBuf++;
+    return false;
+  }
+  ThisTokBuf++;
+  const char *ClosingBrace = std::find(ThisTokBuf, ThisTokEnd, '}');
+  StringRef Name(ThisTokBuf, ClosingBrace - ThisTokBuf);
+
+  if (ClosingBrace == ThisTokEnd || ClosingBrace == ThisTokBuf) {
+    if (Diags) {
+      Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
+           ClosingBrace == ThisTokBuf ? diag::err_delimited_escape_empty
+                                      : diag::err_ucn_escape_incomplete)
+          << StringRef(&UcnBegin[1], 1);
+    }
+    ThisTokBuf = ClosingBrace == ThisTokEnd ? ThisTokEnd : ThisTokBuf + 1;
+    return false;
+  }
+
+  ThisTokBuf = ClosingBrace + 1;
+  auto Res = llvm::sys::unicode::nameToCodepointStrict(Name);
+  if (!Res) {
+    if (!Diags ||
+        !DiagnoseInvalidUnicodeCharacterName(Diags, Features, Loc, ThisTokBegin,
+                                             &UcnBegin[3], ClosingBrace, Name))
+      return false;
+  }
+  UcnVal = *Res;
+  UcnLen = UcnVal > 0xFFFF ? 8 : 4;
+  return true;
+}
+
+/// ProcessUCNEscape - Read the Universal Character Name, check constraints and
+/// return the UTF32.
+static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
+                             const char *ThisTokEnd, uint32_t &UcnVal,
+                             unsigned short &UcnLen, FullSourceLoc Loc,
+                             DiagnosticsEngine *Diags,
+                             const LangOptions &Features,
+                             bool in_char_string_literal = false) {
+
+  bool HasError;
+  const char *UcnBegin = ThisTokBuf;
+  bool IsDelimitedEscapeSequence = false;
+  bool IsNamedEscapeSequence = false;
+  if (ThisTokBuf[1] == 'N') {
+    IsNamedEscapeSequence = true;
+    HasError = !ProcessNamedUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd,
+                                      UcnVal, UcnLen, Loc, Diags, Features);
+  } else
+    HasError =
+        !ProcessNumericUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd, UcnVal,
+                                 UcnLen, IsDelimitedEscapeSequence, Loc, Diags,
+                                 Features, in_char_string_literal);
 
   if (HasError)
     return false;
@@ -495,9 +602,10 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
     Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
          diag::warn_ucn_not_valid_in_c89_literal);
 
-  if (Delimited && Diags)
+  if ((IsDelimitedEscapeSequence || IsNamedEscapeSequence) && Diags)
     Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
-         diag::ext_delimited_escape_sequence);
+         diag::ext_delimited_escape_sequence)
+        << (IsNamedEscapeSequence ? 1 : 0);
 
   return true;
 }
@@ -1561,7 +1669,7 @@ CharLiteralParser::CharLiteralParser(const char *begin, const char *end,
       continue;
     }
     // Is this a Universal Character Name escape?
-    if (begin[1] == 'u' || begin[1] == 'U') {
+    if (begin[1] == 'u' || begin[1] == 'U' || begin[1] == 'N') {
       unsigned short UcnLen = 0;
       if (!ProcessUCNEscape(TokBegin, begin, end, *buffer_begin, UcnLen,
                             FullSourceLoc(Loc, PP.getSourceManager()),
@@ -1921,7 +2029,8 @@ void StringLiteralParser::init(ArrayRef<Token> StringToks){
           continue;
         }
         // Is this a Universal Character Name escape?
-        if (ThisTokBuf[1] == 'u' || ThisTokBuf[1] == 'U') {
+        if (ThisTokBuf[1] == 'u' || ThisTokBuf[1] == 'U' ||
+            ThisTokBuf[1] == 'N') {
           EncodeUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd,
                           ResultPtr, hadError,
                           FullSourceLoc(StringToks[i].getLocation(), SM),
@@ -2114,7 +2223,8 @@ unsigned StringLiteralParser::getOffsetOfStringByte(const Token &Tok,
 
     // Otherwise, this is an escape character.  Advance over it.
     bool HadError = false;
-    if (SpellingPtr[1] == 'u' || SpellingPtr[1] == 'U') {
+    if (SpellingPtr[1] == 'u' || SpellingPtr[1] == 'U' ||
+        SpellingPtr[1] == 'N') {
       const char *EscapePtr = SpellingPtr;
       unsigned Len = MeasureUCNEscape(SpellingStart, SpellingPtr, SpellingEnd,
                                       1, Features, HadError);

diff  --git a/clang/test/Lexer/char-escapes-delimited.c b/clang/test/Lexer/char-escapes-delimited.c
index 461122dcdb119..2b35e2a6282c4 100644
--- a/clang/test/Lexer/char-escapes-delimited.c
+++ b/clang/test/Lexer/char-escapes-delimited.c
@@ -4,15 +4,16 @@
 // RUN: %clang_cc1 -x c -std=gnu11 -fwchar-type=short -fno-signed-wchar -fsyntax-only -pedantic -verify %s
 
 const char *errors =
-    "\u{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\u{"   //expected-error {{expected '}'}}
-    "\u{h}" //expected-error {{invalid digit 'h' in escape sequence}}
-    "\x{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\x{"   //expected-error {{expected '}'}}
-    "\x{h}" //expected-error {{invalid digit 'h' in escape sequence}}
-    "\o{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\o{"   //expected-error {{expected '}'}}
-    "\o{8}" //expected-error {{invalid digit '8' in escape sequence}}
+    "\u{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\u{"   // expected-error {{expected '}'}}
+    "\u{h}" // expected-error {{invalid digit 'h' in escape sequence}}
+    "\x{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\x{"   // expected-error {{expected '}'}}
+    "\x{h}" // expected-error {{invalid digit 'h' in escape sequence}}
+    "\o{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\o{"   // expected-error {{expected '}'}}
+    "\o{8}" // expected-error {{invalid digit '8' in escape sequence}}
+    "\U{8}" // expected-error {{\U used with no following hex digits}}
     ;
 
 void ucn(void) {
@@ -70,6 +71,25 @@ void concat(void) {
   (void)"\o{12" "}"; // expected-error {{expected '}'}}
 }
 
+void named(void) {
+  char a = '\N{LOTUS}';       // expected-error{{character too large for enclosing character literal type}} \
+                        // expected-warning {{extension}}
+  char b = '\N{DOLLAR SIGN}'; // expected-warning {{extension}}
+
+  char c = '\N{NOTATHING}'; // expected-error {{'NOTATHING' is not a valid Unicode character name}}
+  char d = '\N{}';          // expected-error {{delimited escape sequence cannot be empty}}
+  char e = '\N{';           // expected-error {{delimited escape sequence cannot be empty}}
+
+  unsigned f = L'\N{GREEK CAPITAL LETTER DELTA}'; // expected-warning {{extension}}
+
+  unsigned g = u'\N{LOTUS}'; // expected-error {{character too large for enclosing character literal type}} \
+                             // expected-warning {{extension}}
+
+  unsigned h = U'\N{LOTUS}';                      // expected-warning {{extension}}
+  unsigned i = u'\N{GREEK CAPITAL LETTER DELTA}'; // expected-warning {{extension}}
+  char j = '\NN';                                 // expected-error {{expected '{' after '\N' escape sequence}}
+}
+
 void separators(void) {
   (void)"\x{12'3}"; // expected-error {{invalid digit ''' in escape sequence}}
   (void)"\u{12'3}"; // expected-error {{invalid digit ''' in escape sequence}}

diff  --git a/clang/test/Parser/cxx11-user-defined-literals.cpp b/clang/test/Parser/cxx11-user-defined-literals.cpp
index 143cdb502c041..1a7e780588229 100644
--- a/clang/test/Parser/cxx11-user-defined-literals.cpp
+++ b/clang/test/Parser/cxx11-user-defined-literals.cpp
@@ -131,6 +131,7 @@ int operator""_\u212e""_\U0000212e""_℮""(const char*, size_t);
 int operator""_\U0000212e""_℮""_\u212e""(const char*, size_t);
 
 int operator""_\u{212f}(char);
+int operator""_\N{SCRIPT SMALL E}(char);
 
 int mix_ucn_utf8 = ""_℮""_\u212e""_\U0000212e"";
 

diff  --git a/clang/test/Preprocessor/ucn-pp-identifier.c b/clang/test/Preprocessor/ucn-pp-identifier.c
index 1d91ad422b697..efbc6ecb46159 100644
--- a/clang/test/Preprocessor/ucn-pp-identifier.c
+++ b/clang/test/Preprocessor/ucn-pp-identifier.c
@@ -29,9 +29,14 @@
 
 // Make sure we reject disallowed UCNs
 #define \ufffe // expected-error {{macro name must be an identifier}}
-#define \U10000000  // expected-error {{macro name must be an identifier}}
-#define \u0061  // expected-error {{character 'a' cannot be specified by a universal character name}} expected-error {{macro name must be an identifier}}
-#define \u{fffe} // expected-error {{macro name must be an identifier}} expected-warning {{Clang extension}}
+#define \U10000000 // expected-error {{macro name must be an identifier}}
+#define \u0061     // expected-error {{character 'a' cannot be specified by a universal character name}} expected-error {{macro name must be an identifier}}
+#define \u{fffe}   // expected-error {{macro name must be an identifier}} expected-warning {{Clang extension}}
+#define \N{ALERT}  // expected-error {{universal character name refers to a control character}} \
+                   // expected-error {{macro name must be an identifier}} \
+                   // expected-warning {{Clang extension}}
+#define \N{WASTEBASKET} // expected-error {{macro name must be an identifier}} \
+                        // expected-warning {{Clang extension}}
 
 #define a\u0024
 
@@ -113,3 +118,9 @@ C 1
 #define \u{123456789}  // expected-error {{hex escape sequence out of range}} expected-error {{macro name must be an identifier}}
 #define \u{            // expected-warning {{incomplete delimited universal character name; treating as '\' 'u' '{' identifier}} expected-error {{macro name must be an identifier}}
 #define \u{fgh}        // expected-warning {{incomplete delimited universal character name; treating as '\' 'u' '{' identifier}} expected-error {{macro name must be an identifier}}
+#define \u{fgh}        // expected-warning {{incomplete delimited universal character name; treating as '\' 'u' '{' identifier}} expected-error {{macro name must be an identifier}}
+#define \N{            // expected-warning {{incomplete delimited universal character name; treating as '\' 'N' '{' identifier}} expected-error {{macro name must be an identifier}}
+#define \N{}           // expected-warning {{empty delimited universal character name; treating as '\' 'N' '{' '}'}} expected-error {{macro name must be an identifier}}
+#define \N{NOTATHING}  // expected-error {{'NOTATHING' is not a valid Unicode character name}} \
+                       // expected-error {{macro name must be an identifier}}
+#define \NN            // expected-warning {{incomplete universal character name; treating as '\' followed by identifier}} expected-error {{macro name must be an identifier}}

diff  --git a/clang/test/Sema/ucn-identifiers.c b/clang/test/Sema/ucn-identifiers.c
index 38106767f9ab5..fb7181f0beca2 100644
--- a/clang/test/Sema/ucn-identifiers.c
+++ b/clang/test/Sema/ucn-identifiers.c
@@ -18,6 +18,7 @@ void goodCalls(void) {
   über(2);
   \U000000FCber(3);
   \u{FC}ber(4); // expected-warning {{Clang extension}}
+  \N{LATIN SMALL LETTER U WITH DIAERESIS}ber(4); // expected-warning {{Clang extension}}
 }
 
 void badCalls(void) {

diff  --git a/llvm/CMakeLists.txt b/llvm/CMakeLists.txt
index 988c77b68c937..8348bc93faf6f 100644
--- a/llvm/CMakeLists.txt
+++ b/llvm/CMakeLists.txt
@@ -1073,6 +1073,7 @@ if( LLVM_INCLUDE_UTILS )
   add_subdirectory(utils/PerfectShuffle)
   add_subdirectory(utils/count)
   add_subdirectory(utils/not)
+  add_subdirectory(utils/UnicodeData)
   add_subdirectory(utils/yaml-bench)
 else()
   if ( LLVM_INCLUDE_TESTS )

diff  --git a/llvm/include/llvm/ADT/StringExtras.h b/llvm/include/llvm/ADT/StringExtras.h
index ee6c33924e963..0787e3635ed36 100644
--- a/llvm/include/llvm/ADT/StringExtras.h
+++ b/llvm/include/llvm/ADT/StringExtras.h
@@ -326,6 +326,8 @@ inline std::string toString(const APSInt &I, unsigned Radix) {
   return toString(I, Radix, I.isSigned());
 }
 
+std::string to_hexString(uint64_t Value, bool UpperCase = true);
+
 /// StrInStrNoCase - Portable version of strcasestr.  Locates the first
 /// occurrence of string 's1' in string 's2', ignoring case.  Returns
 /// the offset of s2 in s1 or npos if s2 cannot be found.

diff  --git a/llvm/include/llvm/Support/ScopedPrinter.h b/llvm/include/llvm/Support/ScopedPrinter.h
index fb26dd6cc3a3b..3c93a1541c79b 100644
--- a/llvm/include/llvm/Support/ScopedPrinter.h
+++ b/llvm/include/llvm/Support/ScopedPrinter.h
@@ -81,7 +81,6 @@ struct FlagEntry {
 };
 
 raw_ostream &operator<<(raw_ostream &OS, const HexNumber &Value);
-std::string to_hexString(uint64_t Value, bool UpperCase = true);
 
 template <class T> std::string to_string(const T &Value) {
   std::string number;

diff  --git a/llvm/include/llvm/Support/Unicode.h b/llvm/include/llvm/Support/Unicode.h
index ca17bba2fbb42..145d4e7b9c0e2 100644
--- a/llvm/include/llvm/Support/Unicode.h
+++ b/llvm/include/llvm/Support/Unicode.h
@@ -14,6 +14,9 @@
 #ifndef LLVM_SUPPORT_UNICODE_H
 #define LLVM_SUPPORT_UNICODE_H
 
+#include "llvm/ADT/Optional.h"
+#include "llvm/ADT/SmallString.h"
+
 namespace llvm {
 class StringRef;
 
@@ -63,6 +66,23 @@ int columnWidthUTF8(StringRef Text);
 /// rules.
 int foldCharSimple(int C);
 
+/// Maps the name or the alias of a Unicode character to its associated
+/// codepoints.
+/// The names and aliases are derived from UnicodeData.txt and NameAliases.txt
+/// For compatibility with the semantics of named character escape sequences in
+/// C++, this mapping does an exact match sensitive to casing and spacing.
+/// \return The codepoint of the corresponding character, if any.
+
+llvm::Optional<char32_t> nameToCodepointStrict(StringRef Name);
+
+struct LooseMatchingResult {
+  char32_t CodePoint;
+  llvm::SmallString<64> Name;
+};
+
+llvm::Optional<LooseMatchingResult>
+nameToCodepointLooseMatching(StringRef Name);
+
 } // namespace unicode
 } // namespace sys
 } // namespace llvm

diff  --git a/llvm/lib/Support/CMakeLists.txt b/llvm/lib/Support/CMakeLists.txt
index 7cbff3dddbcdf..e60f47e890d5d 100644
--- a/llvm/lib/Support/CMakeLists.txt
+++ b/llvm/lib/Support/CMakeLists.txt
@@ -220,6 +220,8 @@ add_llvm_component_library(LLVMSupport
   TypeSize.cpp
   Unicode.cpp
   UnicodeCaseFold.cpp
+  UnicodeNameToCodepoint.cpp
+  UnicodeNameToCodepointGenerated.cpp
   VersionTuple.cpp
   VirtualFileSystem.cpp
   WithColor.cpp

diff  --git a/llvm/lib/Support/ScopedPrinter.cpp b/llvm/lib/Support/ScopedPrinter.cpp
index a434e50e8c1fb..235f5911631e3 100644
--- a/llvm/lib/Support/ScopedPrinter.cpp
+++ b/llvm/lib/Support/ScopedPrinter.cpp
@@ -11,13 +11,6 @@ raw_ostream &operator<<(raw_ostream &OS, const HexNumber &Value) {
   return OS;
 }
 
-std::string to_hexString(uint64_t Value, bool UpperCase) {
-  std::string number;
-  llvm::raw_string_ostream stream(number);
-  stream << format_hex_no_prefix(Value, 1, UpperCase);
-  return stream.str();
-}
-
 void ScopedPrinter::printBinaryImpl(StringRef Label, StringRef Str,
                                     ArrayRef<uint8_t> Data, bool Block,
                                     uint32_t StartOffset) {

diff  --git a/llvm/lib/Support/StringExtras.cpp b/llvm/lib/Support/StringExtras.cpp
index 5683d7005584e..a777a5810893f 100644
--- a/llvm/lib/Support/StringExtras.cpp
+++ b/llvm/lib/Support/StringExtras.cpp
@@ -12,6 +12,7 @@
 
 #include "llvm/ADT/StringExtras.h"
 #include "llvm/ADT/SmallVector.h"
+#include "llvm/Support/Format.h"
 #include "llvm/Support/raw_ostream.h"
 #include <cctype>
 
@@ -30,6 +31,13 @@ StringRef::size_type llvm::StrInStrNoCase(StringRef s1, StringRef s2) {
   return StringRef::npos;
 }
 
+std::string llvm::to_hexString(uint64_t Value, bool UpperCase) {
+  std::string number;
+  llvm::raw_string_ostream stream(number);
+  stream << format_hex_no_prefix(Value, 1, UpperCase);
+  return stream.str();
+}
+
 /// getToken - This function extracts one token from source, ignoring any
 /// leading characters that appear in the Delimiters string, and ending the
 /// token at any of the characters that appear in the Delimiters string.  If

diff  --git a/llvm/lib/Support/UnicodeNameToCodepoint.cpp b/llvm/lib/Support/UnicodeNameToCodepoint.cpp
new file mode 100644
index 0000000000000..51902125c62c7
--- /dev/null
+++ b/llvm/lib/Support/UnicodeNameToCodepoint.cpp
@@ -0,0 +1,404 @@
+//===- llvm/Support/UnicodeNameToCodepoint.cpp - Unicode character properties
+//-*- C++ -*-===//
+//
+// Part of the LLVM Project, under the Apache License v2.0 with LLVM Exceptions.
+// See https://llvm.org/LICENSE.txt for license information.
+// SPDX-License-Identifier: Apache-2.0 WITH LLVM-exception
+//
+//===----------------------------------------------------------------------===//
+//
+// This file implements functions to map the name or alias of a unicode
+// character to its codepoint.
+//
+//===----------------------------------------------------------------------===//
+
+#include "llvm/ADT/STLExtras.h"
+#include "llvm/ADT/StringExtras.h"
+#include "llvm/ADT/StringRef.h"
+#include "llvm/Support/Unicode.h"
+
+namespace llvm {
+namespace sys {
+namespace unicode {
+
+extern const char *UnicodeNameToCodepointDict;
+extern const uint8_t *UnicodeNameToCodepointIndex;
+extern const std::size_t UnicodeNameToCodepointIndexSize;
+
+using BufferType = SmallString<64>;
+
+struct node {
+  char32_t value = 0xFFFFFFFF;
+  uint32_t children_offset = 0;
+  bool has_sibling = false;
+  uint32_t size = 0;
+  StringRef name;
+
+  constexpr bool is_valid() const {
+    return name.size() != 0 || value == 0xFFFFFFFF;
+  }
+  constexpr bool has_children() const { return children_offset != 0; }
+};
+
+static node read_node(uint32_t offset) {
+  const uint32_t origin = offset;
+  node n;
+
+  uint8_t nameInfo = UnicodeNameToCodepointIndex[offset++];
+  if (offset + 6 >= UnicodeNameToCodepointIndexSize)
+    return n;
+
+  const bool long_name = nameInfo & 0x40;
+  const bool has_value = nameInfo & 0x80;
+  std::size_t size = nameInfo & ~0xC0;
+  if (long_name) {
+    uint32_t name_offset = (UnicodeNameToCodepointIndex[offset++] << 8);
+    name_offset |= UnicodeNameToCodepointIndex[offset++];
+    n.name = StringRef(UnicodeNameToCodepointDict + name_offset, size);
+  } else {
+    n.name = StringRef(UnicodeNameToCodepointDict + size, 1);
+  }
+  if (has_value) {
+    uint8_t h = UnicodeNameToCodepointIndex[offset++];
+    uint8_t m = UnicodeNameToCodepointIndex[offset++];
+    uint8_t l = UnicodeNameToCodepointIndex[offset++];
+    n.value = ((h << 16) | (m << 8) | l) >> 3;
+
+    bool has_children = l & 0x02;
+    n.has_sibling = l & 0x01;
+
+    if (has_children) {
+      n.children_offset = UnicodeNameToCodepointIndex[offset++] << 16;
+      n.children_offset |= UnicodeNameToCodepointIndex[offset++] << 8;
+      n.children_offset |= UnicodeNameToCodepointIndex[offset++];
+    }
+  } else {
+    uint8_t h = UnicodeNameToCodepointIndex[offset++];
+    n.has_sibling = h & 0x80;
+    bool has_children = h & 0x40;
+    h &= ~0xC0;
+    if (has_children) {
+      n.children_offset = (h << 16);
+      n.children_offset |=
+          (uint32_t(UnicodeNameToCodepointIndex[offset++]) << 8);
+      n.children_offset |= UnicodeNameToCodepointIndex[offset++];
+    }
+  }
+  n.size = offset - origin;
+  return n;
+}
+
+static bool StartsWith(StringRef Name, StringRef Needle, bool Strict,
+                       std::size_t &Consummed, char &PreviousCharInName,
+                       char &PreviousCharInNeedle) {
+
+  Consummed = 0;
+  if (Strict) {
+    if (!Name.startswith(Needle))
+      return false;
+    Consummed = Needle.size();
+    return true;
+  }
+  if (Needle.size() == 0)
+    return true;
+
+  auto NamePos = Name.begin();
+  auto NeedlePos = Needle.begin();
+
+  char PreviousCharInNameOrigin = PreviousCharInName;
+  char PreviousCharInNeedleOrigin = PreviousCharInNeedle;
+
+  auto IgnoreSpaces = [](auto It, auto End, char &PreviousChar) {
+    while (It != End) {
+      bool Ignore =
+          *It == ' ' || *It == '_' || (*It == '-' && PreviousChar != ' ');
+      PreviousChar = *It;
+      if (!Ignore)
+        break;
+      ++It;
+    }
+    return It;
+  };
+
+  while (true) {
+    NeedlePos = IgnoreSpaces(NeedlePos, Needle.end(), PreviousCharInNeedle);
+    NamePos = IgnoreSpaces(NamePos, Name.end(), PreviousCharInName);
+    if (NeedlePos == Needle.end())
+      break;
+    if (NamePos == Name.end())
+      break;
+    if (toUpper(*NeedlePos) != toUpper(*NamePos))
+      break;
+    NeedlePos++;
+    NamePos++;
+  }
+  Consummed = std::distance(Name.begin(), NamePos);
+  if (NeedlePos == Needle.end()) {
+    PreviousCharInName = PreviousCharInNameOrigin;
+    PreviousCharInNeedle = PreviousCharInNeedleOrigin;
+  }
+  return NeedlePos == Needle.end();
+}
+
+static std::tuple<node, bool, uint32_t>
+compare_node(uint32_t offset, StringRef name, bool Strict,
+             char PreviousCharInName, char PreviousCharInNeedle,
+             BufferType &Buffer) {
+  auto n = read_node(offset);
+  std::size_t Consummed = 0;
+  bool DoesStartWith = StartsWith(name, n.name, Strict, Consummed,
+                                  PreviousCharInName, PreviousCharInNeedle);
+  if (!DoesStartWith) {
+    return {n, false, 0};
+  }
+
+  if (name.size() - Consummed == 0) {
+    // std::reverse_copy(n.name.begin(), n.name.end(),
+    // std::back_inserter(Buffer));
+    return {n, true, n.value};
+  }
+  if (n.has_children()) {
+    auto o = n.children_offset;
+    for (;;) {
+      node c;
+      bool matches;
+      uint32_t value;
+      std::tie(c, matches, value) =
+          compare_node(o, name.substr(Consummed), Strict, PreviousCharInName,
+                       PreviousCharInNeedle, Buffer);
+      if (matches) {
+        std::reverse_copy(c.name.begin(), c.name.end(),
+                          std::back_inserter(Buffer));
+        return {n, true, value};
+      }
+      o += c.size;
+      if (!c.has_sibling)
+        break;
+    }
+  }
+  return {n, false, 0};
+}
+
+static std::tuple<node, bool, uint32_t>
+compare_node(uint32_t offset, StringRef Name, bool Strict, BufferType &Buffer) {
+  return compare_node(offset, Name, Strict, 0, 0, Buffer);
+}
+
+// clang-format off
+constexpr const char *const hangul_syllables[][3] = {
+    { "G",  "A",   ""   },
+    { "GG", "AE",  "G"  },
+    { "N",  "YA",  "GG" },
+    { "D",  "YAE", "GS" },
+    { "DD", "EO",  "N", },
+    { "R",  "E",   "NJ" },
+    { "M",  "YEO", "NH" },
+    { "B",  "YE",  "D"  },
+    { "BB", "O",   "L"  },
+    { "S",  "WA",  "LG" },
+    { "SS", "WAE", "LM" },
+    { "",   "OE",  "LB" },
+    { "J",  "YO",  "LS" },
+    { "JJ", "U",   "LT" },
+    { "C",  "WEO", "LP" },
+    { "K",  "WE",  "LH" },
+    { "T",  "WI",  "M"  },
+    { "P",  "YU",  "B"  },
+    { "H",  "EU",  "BS" },
+    { 0,    "YI",  "S"  },
+    { 0,    "I",   "SS" },
+    { 0,    0,     "NG" },
+    { 0,    0,     "J"  },
+    { 0,    0,     "C"  },
+    { 0,    0,     "K"  },
+    { 0,    0,     "T"  },
+    { 0,    0,     "P"  },
+    { 0,    0,     "H"  }
+    };
+// clang-format on
+
+// Unicode 14.0  3.12 Conjoining Jamo Behavior
+//  Common constants
+constexpr const char32_t SBase = 0xAC00;
+// constexpr const char32_t LBase = 0x1100;
+// constexpr const char32_t VBase = 0x1161;
+// constexpr const char32_t TBase = 0x11A7;
+constexpr const uint32_t LCount = 19;
+constexpr const uint32_t VCount = 21;
+constexpr const uint32_t TCount = 28;
+// constexpr const uint32_t NCount = (VCount * TCount);
+// constexpr const uint32_t SCount = (LCount * NCount);
+
+static std::size_t findSyllable(StringRef Name, bool Strict,
+                                char &PreviousInName, int &Pos, int Column) {
+  assert(Column == 0 || Column == 1 || Column == 2);
+  static std::size_t CountPerColumn[] = {LCount, VCount, TCount};
+  char NeedleStart = 0;
+  int Len = -1;
+  int Prev = PreviousInName;
+  for (std::size_t i = 0; i < CountPerColumn[Column]; i++) {
+    StringRef Syllable(hangul_syllables[i][Column]);
+    if (int(Syllable.size()) <= Len)
+      continue;
+    std::size_t Consummed = 0;
+    char PreviousInNameCopy = PreviousInName;
+    bool DoesStartWith = StartsWith(Name, Syllable, Strict, Consummed,
+                                    PreviousInNameCopy, NeedleStart);
+    if (!DoesStartWith)
+      continue;
+    Len = Consummed;
+    Pos = i;
+    Prev = PreviousInNameCopy;
+  }
+  if (Len == -1)
+    return 0;
+  PreviousInName = Prev;
+  return size_t(Len);
+}
+
+static llvm::Optional<char32_t>
+nameToHangulCodePoint(StringRef Name, bool Strict, BufferType &Buffer) {
+  Buffer.clear();
+  // Hangul Syllable Decomposition
+  std::size_t Consummed = 0;
+  char NameStart = 0, NeedleStart = 0;
+  bool DoesStartWith = StartsWith(Name, "HANGUL SYLLABLE ", Strict, Consummed,
+                                  NameStart, NeedleStart);
+  if (!DoesStartWith)
+    return {};
+  Name = Name.substr(Consummed);
+  int L = -1, V = -1, T = -1;
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, L, 0));
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, V, 1));
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, T, 2));
+  if (L != -1 && V != -1 && T != -1 && Name.size() == 0) {
+    if (!Strict) {
+      Buffer.append("HANGUL SYLLABLE ");
+      if (L != -1)
+        Buffer.append(hangul_syllables[L][0]);
+      if (V != -1)
+        Buffer.append(hangul_syllables[V][1]);
+      if (T != -1)
+        Buffer.append(hangul_syllables[T][2]);
+    }
+    return SBase + (std::uint32_t(L) * VCount + std::uint32_t(V)) * TCount +
+           std::uint32_t(T);
+  }
+  // Otherwise, it's an illegal syllable name.
+  return {};
+}
+
+struct generated_name_data {
+  StringRef prefix;
+  uint32_t start;
+  uint32_t end;
+};
+
+// Unicode 14.0 Table 4-8. Name Derivation Rule Prefix Strings
+// This needs to be kept in sync with
+// llvm/utils/UnicodeData/UnicodeNameMappingGenerator.cpp
+static const generated_name_data generated_name_data_table[] = {
+    {"CJK UNIFIED IDEOGRAPH-", 0x3400, 0x4DBF},
+    {"CJK UNIFIED IDEOGRAPH-", 0x4E00, 0x9FFC},
+    {"CJK UNIFIED IDEOGRAPH-", 0x20000, 0x2A6DD},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2A700, 0x2B734},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2B740, 0x2B81D},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2B820, 0x2CEA1},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2CEB0, 0x2EBE0},
+    {"CJK UNIFIED IDEOGRAPH-", 0x30000, 0x3134A},
+    {"TANGUT IDEOGRAPH-", 0x17000, 0x187F7},
+    {"TANGUT IDEOGRAPH-", 0x18D00, 0x18D08},
+    {"KHITAN SMALL SCRIPT CHARACTER-", 0x18B00, 0x18CD5},
+    {"NUSHU CHARACTER-", 0x1B170, 0x1B2FB},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0xF900, 0xFA6D},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0xFA70, 0xFAD9},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0x2F800, 0x2FA1D},
+};
+
+static llvm::Optional<char32_t>
+nameToGeneratedCodePoint(StringRef Name, bool Strict, BufferType &Buffer) {
+  for (auto &&item : generated_name_data_table) {
+    Buffer.clear();
+    std::size_t Consummed = 0;
+    char NameStart = 0, NeedleStart = 0;
+    bool DoesStartWith = StartsWith(Name, item.prefix, Strict, Consummed,
+                                    NameStart, NeedleStart);
+    if (!DoesStartWith)
+      continue;
+    auto Number = Name.substr(Consummed);
+    unsigned long long v = 0;
+    // Be consistent about mandating uper casing
+    if (Strict &&
+        llvm::any_of(Number, [](char c) { return c >= 'a' && c <= 'f'; }))
+      return {};
+    if (getAsUnsignedInteger(Number, 16, v) || v < item.start || v > item.end)
+      continue;
+    if (!Strict) {
+      Buffer.append(item.prefix);
+      Buffer.append(to_hexString(v, true));
+    }
+    return v;
+  }
+  return {};
+}
+
+static llvm::Optional<char32_t> nameToCodepoint(StringRef name, bool Strict,
+                                                BufferType &Buffer) {
+
+  if (name.empty())
+    return {};
+  llvm::Optional<char32_t> Res = nameToHangulCodePoint(name, Strict, Buffer);
+  if (!Res)
+    Res = nameToGeneratedCodePoint(name, Strict, Buffer);
+  if (Res)
+    return *Res;
+
+  uint32_t offset = 0;
+  for (;;) {
+    Buffer.clear();
+    node node;
+    bool matches;
+    uint32_t value;
+    std::tie(node, matches, value) = compare_node(offset, name, Strict, Buffer);
+    if (!node.is_valid())
+      continue;
+    if (matches) {
+      std::reverse_copy(node.name.begin(), node.name.end(),
+                        std::back_inserter(Buffer));
+      // UAX44-LM2. Ignore case, whitespace, underscore ('_'), and all medial
+      // hyphens except the hyphen in U+1180 HANGUL JUNGSEONG O-E.
+      if (Strict && value == 0x116c &&
+          name.find_insensitive("O-E") != StringRef::npos) {
+        Buffer = "HANGUL JUNGSEONG O-E";
+        value = 0x1180;
+      }
+      return value;
+    }
+    if (!node.has_sibling)
+      break;
+    offset += node.size;
+  }
+  return {};
+}
+
+llvm::Optional<char32_t> nameToCodepointStrict(StringRef name) {
+
+  BufferType Buffer;
+  auto Opt = nameToCodepoint(name, true, Buffer);
+  return Opt;
+}
+
+llvm::Optional<LooseMatchingResult>
+nameToCodepointLooseMatching(StringRef name) {
+  BufferType Buffer;
+  auto Opt = nameToCodepoint(name, false, Buffer);
+  if (!Opt)
+    return {};
+  std::reverse(Buffer.begin(), Buffer.end());
+  return LooseMatchingResult{*Opt, Buffer};
+}
+
+} // namespace unicode
+
+} // namespace sys
+} // namespace llvm

diff  --git a/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp b/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
new file mode 100644
index 0000000000000..aa7db2f47cd98
--- /dev/null
+++ b/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
@@ -0,0 +1,20167 @@
+//===-------------- Support/UnicodeNameToCodepointGenerated.cpp -----------===//
+//
+// This file was generated using ./bin/UnicodeNameMappingGenerator. Do not edit
+// manually.//
+//===----------------------------------------------------------------------===//
+#include "llvm/Support/Compiler.h"
+#include <cstdint>
+namespace llvm {
+namespace sys {
+namespace unicode {
+const char *UnicodeNameToCodepointDict =
+    "	 #ABCDEFGHIJKLMNOPQRSTUVWXYZ_-0123456789LOWER LEFT CURLY BRACKET "
+    "SECTION HORIZONTAL STROKES TO THE RIGHTS AND UPWARDS OPEN CIRCLE "
+    "ARROWSLAR SIGN WITH OVERLAID BACKSLASH CONTAINING SMALL WHITE "
+    "TRIANGLEESS-THAN ABOVE DOUBLE-LINE EQUALLAGAB TIMES U OVER LAGAB TIMES "
+    "URONG CENTRALIZATION STROKE BELOWHAND WITH MIDDLE FINGER "
+    "EXTENDEDFT-POINTING ANGLE QUOTATION MARKMARK WITH LEFT RIGHT ARROW ABOVEL "
+    "ARABIC LETTER TAH AND TWO DOTSDIFIER LETTER LABIALIZATION MARKED UPWARDS "
+    "EQUILATERAL ARROWHEADD ARROW WITH TRIANGLE ARROWHEADSH SUPERSCRIPT ALEF "
+    "ISOLATED FORMER TAB NI OVER NI DISH OVER DISHDIC KASHMIRI INDEPENDENT "
+    "SVARITA BETWEEN MIDDLE AND RING FINGERSOUBLE-LINE EQUAL ABOVE LESS-THAN "
+    "LEFTWARDS TRIANGLE-HEADED ARROW BAR AT END OF HORIZONTAL STROKE SHADOWED "
+    "WHITE RIGHTWARDS ARROWWO DOTS ABOVE AND TWO DOTS BELOWRONT-TILTED "
+    "SHADOWED WHITE ARROWATHARVAVEDIC INDEPENDENT SVARITASWIRL BIRGA WITH "
+    "DOUBLE ORNAMENTER IGI SHIR OVER SHIR UD OVER UDM LEFT MEMBER OF DOUBLE "
+    "VERTICALRIGHT SEMICIRCLE WITH THREE DOTSTER-THAN ABOVE DOUBLE-LINE "
+    "EQUALED COMMA QUOTATION MARK ORNAMENT LOWER HALF INVERSE MEDIUM "
+    "SHADESEMICIRCULAR ANTICLOCKWISE ARROWNORMAL FACTOR SEMIDIRECT PRODUCTED "
+    "ARABIC-INDIC DIGIT FOUR BELOWED ARABIC-INDIC DIGIT FOUR "
+    "ABOVERIANGLE-HEADED OPEN CIRCLE ARROWVED STEM PARAGRAPH SIGN ORNAMENTWO "
+    "DOTS OVER ONE DOT PUNCTUATIONLEFTWARDS HARPOON WITH BARB DOWNVE LESS-THAN "
+    "ABOVE SLANTED EQUALTICAL BAR DOUBLE RIGHT TURNSTILEWNWARDS ARROW WITH TIP "
+    "LEFTWARDSUG2 OVER TUG2 TUG2 OVER TUG2 PAP DOWNWARDS TRIANGLE-HEADED ARROW "
+    "DOWNWARDS EQUILATERAL ARROWHEADGREATER-THAN ABOVE SLANTED EQUALROFLEX "
+    "CLICK WITH RETROFLEX HOOKLL BUT UPPER LEFT QUADRANT BLACK TRIANGULAR "
+    "THREE QUARTERS BLOCKLE-LINE EQUAL ABOVE GREATER-THANTOP HALF DIVIDED BY "
+    "VERTICAL BARLE COMMA QUOTATION MARK ORNAMENT TORTOISE SHELL BRACKET "
+    "ORNAMENTETALLED BLACK AND WHITE FLORETTEH HAMZA ABOVE WITH ALEF MAKSURA H "
+    "HORIZONTAL MIDDLE BLACK STRIPEE TO MIDDLE LEFT TO LOWER CENTREAISING BOTH "
+    "HANDS IN CELEBRATIONOWNWARDS HARPOON WITH BARB RIGHTIDE AND JOINED WITH "
+    "INTERSECTIONFACE WITH SYMBOLS COVERING MOUTHTIMES ASH2 KU OVER HI TIMES "
+    "ASH2PER BODY TILTING FROM HIP JOINTS-POINTING ANGLE BRACKET ORNAMENT "
+    "KORANIC STOP SIGN ISOLATED FORMINTING DOWNWARDS THEN NORTH EASTDED HIGH "
+    "STOP WITH FILLED CENTREARDS HARPOON WITH BARB DOWNWARDSE-POINTED BLACK "
+    "RIGHTWARDS ARROW-SHADOWED WHITE RIGHTWARDS ARROWE SQUARED LATIN CAPITAL "
+    "LETTER PARDS ARROW ABOVE LEFTWARDS ARROWARDROP-SPOKED PROPELLER "
+    "ASTERISKEN ARM ENDING IN ARROW POINTING IGHTWARDS HARPOON WITH BARB "
+    "DOWNOWER RIGHT CURLY BRACKET SECTIONAND LEFTWARDS OPEN CIRCLE ARROWSTION "
+    "SIGN WITH CIRCUMFLEX ACCENTE CONTAINING BLACK SMALL LOZENGEAND MIDDLE "
+    "RIGHT TO LOWER CENTRES VERTICALLY BELOW AND SMALL TAHTOM-LIGHTED "
+    "RIGHTWARDS ARROWHEADER ARROWS CIRCLING ANTICLOCKWISETHIRD WHITE RIGHT "
+    "POINTING INDEXUPPER AND LOWER ONE EIGHTH BLOCKROXIMATELY NOR ACTUALLY "
+    "EQUAL TOEDIUM SHADE AND LOWER HALF BLOCKHT-POINTING ANGLE QUOTATION "
+    "MARKTRIANGLE-HEADED RIGHTWARDS ARROWEDIUM SHADE AND RIGHT HALF BLOCKOF "
+    "UPWARDS TRIANGLE-HEADED ARROWHUR KAZAKH KIRGHIZ ALEF MAKSURA IRECT "
+    "PRODUCT WITH BOTTOM CLOSEDRIGHTWARDS TRIANGLE-HEADED ARROWLEFTWARDS "
+    "EQUILATERAL ARROWHEADRINGS OVER ONE RING PUNCTUATIONUPWARDS HARPOON WITH "
+    "BARB RIGHTAND MIDDLE LEFT TO LOWER CENTREACK-TILTED SHADOWED WHITE "
+    "ARROWETALLED OUTLINED BLACK FLORETTEONE HUNDRED THIRTY-FIVE DEGREESAISED "
+    "HAND WITH FINGERS SPLAYED CROSSING ASH OVER ASH OVER ASHTNAMESE ALTERNATE "
+    "READING MARK RING OVER TWO RINGS PUNCTUATIONRIGHTWARDS HARPOON WITH BARB "
+    "UPIN WHITE CIRCLE IN BLACK SQUARE-HIRAGANA PROLONGED SOUND MARKOPEN "
+    "CENTRE EIGHT POINTED STARHT CENTRALIZATION STROKE BELOWMINTON RACQUET AND "
+    "SHUTTLECOCKDOWNWARDS AND RIGHTWARDS ARROWAND JOINED BY DASH WITH SUBSETON "
+    "WITH RIGHTWARDS ARROW ABOVEGHT FOUR POINTED PINWHEEL STARINDEX THUMB "
+    "CURVE THUMB INSIDEEFT SEMICIRCLE WITH THREE DOTSEART EXCLAMATION MARK "
+    "ORNAMENTMAKSURA WITH SUPERSCRIPT ALEF AGGRAVATED INDEPENDENT "
+    "SVARITAHIGH-REVERSED-9 QUOTATION MARKMODIFIER LETTER LEFT HALF RINGDOT "
+    "BELOW AND THREE DOTS ABOVEGREATER-THAN ABOVE EQUALS SIGNQAF WITH LAM WITH "
+    "ALEF MAKSURASAD WITH LAM WITH ALEF MAKSURADIVIDED BY HORIZONTAL BAR AND "
+    "EXTENDED ARABIC-INDIC DIGIT TDOT OVER TWO DOTS PUNCTUATION OVER "
+    "RIGHTWARDS ARROW TO BARLIGHT FOUR POINTED BLACK CUSPCKED FACE WITH "
+    "EXPLODING HEAD WITH REVERSED NEGATION SLASHDOWN MIDDLE THUMB INDEX "
+    "CROSSDOWN HEAVY AND RIGHT UP LIGHTEFTWARDS HARPOON WITH BARB "
+    "UPSUPERSCRIPT ALEF INITIAL FORMWITH RIGHTWARDS ARROW AT LEFT DOWN INDEX "
+    "THUMB HOOK MIDDLENS-SERIF INTERROBANG ORNAMENTPUNCTUATION CHINOOK FULL "
+    "STOPEVERSED LUNATE EPSILON SYMBOLUP HEAVY AND RIGHT DOWN LIGHTCONTAINING "
+    "BLACK SMALL CIRCLESEMICIRCULAR PATH AROUND POLEONAL INDICATOR SYMBOL "
+    "LETTER T LITTER IN ITS PLACE SYMBOLUPWARDS AND RIGHTWARDS ARROWACE "
+    "DIRECTION POSITION NOSE U ALAYHI WAAALIHEE WA-SALLAMHREE HUNDRED FIFTEEN "
+    "DEGREESUPPER CENTRE TO MIDDLE RIGHTISMILLAH AR-RAHMAN AR-RAHEEMASTERISKS "
+    "ALIGNED VERTICALLYIBE SYLLABLE BOUNDARY MARKERSALTIRE WITH ROUNDED "
+    "CORNERSUP HEAVY AND LEFT DOWN LIGHTMONOGRAMMOS TESSERA "
+    "DODEKATARECTANGULAR PATH AROUND POLELIQUID MEASURE FIRST SUBUNITLEFTWARDS "
+    "OF DOWNWARDS ARROWEFT ARC GREATER-THAN BRACKETDOUBLE ANUSVARA "
+    "ANTARGOMUKHAHADED WHITE RIGHTWARDS ARROWDOWN HEAVY AND LEFT UP LIGHTFTING "
+    "POINT RIGHTWARDS ARROWMIDDLE RING LITTLE CONJOINEDBESIDE AND JOINED WITH "
+    "UNIONOUND-TIPPED RIGHTWARDS ARROWEDGE-TAILED RIGHTWARDS ARROWPHARYNGEAL "
+    "VOICED FRICATIVEENTATION FORM FOR VERTICAL CONTINUOUS UNDERLINE "
+    "SYMBOLEMICIRCULAR CLOCKWISE ARROW-FEATHERED RIGHTWARDS ARROWDOUBLE ANGLE "
+    "QUOTATION MARKTALIC LATIN CAPITAL LETTER IDE-HEADED RIGHTWARDS ARROW AND "
+    "LEFT SEMICIRCLE ARROWSRIANGULAR ONE QUARTER BLOCKWALLPLANE SHOULDER HIP "
+    "MOVEIDE ARC ANTICLOCKWISE ARROW DIVIDED BY HORIZONTAL RULEDOUBLE PRIME "
+    "QUOTATION MARKRIPLE VERTICAL BAR OPERATORLARGE EQUILATERAL "
+    "ARROWHEADSTRUMENTAL NOTATION SYMBOL-EAVY WHITE RIGHTWARDS ARROWBRDA "
+    "RNYING YIG MGO MDUN MABETWEEN TWO HORIZONTAL BARSHANDED INTERLACED "
+    "PENTAGRAMUPPER MIDDLE LEFT TO UPPER OUR BALLOON-SPOKED ASTERISKPPY PERSON "
+    "RAISING ONE HANDHEAD MARK WITH MOON AND SUNRIGHT ARC LESS-THAN "
+    "BRACKETKATHAKA INDEPENDENT SVARITA BARREE WITH TWO DOTS BELOWCIRCLE WITH "
+    "NORTHWEST ARROWTWO HUNDRED SEVENTY DEGREESWO DOTS BELOW AND DOT ABOVEBRDA "
+    "RNYING YIG MGO SGAB MAIMPERFECTUM CUM PROLATIONE FOUR FINGERS CONJOINED "
+    "BENTLOWER MIDDLE LEFT TO LOWER LOWER TONAL RANGE INDICATORZERO FOR ODD "
+    "POWERS OF FOURLIGHT CENTRALIZATION STROKEONE LARGE AND ONE SMALL "
+    "EYELESS-THAN ABOVE EQUALS SIGNFINGER COVERING CLOSED LIPSCLOCKWISE ARROW "
+    "WITH MINUSJECT REPLACEMENT CHARACTERHTORA SKLIRON CHROMA VASISAND RIGHT "
+    "ONE EIGHTH BLOCKAND MIDDLE FINGERS CROSSEDOTATED FLORAL HEART "
+    "BULLETUNEVEN EYES AND WAVY MOUTHINDUSTRIAL STANDARD SYMBOLSSIAN "
+    "ASTROLOGICAL SYMBOL YAJURVEDIC MIDLINE SVARITARIGHT PARENTHESIS "
+    "ORNAMENTIDEOGRAPHIC ITERATION MARKORTHOGONAL CROSSHATCH FILLALEF MAKSURA "
+    "ISOLATED FORMLEFTWARDS OF UPWARDS ARROWTHREE DOTS ABOVE DOWNWARDSMARRIED "
+    "PARTNERSHIP SYMBOLCAT FACE WITH SMILING EYES WITHIN TRIANGLE "
+    "ARROWHEADONOMICAL SYMBOL FOR URANUSLINE FEED SEPARATOR SYMBOLU REVERSED "
+    "OVER U REVERSEDRIPLE DOT PUNCTUATION MARKMODIFIER FITZPATRICK "
+    "TYPE-LLALLAHOU ALAYHE WASSALLAMMEEM WITH HAH WITH TATWEELCRIPT LIGATURE "
+    "ET ORNAMENTBLE TENNIS PADDLE AND BALLWITH LEFTWARDS ARROW ABOVELANTED "
+    "SOUTH ARROW WITH HOOORPLANE SHOULDER HIP MOVEERSTRASS ELLIPTIC "
+    "FUNCTIONDOTTED SUBSTITUTION MARKER OR APPROXIMATELY EQUAL TOE ONE-WAY "
+    "LEFT WAY TRAFFIC GAD OVER GAD GAR OVER GAROCKED FEMALE AND MALE SIGN "
+    "NEGATED WITH VERTICAL BAR LESS THAN THE DENOMINATORDROP-SHADOWED WHITE "
+    "SQUAREDOTTED LUNATE SIGMA SYMBOL WITH CIRCLED ONE OVERLAYBUT NOT ACTUALLY "
+    "EQUAL TOOUTLINED RIGHTWARDS ARROWMULTIPLICATION SIGN BELOWRIST CIRCLE "
+    "HITTING WALL CROSSING NORTH EAST ARROWTTED SUBSTITUTION "
+    "BRACKETREE-HUNDRED-AND-TWENTIETHDRY MEASURE FIRST SUBUNITOUBLE BIRGA WITH "
+    "ORNAMENTTERNION INTEGRAL OPERATOROLD ASSYRIAN WORD DIVIDERLEFTWARDS ARROW "
+    "WITH HOOKONE UNDER EIGHTEEN SYMBOLLEFT PARENTHESIS ORNAMENTNIVERSAL "
+    "RECYCLING SYMBOLINVERTED EXCLAMATION MARKSTROKE AND TWO DOTS "
+    "ABOVEFFICULTY AT THE BEGINNINGRANCH BANK IDENTIFICATIONFECTIVENESS OR "
+    "DISTORTIONRIPLE BIRGA WITH ORNAMENTING ON THE FLOOR LAUGHINGLOW QUILT "
+    "SQUARE ORNAMENTCAT FACE WITH CLOSED EYESRIGHT DIAGONAL HALF BLACKDOUBLE "
+    "CANDRABINDU VIRAMAMBINING CRYPTOGRAMMIC DOT WITH DOUBLE VERTICAL BAR WITH "
+    "DOUBLE MIDDLE TILDE WITH DOUBLE GRAVE ACCENTBREVE WITH INVERTED BREVETAB "
+    "OVER TAB GAR OVER GARMEDIUM TRIANGLE ARROWHEAD OVER NUN LAGAR TIMES "
+    "SALDIAERESIS AND HOOK SYMBOLELD HOCKEY STICK AND BALLOTTOM-SHADED WHITE "
+    "ARROWTED INTERPOLATION MARKERCONSECUTIVE EQUALS SIGNSWO DOTS VERTICALLY "
+    "ABOVEING FACE WITH OPEN MOUTHBERKANAN BEORC BJARKAN BARM CIRCLE HITTING "
+    "WALL STROKE THROUGH DESCENDEREYES AND HAND OVER MOUTHEQUAL TO OR "
+    "GREATER-THANOTTOM SHADED WHITE ARROWITAN SMALL SCRIPT FILLERLARGE "
+    "TRIANGLE ARROWHEAD OVER TOP SQUARE BRACKETAND MALE AND FEMALE SIGNCULINE "
+    "ORDINAL INDICATORDIAGONAL CROSSHATCH FILLINTERSECTION WITH SERIFSSMALL "
+    "ARABIC LETTER TAH GLOTTAL STOP WITH STROKEDESCENDING MUSICAL NOTESHEAVY "
+    "BLACK HEART BULLETORIZONTAL BAR WITH NOTCHUPRIGHT RECTANGULAR ZEROWITH "
+    "CANCELLATION STROKESINGLE-LINE NOT EQUAL TOT BLACK RIGHTWARDS "
+    "ARROWISOSCELES RIGHT TRIANGLEPERSCRIPT ALEF MOKHASSASBUSINESS SUIT "
+    "LEVITATINGWELVE POINTED BLACK STARE PLUS A PLUS SU PLUS NAPOINTING "
+    "DOWNWARDS ABOVELEFT DIAGONAL HALF "
+    "BLACKONE-HUNDRED-AND-SIXTIETHLY-RECYCLED PAPER SYMBOLGREATER-THAN OR "
+    "EQUAL TORIGHTWARDS THEN CURVING FINGER AND THUMB CROSSED POINTING "
+    "BACKHAND INDEXUPWARD POINTING TRIANGLESYLLABLE REPETITION MARKLICATION "
+    "PROGRAM COMMANDBLIC ADDRESS LOUDSPEAKERMTAVRULI CAPITAL LETTER DOUBLE "
+    "HORIZONTAL STROKEVOICED LARYNGEAL SPIRANTDOWNSCALING FACTOR KIIZHWITH "
+    "UPWARDS ARROW ABOVETEARDROP-SPOKED ASTERISKMALL CIRCLE TO THE RIGHTARROW "
+    "POINTING DIRECTLY BLACK LENTICULAR BRACKETIGATURE OPEN ET ORNAMENTLINE "
+    "HORIZONTAL ELLIPSISVERTICAL BISECTING LINERIGHT DIAGONAL ELLIPSISDOT "
+    "BELOW AND DOT ABOVE HUNDRED TWENTY-EIGHTH IDE ARC CLOCKWISE "
+    "ARROWASCENDING MUSICAL NOTESESS OUTLINED WHITE STARZANTINE MUSICAL SYMBOL "
+    "RAISED OMISSION BRACKETPUNCTUATION END OF TEXTBARBED RIGHTWARDS "
+    "ARROWWESTERN PWO KAREN TONE-P WITH EXCLAMATION MARKUBLE VERTICAL BAR "
+    "BELOWALGAMATION OR COPRODUCTARTY HORN AND PARTY HATLEFT-SHADED WHITE "
+    "ARROWCLUSTER-INITIAL LETTER ISTED RIGHTWARDS ARROWSARABIC LETTER TAH "
+    "ABOVECIRCUMFLEX ACCENT ABOVEUP SPREAD THUMB FORWARDHANKED RIGHTWARDS "
+    "ARROWLSCHREIBER PAUSE SYMBOLRIGHT HORIZONTAL SECANTSHAPE WITH A DOT "
+    "INSIDEININE ORDINAL INDICATORALEF MAKSURA FINAL FORMGREEK SMALL LETTER "
+    "IOTAIGHT-SHADED WHITE ARROW WITH HALF-CIRCLE BELOWSING DIAGONAL CROSSING  "
+    "CAKE WITH SWIRL DESIGNRTOISE SHELL BRACKETED WO-WAY LEFT WAY TRAFFICIVE "
+    "FINGERS SPREAD OPENORIGINAL OF OR EQUAL TOOVERLAPPING LOGICAL ANDAND "
+    "WOMAN HOLDING HANDSOVER RIGHTWARDS HARPOONAVOURING DELICIOUS FOODORAH "
+    "WITH NINE BRANCHES POINTING AT THE VIEWERATTACHING VERTICAL OMETSOLIDUS "
+    "BINARY RELATIONCURRENT SYMBOL FORM TWO ROTATED NINETY DEGREESHT "
+    "TRIFOLIATE SNOWFLAKEREE VARIATION SELECTOR WHITE FOUR POINTED CUSPUPWARDS "
+    "THEN NORTH WESTANG DEPARTING TONE MARKDOWNWARDS THEN CURVING OMBINING "
+    "ANUSVARA ABOVERIGHT-POINTING TRIANGLEPA OVER PA GAR OVER GARHREE POINTED "
+    "BLACK STARMITIAN CONJUGATE MATRIXYELORUSSIAN-UKRAINIAN IREE-CIRCLE "
+    "ALTERNATE ILONG HORIZONTAL STROKELEFT TRIANGLE OPERATORUPPER RIGHT AND "
+    "LOWER OVER NU11 BUR OVER BURDRESSED TO THE SUBJECTWASALLAM ISOLATED "
+    "FORMCONSONANT MODIFIER BARINVERTED SMALL V BELOWOVER LEFTWARDS "
+    "HARPOONEAST-POINTING AIRPLANECONSONANT SIGN MEDIAL MNYAM YIG GI MGO "
+    "RGYANROUND A POINT OPERATORSHORT VERTICAL STROKES-ROTATED DIVISION "
+    "SIGNUSTOMER ACCOUNT NUMBERDOUBLE-LINED HEAD MARKUPPER ONE EIGHTH "
+    "BLOCKSYMPTOTICALLY EQUAL TOLOW PARAPHRASE BRACKET RIGHT ARROWHEAD "
+    "ABOVERECTILINEAR BLACK STARING HEAD IN SILHOUETTEALEF WITH LAM WITH "
+    "YEHDOMAIN ANTIRESTRICTIONIGEL LONG-BRANCH-SOL SLE BESIDE VERTICAL "
+    "BARDOUBLE VERTICAL STROKELATIN CAPITAL LETTER SYIAKENG PUACHUE HMONG  "
+    "WITH THREE DOTS ABOVECJK UNIFIED IDEOGRAPH-WITH HORIZONTAL STROKE WITH "
+    "SINGLE ZAPYATAYADOUBLE SOLIDUS OVERLAYNOT INCLUDING THE POLEACKSLANTED "
+    "SOUTH ARROWREASE FONT SIZE SYMBOLPRECEDED BY APOSTROPHETWO HORIZONTAL "
+    "STROKESHEXIFORM LONG ANUSVARAWITH VOICED SOUND MARKINVERTED SMALL V "
+    "ABOVEHORT HORIZONTAL STROKEUBSCRIPT SMALL LETTER OVER SHIR BUR OVER "
+    "BURKEEPING STILL MOUNTAINI YFESIS TETARTIMORIONPERSET OF NOR EQUAL "
+    "TODOWN-POINTING TRIANGLEPOINTING UPWARDS BELOWTRIPLE RIGHT TURNSTILERROW "
+    "WITH ROUNDED HEADTRIPLE VERTICAL STROKEGREATER-THAN DIAERESISWITH JEEM "
+    "INITIAL FORMBAR ABOVE INTERSECTIONCURLY BRACKET ORNAMENTIN DEPARTING TONE "
+    "MARKRIGHT-POINTING FLEURONSHORT RIGHTWARDS ARROWND RECORDING "
+    "COPYRIGHTDOWNWARDS ZIGZAG ARROWQUESTION MARK ORNAMENT WITH DECORATIVE "
+    "COVERARMENIAN ETERNITY SIGN OVER STAMPED ENVELOPESEMI-VOICED SOUND MARK "
+    "WITH CIRCUMFLEX ABOVEUIGHUR KIRGHIZ YEH WITPUNCTUATION KUNDDALIYA SYMBOL "
+    "FOR LIGHTHOUSEINDIRECT QUESTION MARKVERTICAL LINE OVERLAYOHAMMAD ISOLATED "
+    "FORMINVERTED GLOTTAL STOPHOCKEY STICK AND PUCKTHICK LETTER "
+    "SELECTORHOUSAND MILLIONS SIGNSIDE TO SIDE SCISSORSFLATTENED "
+    "PARENTHESISRELICT HOUSE BUILDINGVOICED ITERATION MARKTRIANGULAR HALF "
+    "BLOCKABOVE SHORT DOWN TACKFINAL CONSONANT SIGN DOUBLE LEFT "
+    "TURNSTILE-SHAPED BAG DELIMITERDELIMITER TSHEG BSTAR-ROUND NOTEHEAD DOWN "
+    "GRUENT WITH DOT ABOVEGRAMMOS OKTO DODEKATABOTTOM U-SHAPED ARROWAKIA "
+    "TELOUS ICHIMATOSRATING SYSTEM COMMANDEIGHT SPOKED ASTERISKPAP PLUS PAP "
+    "PLUS LU3RISING DIAGONAL SLASHSH AMPERSAND ORNAMENTARD SHELL FLOPPY "
+    "DISKMALE WITH STROKE SIGNWITH INVERTED V ABOVEBUT NOT EQUIVALENT "
+    "TOLATTENED OPEN A ABOVELESS-THAN OR EQUAL TOER RIGHT CORNER ANGLEDOWN "
+    "HORIZONTAL LIGHTEFT HORIZONTAL SECANTWO-CIRCLE ALTERNATE IEFT-POINTING "
+    "TRIANGLEWO-CIRCLE NUKTA ABOVETILDE OPERATOR ABOVE ACUTE AND HOOK SYMBOLND "
+    "TELEPHONE RECEIVERINVERTED BRIDGE BELOWXTRA SHORT VOWEL MARKEFT OPEN BOX "
+    "OPERATORAND VOWEL LENGTH MARKGHT OPEN BOX OPERATORINTERSECTION "
+    "OPERATORARYSTIAN FIVE HUNDREDDIGRAMMOS EX DODEKATACROSSE STICK AND "
+    "BALLDOWNWARDS ARROW ABOVEQUADRANT CIRCULAR ARCTEEN POINTED ASTERISKMIDDLE "
+    "RING LITTLE ONOPPOSING AN PLUS NAGA AND SLANTED PARALLELINTERSECTING "
+    "LOGICAL LETTER SMALL CAPITAL ALLING DIAGONAL SLASHTOUCHING INSIDE "
+    "MOUTHSHORT LEFTWARDS ARROWVERY HEAVY BARB ARROWHALF TRIANGULAR COLONYIG "
+    "MGO TSHEG SHAD MAHORIZONTAL TABULATIONREVERSED FEATHER MARKOCAL NOTATION "
+    "SYMBOL-CTOR OR CROSS PRODUCTMORPHOLOGICAL DIVIDERARKENING OF THE "
+    "LIGHTNTISTRY SYMBOL LIGHT EQUAL TO OR LESS-THANCRUCIFORM NUMBER FOURHAND "
+    "INTERIOR PRODUCT WITH SHORT RIGHT LEGELATIONAL COMPOSITIONBESIDE RIGHT "
+    "TRIANGLEOP SHADED WHITE ARROWDOWN HORIZONTAL HEAVY WITH VERTICAL "
+    "STROKEBSET OF NOR EQUAL TOPLUS GISH TIMES TAK4OVER LEFTWARDS ARROWRUMAI "
+    "PALAUNG TONE-5 AND DIAGONAL STROKEGRA GCAN -CHAR RTAGSDOUBLE DOT TONE "
+    "MARKINSIDE MOUTH RELAXEDLEFT-TO-RIGHT SECANTINVERTED CANDRABINDUFOUR "
+    "RAISED KNUCKLESCENTRE VERTICAL LINEINVERSE WHITE CIRCLEFORMS LIGHT "
+    "VERTICALDOUBLE ANGLE BRACKETCHARACTER INTRODUCERTRANSPOSITION "
+    "MARKERGHTWARDS ARROW BELOWDOTLESS HEAD OF KHAHCHEMICAL SYMBOL FOR SINGLE "
+    "DOT TONE MARKCRESCENT MOON SYMBOLINDEX RING LITTLE ONWARE-FUNCTION "
+    "SYMBOLKHAMTI REDUPLICATIONE CONSONANT MODIFIERIRCLES HITTING WALL 79 OVER "
+    "LAK-079 GUNUEVERSED ROTATED RANAARXIS KAI FTHORA VOUWET CULTIVATION "
+    "SIGNHORIZONTAL BAR WITH RIGHT ANGLE WITH DOTUBHAANAHU WA TAAALAA WITH "
+    "HORIZONTAL BARMULTIPLE PUNCTUATIONHAR2 TIMES GAL PLUS CONSONANT SIGN "
+    "HAARUTHROUGH SMALL CIRCLE ABOVE LEFT TRIANGLEWORD REPETITION MARKCURVED "
+    "ANGLE BRACKETAND NORTH WEST ARROWHIGH RATHA OR LOW PACURRENCY SYMBOL "
+    "RIELA- SHOG GI MGO RGYANYRENAIC TWO DRACHMASAND NORTH EAST ARROWAND SOUTH "
+    "EAST ARROWREVERSED ONE HUNDREDAND SOUTH WEST ARROWSCRIPTION CHARACTER "
+    "WITH SOROCHYA NOZHKAHIGH TONE APOSTROPHERIGHT-POINTING ANGLE BEGIN "
+    "LOGOGRAM MARKJUDEO-SPANISH VARIKAWITH FOUR DOTS ABOVENIS RACQUET AND "
+    "BALLLASHING SWEAT SYMBOLRIGHT U-SHAPED ARROWLATALIZED HOOK BELOW OVER TUR "
+    "ZA OVER ZAVAL WITH OVAL INSIDEINING OBLIQUE STROKELE WITH POPPING "
+    "CORKIMAGE OF OR EQUAL TOFINAL CONSONANT MARKUP-POINTING TRIANGLE OVER "
+    "LAGAR GUNU SHEYIG MGO PHUR SHAD MAPOTABLE WATER SYMBOLSTAR WITH MIDDLE "
+    "DOTLEFT AND LOWER RIGHTONE MARK SGAW KAREN REAN STANDARD SYMBOLFIVE "
+    "SPOKED ASTERISKBETWEEN PALM FACINGSL FUNCTIONAL SYMBOL SEPARATOR KEY "
+    "SYMBOLSEPARATOR MIDDLE DOTENARMONIOS ANTIFONIAHREE-DOT NUKTA ABOVERIGHT "
+    "QUADRANT BLACKANGE ANTIRESTRICTIONDOWN ARROWHEAD BELOWHALF CIRCLE WITH "
+    "DOTOTLESS J WITH STROKEEMESTVENNY ZADERZHKAONCAVE-SIDED DIAMONDSIDEWAYS "
+    "NOON GHUNNAVERSAL INTERSECTIONSYMBOL FOR BEGINNERVERSE FINAL BARLINEATED "
+    "TELLER MACHINENORTH ARROW WITH HOHORT STROKE OVERLAYITED LIABILITY SIGNLF "
+    "MADDA OVER MADDAISPUTED END OF AYAHOVER E NUN OVER NUNRATUM SUPER "
+    "STRATUMRROW NO-BREAK SPACETART OF RUB EL HIZBOP SEMICIRCLE ARROWHAND "
+    "COVERING MOUTHBETWEEN MIDDLE RINGOTATED ARDHAVISARGADOWN AND HORIZONTAL "
+    "AND PROSGEGRAMMENILANTED EQUAL ABOVE TRANNO MALO POVYSHEARTIAL "
+    "DIFFERENTIALRAILING MCHAN RTAGSLEFT U-SHAPED ARROWLEADING MCHAN RTAGSLEFT "
+    "TO LOWER RIGHTVARIANT FORM ILIMMUVARIANT WITH SQUAREVARIATION "
+    "INDICATORLEFT POINTING INDEXVASTNESS OR WASTINGSLANTED NORTH ARROWA END "
+    "LOGOGRAM MARKPREFIXED NASAL SIGNQUADRUPLE CRESCENTS FLUTTERING IN "
+    "WINDQUESTION MARK ABOVEUP HORIZONTAL HEAVYHURISAZ THURS THORNGIBBOUS MOON "
+    "SYMBOLUP HORIZONTAL LIGHTURRENCY SYMBOL BAHTWOMEN HOLDING HANDSUBLE DOT "
+    "WITHIN DOTHEAD-SHAPED POINTERAHU ALAYHI WA-AALIHDOWN POINTING INDEX AND "
+    "RETROFLEX HOOKKULL AND CROSSBONESSTRATIAN FIFTY MNAS IN A RECTANGLE BOX "
+    "LOVE YOU HAND SIGN WITH STRIKETHROUGHIN CHEN SPUNGS SHADARENTHESIS "
+    "NOTEHEAD KASKAL U GUNU DISHANSPOSITION BRACKETC DIGRAPH WITH "
+    "CURLDENOMINATOR SIXTEENNE HUNDRED TWENTY PFT-POINTING FLEUROND CIRCUMFLEX "
+    "ACCENTTHANG LONG ANUSVARAANS-SERIF CAPITAL LALTERNATE LAKH MARKRY "
+    "CULTIVATION SIGNOW-9 QUOTATION MARKSH PLUS HU PLUS ASHRIGHT TO LOWER "
+    "LEFTPARAGRAPH SEPARATORSEQUENCE INTRODUCERFIVE FINGERS SPREADLUB-SPOKED "
+    "ASTERISKWITH YEH FINAL FORMINSIDE CIRCLE BELOWFLOORPLANE "
+    "TWISTINGTWENTY-FIVE DEGREESARABIC FORM SHAPINGILDING CONSTRUCTION WITH "
+    "VERTICAL TAILTO LOWER RIGHT FILLREE-QUARTER CIRCLE NOGRAPHIC FULL "
+    "STOPCIRCLED WHITE ARROWNAXIAN FIVE HUNDREDVERTICAL TABULATIONRIGHT MIDDLE "
+    "STROKEIMIDIA SEXTULA SIGNNDRED POINTS SYMBOLTURNED PADA PISELEHSTRAIGHT "
+    "THUMB BENTMOVES AGAINST CHEEKIGATURE AYIN-DALETHSEVEN EIGHTHS BLOCKEVEN "
+    "POWERS OF FOURTIGHTLY-CLOSED EYESNETWORKED COMPUTERSET WITH WHITE "
+    "CROSSCIRCLED SANS-SERIF TURNED SECTION MARKGAPPED CIRCLE ARROWING SHIRT "
+    "WITH SASHMSHELL MOBILE PHONESYMMETRIC SWAPPINGHAIS LUS NTOG NTOG NOT "
+    "LITTER SYMBOLSMALL RED TRIANGLEARROW SHAFT WIDTH ASTED SWEET "
+    "POTATOHILOSOPHERS SULFURSET OVER BUILDINGSEPIGRAPHIC LETTER UTLINED BLACK "
+    "STARQUARTER NOTE STEM YPTIAN HIEROGLYPH ORK ON THE DECAYEDNINETEEN FULL "
+    "STOPOU ALAYHE WASALLAMYLLABLE LENGTHENER AND YPOGEGRAMMENITILTING FROM "
+    "WAISTS INSIDE AND ABOVE WITH CIRCLE BELOWAND LOW RIGHT RINGCONTINUING "
+    "OVERLAPCTLY EQUIVALENT TO AND SMASH PRODUCTKANTAJA NAASIKYAYASINGLE "
+    "PUNCTUATIONCOPPER ANTIMONIATEKOREAN CHARACTER OEVERSED CHELYUSTKA WITH "
+    "CROSSED-TAILOUCHTONE TELEPHONE THUMB INDEX THUMB WITH CIRCLE ABOVEIGSAW "
+    "PUZZLE PIECEWITH JUSTIFICATIONTOP U-SHAPED ARROWKBAR ISOLATED "
+    "FORMEVENTEEN FULL STOPBASELINE ROUND DOTTO LOWER LEFT FILLINDEPENDENT "
+    "VOWEL SEPTUPLE CRESCENTSHUNDREDS UNIT MARKMATHEMATICAL SPACEERTICAL BAR "
+    "VIRAMANORMAL SUBGROUP OFBAARAKA WA-TAAALAAWHITE VERTICAL BAR SPREAD THUMB "
+    "SIDERYUKOVAYA SVETLAYA WITH KAVYKA ABOVEPACING CANDRABINDUDOWN-OUTPUT "
+    "SYMBOLCUP WITHOUT HANDLE WITH FLOWING SANDS PRESSED TOGETHERLOWER MIDDLE "
+    "RIGHTGATIVE ACKNOWLEDGEWITH STROKE SYMBOLCANTILLATION SIGN FORTY-FIVE "
+    "DEGREESFORKED PARAGRAPHOSU-SHAPED ORNAMENTS FOR SIMALUNGUN SABOTTOM RIGHT "
+    "KASRASOUL ISOLATED FORMLEFT MIDDLE STROKEPERFIXED LETTER RAOW TONE "
+    "APOSTROPHETROFLEX HOOK BELOWVERY SMALL DIAMONDOTLESS DALATH "
+    "RISHHORIZONTALLY BELOWUP ARROWHEAD BELOWATIN SMALL LETTER  OVER INVERTED "
+    "SHUNYOOGA NAAKSIKYAYALOSED CIRCLE ARROWNYET THYOOM TA-ROLIX SPOKED "
+    "ASTERISKSHAN REDUPLICATIONGISH CROSSING GISHLEFT-STEM TONE "
+    "BARATERRESTRIAL ALIENSHU ITERATION MARKUPPER MIDDLE RIGHTFIVE EIGHTHS "
+    "BLOCKNISH VERSE DIVIDERTYPE A ELECTRONICSABBREVIATION MARK WEST POINTING "
+    "LEAFENTERING TONE MARKDOUBLE PUNCTUATIONHOUSANDS SEPARATORENTY-TWO POINT "
+    "TWOGGLY VERTICAL LINE AND NO DOTS ABOVEHOLDING BACK TEARSIGATURE "
+    "ZAYIN-YODHPUNCTUATION BINDU ASTROLOGICAL SIGN EAST POINTING LEAFRIST "
+    "CIRCLE FRONT UM WITH DRUMSTICKSNITE PART INTEGRALIN POSSESSION SIGNJEEM "
+    "ISOLATED FORMVARIANT FORM LIMMUCROSS PUNCTUATIONAND BLACK SQUARESURNED "
+    "DAMMA BELOWURNED COMMA ABOVEAPLI DYO DODEKATAS REVOLVING LIGHTCTION "
+    "APPLICATIONKE BOTTLE AND CUP TO BLACK DIAMONDNFORMATION SOURCEPRECEDING "
+    "SOLIDUS OVER ZU PLUS SARNAUDIZ NYD NAUD NABBREVIATION SIGNAUKAZ LAGU LOGR "
+    "LQUAT REVERSED ESHNEGATIVE CIRCLED NE EYEBROW RAISEDHIRTEEN FULL STOP "
+    "PLUS SHA3 PLUS AYEH ISOLATED FORMASTERN PWO KAREN PRIZNAK MODIFIER "
+    "NASALIZATION MARKEMICOLON UNDERBARDENTAL PERCUSSIVEULAR MEDIUM "
+    "SHADEHORIZONTAL SINGLEATHERING TOGETHERDELPHIC FIVE MNASVRE TOURNOIS "
+    "SIGNMILITARY AIRPLANETRIPLE DASH ARROWPRESSIONLESS FACEHORIZONTAL DOUBLEA "
+    "PLUS HA PLUS DAAEUM ONE PLETHRONONE EIGHTH BLOCK-FLICK ALTERNATINGBOTTOM "
+    "HALF BLACKREATIONAL VEHICLEGREATER-THAN NOR GREATER-THAN SIGNINVERTED "
+    "MCHU CANFINGER-POST ARROWVARIANT FORM USSUVARIANT FORM IMININITIAL LETTER "
+    "RAUP POINTING INDEXVARIANT FORM ASH9ALTERNATE NUMBER ICTED LEFT "
+    "ENTRY-VOCALIZATION MARKCIRCLES WITH DOTSLD PERMIC LETTER  AND PALATAL "
+    "HOOKAMBDA WITH STROKEIASTRE MARK ABOVETONAL RANGE MARK OURTEEN FULL "
+    "STOPOWER NUMERAL SIGNTARTING FROM SIGN LAGAB TIMES ASH2 LAGAR OVER "
+    "LAGARMALL WHITE CIRCLEVERY SMALL SQUAREBUT RELIEVED FACEGENERIC "
+    "MATERIALSLIAN HIEROGLYPH A GRAVEYARD SYMBOLLHOUETTE OF JAPANCAL SYMBOL "
+    "BOTTOMIDEOGRAPHIC COMMACANCELLATION MARKCANDRABINDU ABOVEVERAGE WITH "
+    "SLASHTERSYLLABIC TSHEGTEN THOUSAND SIGNEAR SCREEN SYMBOLBRIGHTNESS "
+    "SYMBOLPUNCTUATION SIGN Y ON BLACK SQUAREVEE WITH UNDERBARFROM SMALL "
+    "CIRCLEFRACTION ONE HALFRIGHT HALF CIRCLEBRACKET EXTENSIONUP AND "
+    "HORIZONTALRIATION SELECTOR-0 WHEELED CHARIOTSIGN O WITH CROSSTHREE SOUND "
+    "WAVESSTRAIGHT MOVEMENTRYBLION BASE SIGNWO VERTICAL DOTS MEEM INITIAL FORM "
+    "WITH SOUND WAVESAMPHYLIAN DIGAMMABERBER ACADEMY YACONSONANT SIGN "
+    "PAIGHTEEN FULL STOP WITH TILDE ABOVECONTINUATION SIGNMEDIUM BARB ARROW "
+    "WITH BULLET NOSEWITH NOT EQUAL TOCONTOURED OUTLINEOPEN-HEADED ARROWWHITE "
+    "PARENTHESISHEART-SHAPED EYESINEAR ANNOTATION BE WITH MERIDIANSCLOSED "
+    "LITTLE YUSHAH ISOLATED FORMTIAL ARTS UNIFORMLAPPING LESS-THANMANENT PAPER "
+    "SIGNSQUARED TIMES KURPINWHEEL ASTERISK-GAAHLAA TTUDDAAGING POLE AND "
+    "FISHFACING BABY CHICKTAN ISOLATED FORMLAH ISOLATED FORMKHAH INITIAL FORM "
+    "ALTERNATION MARKCOMBINING NUMBER NG STROKE OVERLAYWHITE SHOGI PIECESERVER "
+    "EYE SYMBOLLAGOLITIC LETTER RISING TONE MARKISTOS DISC SIGN IDED GREEK "
+    "CROSSIMENSIONAL ANGLERIZONTAL ELLIPSEULDERED OPEN BOXRIGHT DOWN BARB "
+    "QUALS SIGN BELOWDVUMYA ZAPYATYMI AND HEAVY RIGHTHYPHENATION MARKINDEX "
+    "THUMB SIDE AND LIGHT RIGHTANABAZAR SQUARE STRING FRETBOARDUP-OUTPUT "
+    "SYMBOLIPPER-MOUTH FACEAFFRICATION MARKPEN CENTRE CROSSINDEPENDENT "
+    "SHINSTUCK-OUT TONGUEORIZONTAL JOINERSTRAIGHT STRETCHUMBER SIGN "
+    "ABOVESTERISK OPERATORIFTEEN FULL STOPRIGHT HALF BELOWO-MINOAN SIGN "
+    "CMIRCLE X NOTEHEADE PLUS GAN2 TENUQ WITH HOOK TAILINES CONVERGING "
+    "ARENTHESES ABOVEUP MIDDLE HINGEDRIGHT HALF BLACKIGHTH NOTE STEM STICKING "
+    "OUT FARUPERSCRIPT ALAPHRECORD SEPARATORVIEWING CEREMONYWITH HEARING AIDCH "
+    "WITH UMBRELLALOWER OVER UPPER INSERTION POINTLTERNATE HASANTAFLOORPLANE "
+    "SPACEYATHOS BASE SIGNREPETITION MARK-MAGNIFYING GLASSNION WITH SERIFSPLE "
+    "MEASURE RESTFFERENCE BETWEENFALLING DIAGONALPLACEHOLDER MARKSERIFS AT "
+    "BOTTOMRESH-AYIN-DALETHDOUBLE HEAD MARKDOUBLE DOT ABOVEDOUBLE "
+    "CRESCENTSWITH LEFT UPTURNEFORE COMPLETIONLIGHT AND RIGHT LIGHT BARB "
+    "ARROWDOTTED CRESCENTSRAYS AND DOTTED VERY HEAVY SHAFTLLOW PAN OF FOODWITH "
+    "CENTRED DOTERCURY SUBLIMATE SMALL ROTATIONSEPSILON UNDERBARENUMERATION "
+    "SIGNENTRE WHITE STARSANS-SERIF ARROWMIDDLE AND RIGHTEND OF TEXT MARKEN "
+    "MILLIONS SIGNTRIPLE CRESCENTS PLUS KAK PLUS ANAL DIGIT SHAPESOLD WHITE "
+    "CIRCLEDEWAYS U BRACKETOLD TAMIL VIRAMA OR THE IMAGE OFCORNER LEFTWARDS "
+    "LIGHT MOON ARTADITORIAL CORONISCOMPRESSED ARROWCONSONANT JOINEREVERY "
+    "OTHER TIME WITH DOT INSIDEEVERSED VISARGA CORNER DOWNWARDSCASIAN ALBANIAN "
+    " WITH BUNNY EARSVOWEL LENGTHENERWITH HAMZA ABOVECREAMING IN FEARMESTVENNY "
+    "KLYUCH TIMES GAN2 TENU TIMES DISH TENUMIDDLE AND BELOWDOWN RIGHT BARB "
+    "SLANTED EQUAL TOR PLUS GAN2 TENUSITION INDICATORBOTTOM HALF RINGSMALL "
+    "CAPITAL ELUBJOINED LETTER  CAPPED MOUNTAINTAKANA-HIRAGANA SIGN RISING "
+    "TONEECIMAL SEPARATORDOUBLE ZAPYATAYAHMATULLAH ALAYHEADIAN SYLLABICS UPPER "
+    "OVER LOWERIVE POINTED STARHOLDING TOGETHERUDLY CRYING FACEHIGH SPACING "
+    "DOTK PERMITTED HEREB2 TENU PLUS TABSMALL NOON ABOVEYIR MKPARAQ "
+    "MEUNPRECHGESANG STEMPRECEDING SUBSETNTAIGANA LETTER LEFT HALF "
+    "CIRCLEPOSTPOSITION MENBOLD GREEK CROSSLEFT ARROW ABOVEVARIANT FORM "
+    "ESHSHU2 PLUS KASKALLD ASSYRIAN ONE WAVY HAMZA BELOWRAIDO RAD REID RDOUBLE "
+    "TURNSTILEESSARON CHRONONUGMENTATION DOTULTIPLICATION XEH INITIAL "
+    "FORMERICAN FOOTBALLPRISHTHAMATRA EDIGA AELA-PILLABREAKING HYPHENTILDE "
+    "DIAERESISESIDE LESS-THANBROWS STRAIGHT PEN SQUARED DOTXTEEN FULL "
+    "STOPHOOKED INDEX UPBLOCK DIAGONAL OUBLE BACKSLASHEFTWARDS ARROWSU PLUS U "
+    "PLUS UGHT REPEAT SIGNETIC VERSE SIGNIGN PALI VIRAMAE ISOLATED FORMEFT "
+    "REPEAT SIGNE MUSICAL NOTESUMAI PALAUNG FAPERTHO PEORTH PFTER COMPLETIONDI "
+    "ALLAHOU ANHUTRIANGULAR MARKHOUSAND STATERSTIP ON THE LEFTBINDING "
+    "BRACKETDESCENDING TONEHREE DOTS BELOWSTERESIS SYMBOLPENSION RAILWAYGROUP "
+    "SEPARATORATINATE MYSLITEFRACTION DIGIT RIGHTWARDS AND DIALYTIKA "
+    "TONOSDOWNWARDS TRENDATA LINK ESCAPEHORIZONTAL FILLDAGESH OR "
+    "MAPIQHORIZONTAL DASHRIGHT RERENGGANOWER HALF BLACKBELGTHOR SYMBOLTAI "
+    "LAING TONE-CIRCUIT-OUTPUT E OVER INFINITYBELOW LONG DASHTOP RIGHT "
+    "FATHAWITH DOWN ARROWBENT OVER INDEXDOING CARTWHEELOW-FALLING TONETVIMADUR "
+    "SYMBOLCAPITAL LETTERSHALF FILL SPACEFORWARD TILTINGHAKING PARALLELIAMOND "
+    "UNDERBARTWO WITH STROKERIGHTWARDS TICKCORNER WITH DOTIDING ENCLOSUREBAR "
+    "ABOVE UNIONSTROKE NOT SIGNHEH MEDIAL FORMUBLE RING BELOWTHROWING A "
+    "KISSGGLY LINE BELOWGEMINATION MARKFOUR DOTS WITH PUT SYMBOL FOR EXPONENT "
+    "SYMBOLDOUBLE TRIANGLETHREE DISH TENUPLUS SIGN BELOWDOWN SEQUENTIALFOUR "
+    "ENCLOSURESCLOSED BY CURVECKET CALCULATORLIGHT AND LEFT ALAYHE "
+    "ASSALLAMONTOUR INTEGRALINVERTED LAZY SSHITA PLUS GISH THROUGH "
+    "CIRCLEYNCHRONOUS IDLEMIDDLE DIAGONALINVERTED STROKELEVEN FULL STOP THUMB "
+    "STRAIGHT TIMES IGI GUNU TOUCHING INDEXVOWEL SHORTENERON TOP OF MODEMN-ARY "
+    "SUMMATIONSALTER PAHLAVI RIGHT HALF RINGALMOST EQUAL TOMURDA MAHAPRANALEFT "
+    "DOWN BARB LEFT HALF BELOWLEFT HALF BLACKVOWEL SEPARATORLEFT HAND "
+    "INDEXALIF LENGTHENERUR POINTED STARSHORT OVER LONGINUS SIGN BELOWLETTER "
+    "CAPITAL LEVEL TONE MARKWHITE DOT RIGHTQUADRUPLE ARROWQUADRUPLE DASH "
+    "MALAKON CHROMA -NO-EVIL MONKEY-PIECE SWIMSUITRECITATIVE MARKRECEPTIVE "
+    "EARTHACHES THE LIMITLONG HOOK BELOWLONG VOWEL SIGNREAMY EYEBROWS LOOK OF "
+    "TRIUMPHLOSED INSULAR GITH FINGERNAILSMARRYING MAIDENMEEM FINAL FORM WITH "
+    "DESCENDER WITH DIAERESISORIZONTAL COLONVERTICAL SECANT WITH RIGHT LEGIZED "
+    "WHEELCHAIRIMISEOS CHRONOUAI LAING DIGIT 2 CHARIOT FRAMEIRCUMFLEX "
+    "BELOWZERO WITH SLASH-CARRIER LETTEROND PLACE MEDALONJOINED HINGEDLMOST "
+    "EQUAL TO WALLPLANE SPACES IN SILHOUETTES ELEVATUS MARKAMOUNT OF "
+    "CHECKIMPERFECTA RESTLATION FUNCTIONSIXTEENTH NOTES AND LOWER LEFTKISIM5 "
+    "TIMES BIRNAMENT STROKE-R WITH FISHHOOKNVERTED UBADAMAREVERSE "
+    "SOLIDUSNJOINING MACRONST QUARTER MOON NEPOSTOYANNAYANO GOOD GESTURE CLOUD "
+    "AND RAINNOON FINAL FORMNOON WITH KASRAOGOGRAM KHAMTI USTER NOTEHEAD  "
+    "CORNER BRACKET DEYTEROU ICHOUNOT APPROXIMATEST SYRIAC CROSSWITH RAIN "
+    "DROPSAND PARALLEL TOINGLE HEAD MARKND OF PARAGRAPHING SYMBOL FOR  "
+    "ALTERNATE FORMSSICAL BUILDINGODO SOFT HYPHEN OVER MOUNTAINS OVER SIG4 "
+    "SHU2AMARITAN SOURCEORT EQUALS SIGN PARESTIGMENON NASALIZED TONE-OLIDUS "
+    "OPERATORZAIN FINAL FORMNA DOUBLE HELIX PLUS HI PLUS AREVERSED OPEN ELD "
+    "TAMIL SHORT  OPERATOR WITH RMAN PENNY SIGNTETARTOS ICHOSTWO "
+    "ENCLOSURESUNDER RELATIONQUINARIUS SIGNUBHAYATO MUKHATHALAN ETHEL OHESIVE "
+    "BANDAGECEPTER OF JOVECENTURIAL SIGNRD PLACE MEDALOPPOSING PIRIG1 OVER "
+    "LAK-081THAKA ANUDATTALESS-THAN NOR ZAH WITH MEEM BLACK TRIANGLEBLADE "
+    "SCISSORSGHT WITH STARSGYPTOLOGICAL ALEVEN TWELFTHSXO EKFONITIKONTELPIECE "
+    "CLOCKLETTER OVERLAPOUSING THUNDERVENIENCE STOREGUNU TIMES ASHLEFTWARDS "
+    "TICKLEFTWARDS AND ZAKAYA LANTERNOVER GUD LUGALSHESHIG TIMES USPENSION "
+    "MARKTWO WHITE DOTSLINE EXTENSIONVERTICAL LIGHTGERED TREMOLO-LACE OF "
+    "SAJDAHVERTICAL HEAVYVERTICAL COLONOUR OBOLS SIGNLITTLE SECTIONBHATTIPROLU "
+    "AAWITH LEFT HOOKUAL WHEELCHAIROOTNOTE MARKERLIGHTLY SMALL TERMINAL "
+    "MARK-SIDE-DOWN FACEVERTICAL ABOVEPPED MIDDLE UPEND OF SECTIONTRIANGLE "
+    "WITH PARTMENT STOREDIAGONAL PATH DIAGONAL MOUTHDI ALLAAHU ANHOLD "
+    "RESOLUTIONDEYTEROS ICHOSPARATED SYMBOLEMIVOWEL SIGN REH FINAL FORMDASIA "
+    "PNEUMATAWITH DOT BELOWENDED MULTIMAPENNA WITH BARSTIMES SHU "
+    "TENUMRACHNOTIKHAYAPAO KAREN TONETIMES OPERATOREPENTHETIC YUTMOTHETIC "
+    "ABOVED-UP NEWSPAPERTOP HALF BLACKREVERSED-SCHWADUN3 GUNU GUNUOBLIQUE "
+    "HYPHEN AND DIAERESISPEN MARK BELOWNYI ZLA NAA DADOUBLE-STRUCK  CROSSING "
+    "ESH2REE-LINE STAFFNORTH ARABIAN TRANSMIT STATE HASER FOR VAVED SYMBOL FOR "
+    "DOES NOT EXISTDIRECTION FLIPDIO MICROPHONEPLETE INFINITYTHREE POINTED "
+    "COLON OPERATORTHOUSANDS SIGN-CURRENCY SIGNTHOUSANDS MARKFATHATAN "
+    "ABOVEFFED FLATBREADFFICE BUILDINGFINAL ANUSVARAPLE WITH HEARTPLITTING "
+    "APARTVONIC ASTERISKONE SOUND WAVEREATIVE HEAVENTHER CHRISTMASFORWARD "
+    "INDEX TWO DOT LEADERLOWER DIAGONALSHAN MEDIAL WALOTUS POSITIONMENSION "
+    "ORIGINVRON SNOWFLAKEERIAL ARAMAIC ERIC INDICATORRING MEGAPHONESECOND "
+    "SUBUNITERTICAL JOINERMID-LEVEL TONEWITH FATHATAN ROSS ON SHIELDCERTAINTY "
+    "SIGNCRIFICIAL WINESEL LOCOMOTIVETURKIC LETTER MEDIUM DIAMOND WITH LONG "
+    "LEGEXCLAMATION OHSEPARATOR MARKOTHERS CIRCLEDHIRD-STAGE HLIISED ROUND "
+    "DOTSTRONG ISOLATEAFETY SCISSORSAROUND-PROFILESMALL LETTER JIWAZ TIR TYR "
+    "TPROTECTED AREAUP RIGHT BARB ALLAJALALOUHOUIKHAYA PUTNAYAORD SEPARATOR "
+    "SMALL TRIANGLESMALL LETTER DINSERTION SIGNINOLOGICAL DOTSURROUND FROM "
+    "UPPED INDEX UPAU LENGTH MARKAND COLD SWEATISSION TICKETSIVE KEY "
+    "SYMBOLIGHTWARDS VANEUNION OPERATORINFINITY BELOWBAG MEMBERSHIPOSITION "
+    "SYMBOLINVERTED BIRGAIVE OBOLS SIGNALF TREE TRUNKINVERTED DAMMAWORD "
+    "SEPARATORSPEECH BUBBLESHREE-LEGGED TESQUIGGLE ARROWUND MARK ABOVEAMNUC "
+    "PII KUUHAI LENGTH MARKOT TILDE ABOVEORANGE DIAMONDSMOKING SYMBOLANGLE "
+    "OPENING UNIT SEPARATORIRCULAR VIRAMARIGHT CROSSBARYOUTHFUL FOLLYJOINED "
+    "SQUARESING HANDS SIGNFT ARROWHEAD IVE SLOW SIGNFROWNING FACEARGOSYNTHETON "
+    "OPPOSING KURONG-LEGGED DEONGRATULATIONROTATED BIRGAGIFT ENVELOPEONG RIGHT "
+    "LEGUPERIMPOSED XITING THROUGHUPSILON WITH TIRTA TUMETESIVE POINT "
+    "ONEDIAERESIZED UVERGREEN TREEOMAN NUMERAL MULTIOCULAR OVERLAY "
+    "MIDDLETROFLEX CLICKSAMYOK SANNYAGAR FRACTION VERTICAL FILLAUDATE "
+    "CHRIVINAP PIZZICATOGAW KAREN SHAACCOMMODATIONSHESH PLUS KIVERTICAL "
+    "BARSLISION SYMBOLIFI ROHINGYA SAL PLUS TUG2ARCHAIC "
+    "KOPPAWAW-AYIN-RESHEMPHATIC TONERIGHT HARPOONFULL SURROUNDLOCK WITH KEYJES "
+    "SU NGA ROVICE CONTROL INTEREST SIGNBY DEFINITIONUPWARDS TRENDS UP "
+    "TOGETHERLOCATION SIGNOLVING HEARTSMALL LETTER ZIOT SYLLABLE VOWEL SIGN "
+    "PACRIPTION TAKE-ESASA DOTTEDCRIPTIONAL PAOTEHEAD BLACKMALO POVYSHE ARROW "
+    "OVERLAYCROSSING GABACROSSING GAN2MESSENIAN TENUPONDIUS SIGNCROSSING "
+    "MUSHCITATION MARKFICATION CARD WITHOUT SNOW WITH INK PENONAL COMPUTER "
+    "WITH JEGOGANIRCLED INDEX  WITH OVERBARMEDIUM SQUAREEVERSED DAMMAI WITH "
+    "STROKE WITH TEE TOPSSAGE WAITINGMASORA CIRCLE VARIANT FORMMARKS "
+    "CHAPTEREUROPE-AFRICAMELODIC QITSASELECTED AREAMINUS WHITE XHREE "
+    "TWELFTHSFIXED-FORM RAINVERTED FORKLVE FULL STOPPAIRED ARROWSMINDER "
+    "RIBBONCHECKER BOARDMINUS SIMILARLVEOLAR CLICKPLUS "
+    "OPERATORFOREMENTIONEDMODIFIER MARKARLAUG SYMBOLER BOARD FILLZHOU NUMERAL "
+    "FINAL LETTER INVERTED TURN-OFF CALENDAR-OR-PLUS SIGN-PER-EM SPACE TIMES "
+    "KASKALMAILBOX WITH YOD YOD PATAHPA NJI PIPAEMARRED TRIDENTCIRCLE "
+    "INSIDERIZONTAL TAILCULATED LORRYFINAL SEMKATHTU WAS-SALAAMISH LIRA "
+    "SIGNCHRYSANTHEMUMERTION SYMBOLTHIRD SUBUNITUE OF LIBERTYLEFT CROSSBAROUT "
+    "MIDDLE UP CROSSING KA2 BZHI MIG CANDOTTED ZLAMA L-TYPE SYMBOLWAVY "
+    "OVERLINEHIEROGLYPHIC BOHAIRIC KHEIED DOUBLE VERLATERAL CLICKNINE "
+    "TWELFTHSGTER TSHEG MAOON NOTEHEAD NUMERATOR ONEIGHT TWELFTHSDOUBLE "
+    "STROKEILABIAL CLICKUFFLE PRODUCTSYNDESMOS NEONUMERIC SIGN SIGN PAMUDPOD "
+    "BAT AND BALLBOTTOM CORNERNG TERMINATORWITH INTEGRALUDDISA SIRRAHAPPED "
+    "PRESENTEDIC ANUSVARAWO-LINE STAFFHINESE TONE YSIA-AUSTRALIAAN RUPEE "
+    "SIGNGYA GRAM SHADSILI PNEUMATAUSICAL LEIMMAPREPONDERANCEUSHING UPWARDED "
+    "PAPERCLIPSPPOSING LUGALH-TYPE SYMBOLWITH ASTERISKEAVENLY EARTHRTABLE "
+    "STEREOTE ORDER MARKNTY FULL STOPEELING PERSON HEADED ARROWNING "
+    "MOVEMENTQUARTERS SIGNYUUKALEAPINTUAMUHU ALAYNAAOURTH SUBUNITSTERTIUS "
+    "SIGNILE SEPARATORRIPLE SVARITARACKETS ABOVEEHU FEOH FE FBALL AND HOOPSIGN "
+    "AVAGRAHALEGETOS ICHOSOBLIQUE LINE RANKS CASKET ANNED LEATHERDOUBLE "
+    "CIRCLEDOUBLE MUCAAD DIMINUTION-1RPENTRY PLANEHERICAL ANGLETED HAND "
+    "SIGNDOUBLE HYPHENHAM DIGIT ONEDVOECHELNAYA S KRYZHEM ON AR WITH QUILLRN "
+    "PENTATHLON OF THE HORNSS KAI APOTHESVEN POINT ONE DIRECTIONAL IMAGE "
+    "BRACKETDIC MARK SIGNOPPOSING NAGAWAVY LOW LINEOGOTYPE SIGN YMBOL TAU "
+    "RHOBASAN LETTER URNED W BELOWSMALL LETTERSBOWING DEEPLY AND YEN "
+    "SIGNBACKSLASH BAR B BAR SYMBOL AND SKI BOOTTOP HALF RINGW RING "
+    "INSIDEVE-LINE STAFFKAPYEOUNPIEUPAWELLEMET YAZK WORK SYMBOLRRIAGE "
+    "RETURNSTABLE SYMBOLU WITH STROKEHAKASSIAN CHEMIDDLE PIECEOGOGRAM NYAJRED "
+    "KEYBOARDRING OVERLAY CROSSING GUEVERING FACECRESCENT BAREAGULL BELOW AND "
+    "PICTUREANG KHANG GYON US SYMBOLETRETES SIGN WITH DAGESHDUG TIMES NIMEDIUM "
+    "SHAFTWITH SMALL VTRAGRAM FOR IRAGANA HOKAT MONGKEUAEQNUITY SYMBOLRISTMAS "
+    "TREEDOWN HARPOONCROSSING NUNMETA STAVROUCROSSING LU2CROSSING KALIN MIDDLE "
+    "UPCROSSING GI4REVERSE MARKDOWN NEUTRALOING TO MEETSS-THAN SIGNSECTION "
+    "SIGNTOP-LIGHTED TRIPLE DANDAALTERNATING NARROW SHAFTING ENVELOPEEMISOFT "
+    "SIGNDENTAL CLICKNERSHIP SIGNDIGRAPH KOTODIGRAPH YORIS ABOVE SIGNALT PAN "
+    "SIGNTRIPLE FLAMEN ELEMENT OFNGLE BARLINEDE MARK SIGNENARIUS SIGNALLPOINT "
+    "PENMUM TIMES PAINTEGRATION  OVER KISIM5 ON PEDESTALUN WITH RAYSNDING "
+    "PERSONEIGHTH NOTES OF ANTIMONYING HITTING ING OPERATORS SUBPUNCTISDICTION "
+    "SIGNAR DIAERESISNCK CONSTANT OVER MIDDLEIGATURE SHRIARALLELOGRAMEGIN "
+    "SEGMENTNEPOSTOYANNY OVER TWO PINATURAL SIGNYAN NUMERAL UME INTEGRALEMELY "
+    "HEAVY RIGHT DOUBLEINVERTEBRATEMONOGRAPH UKDOT OPERATORSAZ IS ISS I SKEWED "
+    "LEFTNORTHERN TSEROUNDED ZEROOID NOTEHEADAND CRESCENTNOTCHED HOOKMING TO "
+    "MEETDOUBLE ARCH ERPENDICULARDOUBLE ARROWAND OPERATORNOTCHED TAILRIAGE "
+    "SYMBOLOHAZARD SIGNEEPING SMALLDASHED ARROW LINE SYMBOLOK HAND SIGNENOS "
+    "CHRONOUENT ARROW POPHEME JOINER KLYUCHEVAYAMPTY CENTRE REN CROSSINGNJALA "
+    "GONDI REFACE COLON IN TRIANGLEMPHASIS MARKINDEX MIDDLEIDENTICAL TOINUSOID "
+    "SIGNBSCRIPT ALEFRIGHT SINGLEVER EQUAL TOOTTOM HALF OUGHT BALLOONLER "
+    "CONSTANTLICKING LIPSBUTTON MOUSEBYSMAL WATERSMILING FACEOVER KASKAL "
+    "BRIDGE ABOVESHORT RIKRIKBRATION MODETEARS OF JOYSMALL TRIPLERANCHING "
+    "OUTPORT CONTROLLEFT-LIGHTEDLEFT HARPOONQUARTER SIGNAA AS-SALAAMLLE "
+    "PATTERN SHED BARLINERCHAIC SAMPIATNAH HAFUKHONISHED FACEQUARED ARROWACE "
+    "INTEGRALPROTOS ICHOSVICTORY HANDPOETRY MARK-IVE TWELFTHSFT RERENGGANACUTE "
+    "ACCENTCENDING NODEYOUTHFULNESSLL MODIFIER-GAW KAREN EUATTOOED HEADGBY "
+    "FOOTBALLWIGGLY FENCEROLLING EYESGEBA KAREN ICALENDAR PADLINKING "
+    "MARKLINGING FIRELIMBS DIGITSTERNATE AYINCABBAGE-TREEUH PLUS GISHUSEATED "
+    "FACESMALL DOUBLERNAM BCAD MAKLYUCHEVAYA OPLE HUGGINGHEAD-BANDAGEBACK OF "
+    "HANDOPENING LEFTKHMIMIC KHEIBEHIND CLOUDHASIS SYMBOLHAND FORMAT BETWEEN "
+    "LIPSKHAMTI TONE-OPPOSING LU2HIBITED SIGNOQ NSHUT YUMQUIRREL TAILOUGHT "
+    "BUBBLEKAPPA SYMBOLOUCHES THUMBUBSCRIPT TWOKANA REPEAT BAHIRGOMUKHAGREEN "
+    "DRAGONGROUND SLIDEGUARDED AREATE SEPARATORBLUE DIAMONDBLOWING FACELEADING "
+    "EYESPOUTING FACEWDATA SQUAREVAKRAHASANYAXIRON KLASMABLACK CIRCLELAYING "
+    "CARDSMEDARY CAMELLATALIZATIONLARGE TRIPLERAH BEN YOMOLARGE DOUBLEBINING "
+    "MARK HAH WITH DAL6 LONG NGGOOUTH-SLAVEY KUTH ARABIAN OUR TWELFTHSHALF "
+    "BRACKETRAFFIC LIGHTFERENCE MARKHYPHEN-MINUSLU PLUS ESH2THIC LETTER "
+    "IRTY-SECOND RIAL TRAMWAYTHETA SYMBOLFOLDED HANDSTHREE HEARTSFEMININE "
+    "DOTMALL SECTIONHREE FINGERS-SIMPLIFIED ULL NOTEHEAD-SHAPED SIGNFORMING "
+    "ARTSLOWERED FLAGTHODOX CROSS-DZUD RTAGS MANNAZ MAN MVOLTAGE SIGNFLAG ON "
+    "POSTFALLING DOTSLUS NOTEHEADSUR OVER SURM NSHUT NYAMSH ZIDA TENUYOD "
+    "TRIANGLEUPPER CORNERCIAN LETTER CK-O-LANTERNMBELLISHMENTMADDA ABOVE LOWER "
+    "CORNERCIRCLES AND  WITH INDEX -MAIL SYMBOLRION CHRONONFOUNTAIN PENYMBOL "
+    "BINDU CIRCLED PLUSCHAIR SYMBOLAFU LEERAEWARISING DOTSNSE CHEEKS EDICAL "
+    "MASKGUISED FACENITIAL IZHEROR-BARRED TIEE SHEUOQOHINGYA YEHLACKLETTER "
+    "RUNNING MANXESTES SIGNLACK SULFURSPIRATED FAIBLE-CREE YOUBLE "
+    "DANDAINDICESIMA LATIN CROSSLCE TSA CANHAGGAR YAZHSTORIC "
+    "SITEINDERGARTENETEI MAYEK TIGHT ACUTETHIRDS SIGNLD POLISH OLD SCRIPT "
+    "XFGHANI SIGNOUBLE ACUTEHIGH STROKETA EQUAL TOMBA BAYANNAIMULTANEOUSSMALL "
+    "CLOUDE2 TIMES ANTHREE TIMESROSS ACCENTOF ENVELOPEOF MASHFAATE WITH "
+    "VEILOPPOSING IMIN EQUAL TOOPPOSING ENHEELED SHOENYIS -KHYILME LONG CANDYO "
+    "CHRONONXI RADICAL STEAMY ROOMMED RGYINGSIRCLED TEXTI TIMES NUNILIQUA "
+    "SIGNMBLER GLASSRPOON ABOVESTERED SIGNRITING HANDL OF THREADEAVER DENE "
+    "NTIMONY OREKTIESELSKABIL FRAGMENTLEFT DOUBLESIMILE SIGNHAWH HMONG L TIMES "
+    "LALHANG KHUDAMEUNJOMNDEUQWO TWELFTHSKAARA POLLUIPLE TONGUEILCROW "
+    "SIGNNUSVARA ONENUN HAFUKHAI TIMES BADHEAVEN MARKHEATED FACEORT "
+    "BARLINENUMBER ZEROWITH GARDENNUMBER SIGNKRAINIAN IESINGLE AND OUNDED "
+    "FACEGE AT NIGHTN THE VERGEGAYANUKITTAERCENT SIGNSHEQEL SIGNEN "
+    "STRAIGHTLTERNATE YAGAP FILLER-PARAKALESMALTED "
+    "FLOWERTETRAFONIASMUUSIKATOANLT OF CLOTHLINE FILLERXAGRAM FOR HORA DIGIT "
+    "LUPOVODNAYAGENTLE WINDSHAAYATHIYAIEN MONSTERJECT SYMBOLRONTHISMATAORCE "
+    "SYMBOLLU PLUS IGILON SKEWED ENTHESIZED OVERSTRUCK OMAN SIYAQ EORGIAN "
+    "NARSSANGKIYEOKLOSED ENTRYEPIDAUREAN FOURTH ROOTLOSING MARKLOTI NAGRI THAM "
+    "DIGIT IX TWELFTHSMUNCIA SIGNMONOCULAR OONIAN SIGN TH-THALATHAIVERY "
+    "TRUCKSECOND MARKENG DIGRAPHRING LIQUIDHREE BALUDAWHITE JOKERLEFT "
+    "SINGLELEFT SYMBOLGRAMMA SIGNHITE DRAGONMIDDLE BENTNG LEFT LEGHLETIC "
+    "SHOEOUTHERN TSEMIDDLE HOOKESH DIGRAPHLEAF CLOVERTONAL MARK EEZING "
+    "FACELEEP SYMBOLGSUM -KHYILNIKOLSBURG SYURA SASAKJOYOUS LAKEMOVED "
+    "BELOWMFON PIPAEMGRAVE-ACUTERYVNIA SIGNMICAL HEARTMIDDLE STEMND OF "
+    "PIECEJIHVAMULIYAISIGOTHIC ZND ODD SIGNROKUTASTI AGHAIN WITH "
+    "XTINGUISHERNBLENDED UKSYMBOL VIDJOR OPERATORRIPLE PRIMEFINAL SIGMAOLD "
+    "NUBIAN MACING FACESPEED TRAINSVASTI SIGNLETION MARKLEU SATANGAHOKHLOM ON "
+    "TENS DIGIT FIRE ENGINE WITH TITLOTRESVETLAYA WITH FLASH WITH JACKS WITH "
+    "MAPIQRACHMA SIGN WITH PLATERADITIONAL UBLE TONGUEDE KIKAKUI TRIAN "
+    "CAMELTRESS SIGN  WITH TRILL WRIST FLEXUTH CORNERSZIGZAG LINE-COPPER "
+    "OREBANK SYMBOLPUT MORTUUM-MINUS SIGN UPPER HALFURRENT SIGNBLACK ARROWDONG "
+    "TSHUGS TACK BELOWDOLLAR SIGN TIMES ESH2COND SCREEN-OFF SYMBOLBETA "
+    "SYMBOLCONTAIN AS DOACHASHMEETRUNCATED ABELOW RIGHT WITH CARON WITH "
+    "COMMARA SOMPENG  WITH DASIATUNE COOKIEDASH SYMBOLCROSSING EN5 LONG "
+    "MBOORAISED FLAGVARYS ICHOSRIGHT-LIGHTASE TO THE WASLA ABOVEPERISPOMENIULO "
+    "TWO SUMCROSSING BUDENT EMBLEMDESK PERSON3 LONG NGGOARM SPIRAL CROSSING "
+    "IMCROSSING PICROSSING URARMS RAISEDRANSMISSIONARPEGGIATO VE OF PEACEVA V "
+    "CHELNU6 LONG NGGEUETTE BREADARAM GONDI AWNING FACE0 FOOTSTOOLUG RTAGS "
+    "GYREAKTHROUGHUTING WHALECREDIT SIGNVISARGA ONEDIATONON DIVAMAGOMUKHACTION "
+    "MARK-ATION SPACEATION POINTUISHED FACEATH PRODUCTUMAN FIGURECTION MARK "
+    "RIGHT-HAND ZERO THIRDSRCHAIC JNYACAN RGYINGSTWO FINGERSCARET TILDE I "
+    "ZAPYATOYACUTE-GRAVEACTIVE SIGNACKED COMMAWINKING EYETY THOUSANDRIGHT "
+    "HEAVYPHNAEK MUANABOVE RIGHT OF FLOWERSBZHI -KHYIL OVER BULUG OVER IDIM "
+    "ZZA WA JALLYEORINHIEUHUPADHMANIYACHING CHICKAILLESS PHI AND MACRONAGONAL "
+    "SIGNCK SEXTANT-AGAZ DAEG D SHOE STILEAESHAE NYAMAESCULAPIUSTRAIGHT "
+    "WAWRIGHT GUARDCH AND LAMPDUATION CAP DECORATIONCELANDIC-YRCE OF "
+    "PIZZACCUMULATIONPODCHASHIEMRESPONDS TOQUERED FLAGBOTTOM MARKDOUBLE "
+    "SHADPOST OFFICE PROPORTIONDOUBLE RINGDOUBLE MARKCURVED BENDDOUBLE AND "
+    "VYKA ABOVE BUMPY ABOVEWE PALAUNG  S "
+    "ZAPYATOYCOMBINATIONQUIQUADRATEDALETH-RESHWING NEEDLEUNJO WYNN WAMUSED "
+    "FACE PLUS NUNUZUNIT DIGIT  PLUS MASH2BREVE BELOWANGULAR TOANDHI "
+    "MARKAKKHANGYAOUP NEUTRALIDEOGRAPH ALEF LAMEDRIGHT HOOKALENT SIGNUM "
+    "ROTUNDAUP OR DOWNORTHERN TAOSTAL MARKANGKHANKHUUNKIA SIGNING LARGE IDDLE "
+    "MARKSTROM SIGNST-FEEDINGIKRON ISONIGATING RAINDEX BENTINITIAL RASTRAL "
+    "SIGNIGATURE OEALLY MARK ST PALETTESSANGARAEAOROME SIGNUP HARPOONIED "
+    "SHRIMPUMAN EARTHING-SHIFT OSSED SHEISSANGPIEUPILE FOLDERINDU BELOWPOLICE "
+    "CARTWO THIRDSGBAKURUNENTERNATIVE TYPE COLONGGING FACEC WITH "
+    "DOTGGRAVATIONGHT LIFTERU CIN HAU GIMEL-HETHTEMPLATIONBSTRUCTIONTWO "
+    "SHORTSBROKEN BARGOLUBCHIK RIGHT SIGNOUTHERN TAOUTER JOINU2 PLUS BAGREE "
+    "SLASHBOLD SHAFTGUA PI MAOPOUND SIGNOUT INDEX CH BALLOONINHERENT ACIRCLED "
+    "CAFINAL HETHPLUS BELOWPLUS ERIN2TWENTIETHSCHECK MARKFOR "
+    "RECORDFORMATTINGCHAD RTAGSFRONT WALLTHDAY CAKEFTOGGOS OUTHAPASCAN Y AND "
+    "RICEGAGE CLAIMGANDA MARKCAPITAL ETTESE CROSSGAS BZUNG OTING STARBA "
+    "SATANGAT AND BOLTAYER BEADSXHEEJ CEEVAUTOMOBILEHOOK ABOVESYLLABLE MATTY "
+    "WITH ATRICHISMAHOTIC HOOKHREE ABOVEYMBOL "
+    "AIVAASTERISCUSASPIRATIONHUNGARIAN XED BICEPSI ARCHAIONICAL TAPERBELOW "
+    "LEFTBLACK FLAGHAAPRAANA UAM TSHOOJPPOPOTAMUSTAMAN SIGNHAMZA MARKHAN DIGIT "
+    "UARDEDNESSOUR FIFTHSTAIL GLASSICK FIGUREPRALINEAR HEADSTROKEUBLE DASH "
+    "OUND OMEGAHEAVY BEATHERMOMETERMONOSPACE  THOUSANDSMILLE SIGNSE-CREE "
+    "SKWHITE FLAGMINO TILE OMMA BELOWSCAN LINE-SBUB -CHALMONOFONIASMONOGRAM "
+    "BMONTH SIGN SCHROEDERMOTORCYCLE RGYA GRAM RESUPINUS POVODNAYAOLON EQUAL "
+    "PLUS SHU2 WITH LOW MADDA MARKMALL ALEPH-LUE KARAN WITH TICK WITH TAIL "
+    "WITH RING WITH RAIN WITH PLUS WITH PAGEME PLUS ENN NGGEUAET WITH EGGSMEEM "
+    "ABOVE WITH BELT WITH BASESELINE ESHRED DRAGONMEL SYMBOLON MEDIAL  TIMES "
+    "SHERESH BELOWNOTE WITH RUDIMENTA  DRAWINGS NTITY MARKNTO SHRINENUMBER "
+    "TENRSI SYMBOLWITH STRAWOF HYGIEIAWITH SPOON AND MOUSEOANDAKHIAT AND KNIFE "
+    "AND BREVE AND ARROW AND ACUTEREVERSED IWHOLE NOTEZU OVER ZUOLING FACENAKE "
+    "BELOWNANGMONTHOWHITE HAIRNASPIRATED OVER KAD5ND SEGMENTNDA PA NJIRHO "
+    "SYMBOLNDU TEMPLE OF DHARMAW OR MODEL-SHAPED HAROUND DOT NGLICANA WNGUAGE "
+    "TAG LATE FORMRUPEE MARK KABA TENUROUNDED ERRGE SQUAREWITH WINGSRGE "
+    "CIRCLE7 PLASTICSA PLUS IGIKA SATANGAKAI SYMBOLURIPIGMENTQUISH "
+    "QUADSIXTEENTHSKINDI MVOPWING HEARTURVED OMETOPEN SHELFKRYZHEVAYAR2 PLUS "
+    "SUUSEL HORSEUSHED FACEK2 PLUS BUWO SHORTS LA USED ASOP NKAARAELACK "
+    "JOKERUTH OR SPYSIDEWAYS I6 PLASTICSLANE MERGERAGGISMATAROAD OMEGAADDA "
+    "WITH ION BOTTLESS OF MILKAILED BIRDISMUTH OREIT MBAAKETSPACE MARKUPPER "
+    "HOOKITH DIGIT AEDA-PILLAOON SELENAADAK BINDIIXTHS DISHRKING FACESMILO "
+    "SIGNABATA TREEAB2 TIMES UR CORNERSUR HUNDREDUR YIG MGOJONG TILE SMALL TAH "
+    "A TANG LAIA PLUS KUR1 PLASTICSLIMITATIONLINDRICITY2 PLUS ASH2 PLASTICS2 "
+    "LONG MBOZH DIGRAPHRCHAIC KHALLOW HEARTLOGICAL ORVIE CAMERASHARP SIGNLIGHT "
+    "BULBLONG FINALRDHACANDRALONG OVER LONG TSHEG1 LONG MBEVIOUS PAGELOWER "
+    "HOOKLPAPRAANA LTERNATE ULTIC CROSSM STALLIONSGOR RTAGSRECIPITATEZAR "
+    "AMULETOON LILITH5 PLASTICSLE LETTER LE-DELAYEDROEZENIAN LEFT GUARDLEFT "
+    "HEAVYLEFT LIGHT4 PLASTICSLEFT SERIFLEFT-HAND VEL SLIDERZEIRO SIGNLEK "
+    "ATTAK LENDED YUS3 PLASTICSLET SYMBOLVERAGE BOXLGIZ EOLHXSHMIRI YEHLHAG "
+    "RTAGSLIGHT BEATE PLUS SUMDA PLUS HAEICH STARKTHMIKON N EDESTRIANSD WITH "
+    "DOTPASSIMBANGEARTH MARKTIMES SIGNDA SATANGAENETRATIONCROSS "
+    "MARKFFICULTIESEQUIHOPPERPEDAL MARKELT BUCKLETING HEARTTREFACTIONRING "
+    "ABOVEENTHUSIASMF SHE-GOATDOUBLE BARED FIGURE-EUTRAL YERED FINGERSEARLY "
+    "FORMEIGHTIETHSEONGCHIEUMENS SYMBOLCOLATE BARRING THUMBDIATONIKI "
+    "COMPONENT-DIGIT ZEROCURLY HAIRCISIVENESSDIRGA MURECOMPONENT DED PERSONCY "
+    "MESSAGETRETCHED CEVERSED PETOP CORNERFAHRENHEITCURLED WAWEBENSTIMMEEEKING "
+    "EYEETTA-PILLADUOUS TREECROPHONIC TRESS AND ZAL SASAKLIGHTNING247 DIPTEHOT "
+    "SASAKZENE RINGELEGRAPH LITTLE UPLISSANDO 5 CYPERUSROJECTIONUE "
+    "MAEMBAZAKRYTAYAHINOCEROSLINE FACEOO DENNEN5 BATHTUBDEPARTUREHOOK "
+    "MARKPROJECTORP ELAMITEP DIGRAPHLEFT RINGVELOPMENTLEFT TACKATTACHED "
+    "HIYYAALAAEMBEDDING3 PLUS ANELLOWSHIPCRESCENDOAVE ARROWATHAMASATVER "
+    "LUGALVERLONG AWASH TAILXHAUSTIONEURO SIGN-LOW TONEHARD SIGNTO "
+    "CORNERPPOSITION-MID TONEMAEMGBIEE-STACCATOHARACTERSM HE-GOATBEER "
+    "MUGSTUKWENTISHEADSCARFONE MARK-CORN FACELVIN SIGNZIR SASAK0 LONG LEHALF "
+    "SIGNBIAL SIGNPPOINTED HALSHELETSEMICOLONMBROIDERYEFORMED "
+    "TSEPTEMBER-AMMONIACMARK SHADMARK CIM TAKHALLUSMALL RING-KHYUD PAB "
+    "DIGRAPHRDEL DKARONGSEONG HI SYMBOLVICE MARKVEUAENGAMLOND HAIRRCHAIC "
+    "RALLABLE OMLLABLE B0ZERO SIGN2 GARMENTHIMA SIMARCHAIC IIVISARGAYAONE "
+    "THIRDSHAB CEEBVOETOCHIEVOCALIC RTABE SIGNBASE UNITREAK HEREONG "
+    "GRAVELIVERANCELOWER DOT1 CHARIOTVINE LEAFVIGINTILEEIGHT OF LONG TIP "
+    "UBSTITUTET ON BONET OF MEATAF PERSONISEN-ISENAFFE FACEIGHTH ASHSPIRITUS "
+    "IRST MARKQUADCOLONIGN NUKTAUPPER DOTIGN SAFHAIGN TOMPID "
+    "SALTIREAINTBRUSHAISED DOTAJANYALANAOS ICHOSER BUBBLEAL RUNOUTITRA "
+    "SIGNARCHAIC MIVINATIONSTRELNAYAIVE-PULL-UPTSTIMMEADEG ADEGUMED HEADPIDERY "
+    "HACUBE ROOTADMA GDANPAA-PILLATTED STEMYEH WITH IGH HAMZAWRY "
+    "SMILEINISHMENTANGGEUAETANG CITI ING STONEANEROSIS IN SQUAREING LANESING "
+    "GLOVESTAL BALLING DOLLSINAL NOTEINARBORASING CARD UNGSEONG UNGLASSESESAME "
+    "DOTANTHAKHATANTAYALANALAYALAM ANSKRIT SILE TILDEES AKURU ILIPPINE "
+    "STEBASKETACE NOTE ERCIAL ATALI GALI PADE SUITERTY LINESSANGSIOSORTH "
+    "WINDALPAPRANAINNYIIYHEORT-TWIG-OP HALF OLACKFOOT Z DIGRAPHETRASIMOUHWAZ "
+    "EH EL ME HANDKYO TOWERKU RU KHAKSTREPTONYEH ABOVEI PLUS LISIVE FACEURUZ "
+    "UR UAS MEMBERR PLUS RAKING BOOTXCITEMENTUURDHAJA DENT AND VANAGARI EMPTY "
+    "SETETTI BALLHREE FOR UVUZHAKKUIA SYMBOLRIED FACELARGEMENTUTRA MARKLAN "
+    "SIGN RO WIDTH RNEY PARATIMES NA2A PLUS NAWORDSPACEK "
+    "GESTUREURAMAZDAAAROSHTHI WITH FACEUR-DE-LISPANYANGGAENTRY SAWSMALL YUSARM "
+    "CLOCKKA- SHOG JERUSALEMDAD WITH IDEOGRAM ARISTERA ABOVE TO IDEWAYS USOF "
+    "PASUQWRINKLES ETER SIGNURNED GANIALECT-P WING STARKEMPHRENGURNED "
+    "AYBQUSHSHAYAOTAL SIGN5 LONG JOURLY LOOPKAMEYTSA YRANISMA TIMES PAPQUEEN "
+    "OF ICE CREAM OF PAPERCAPITAL DS DIGRAPHCANG TE-UCLOSED PL OF BLOODOVER "
+    "MUSHDOWN STEPDOWN SIGNNDAILING NIGHT OF NIGGAHITAOKED HEADOKED TAILRWARI "
+    "DDANGUN SIGNCARTRIDGEOKOUFISMANGER SHIPPENTASEMENG SANDALCAPITAL "
+    "QNFORZANDOCAPITAL ITEH ABOVE PLUS SAGY-FOURTHSROTATION-GITTARIUS PLUS TUR "
+    "PLUS ZA7EBIT SIGNMUKPHRENGBRUL SHADCOIN SIGNOM SYMBOL RA OR "
+    "RIMRACHNAYATED PLANT OVER BALNCLOSING  OVER LUMFACING UPREFORMED DOWN "
+    "HANDNIHSHVASAEAVY DOWNOVER GAN2 PLUS GAL PLUS GUD PLUS KU3Y-FOURTH NA "
+    "KHONNA PLUS LALTRAIGHT UNVERTED RFLAT SIGNNUSVARAYANTRACTIONRTER "
+    "MARKNTESSENCENTERPRISECHAVIYANIOW KAVYKAE AT "
+    "LEFTODIASTOLERPORATIONOCCLUSIONFINAL MEMFINAL NGAFINAL NUNTUTEYASAT AND "
+    "BELT AND CURL DIVIDERSDUS RTAGSCHOSEONG OF STIMME AND TAILFISH TAIL "
+    "APODEXIANO TELEIA FROM BAR GARSHUNIRFUL FACEFROM WALLFEH WITH RUM "
+    "CLEF-DRAM SIGNNING SIGNY BLOSSOMG IN HOLEPLE HEARTRTS MEDALNSERT AT "
+    "CHANICAL YEAR SIGNEFAIDRIN FOUR BENTPENT SIGNCOMPLETEDMHANCHOLLVRAKHIYA "
+    "ED DIGIT BKHASIAN  TROMIKONTREDECILEOURA SIGNREDNE ON ON GROUND TIMES "
+    "HATANDSTILLBITE LIPS STREAMERTRESVETLOBO GYFU GBOTH BENTMETOBELUSBO "
+    "BAIMAIBING CANEEEN WITH RED JOKERHALF NOTEGREATER Y RICKSHAWGRIK "
+    "SIGNHAIKSUKI BICYCLISTTONE MAI OUTH WINDOUT MOUTHPOSITIONS TIMES UDED "
+    "PLANET SPARKLERON TEUAEQRED HAIR-PHIEUPHPAVIYANIMALL AXEOHM "
+    "SIGNMEM-QOPHSPERSIONIS FORM IS WHEELIS-PILLANRES TOS TTUDDAGAEN NYAM "
+    "CURRENTPALOCHKAITA MFONON CROSS-X BELOWJACK OF JAVIYANIM ALLAAHPENTAGON "
+    "HANDLESSNA LDANWO ABOVENO THUMBABOAFILIWRINKLEDABAAFILINO SLASHROSSED "
+    "OZWJ THAJNITIAL ZWRITING NOTE PADDS-CREE OREHEAD ONE FOR EGORIAN "
+    "DOCUMENTACKSPACE FACING NOVEMBEREOUT BOXSOFTNESSDIFONIASVOMITINGING ROD "
+    "SENTAGONYBEYFILITRI DISHRIYOOSANDUSHENNADIT CARDEREVODKAQAIRTHRAERDIGRIS "
+    "ANTENNA YUQ NAEMARRATANALLIANCEAMS HORNTTO MARKODESTONEOCUS OF "
+    "PAIRTHRAOCK SALTME BADGEING BELLING BOWLOCALIC MERAL "
+    "URNDVISVARADVANTAGETO-LEFT PAKPAK EOBOOFILITOWARDS VOLUTIONUP TRUCKORM "
+    "FEEDSQUEEZEDAIYANNOI CEDILLAMANGALAMMANDARINRESVETLYIRD MARKRSE DUNGER "
+    "TRUTHDIM GUNU AT DUSKRILLIONSD BUBBLE-KHIEUKH-CREE TH-EM DASHD CROSS "
+    "TTENTIONE OF POO PLUS DUREE MARKNA METEKN-JOINERWASH KAFRAMMA GGVE "
+    "SASAKEBEEFILILOCATIVESALT OF MY HOUSE OVER ZI56 TURO2RDEL NAGLATION XV "
+    "OVER M OVER MUNCE SIGNLONG BARNAVIYANILEANING MMATION  SLIDINGNAMENNY "
+    "ZAKRYTOE PLUS DISANYAKA ELEPHANT3 ARMOURSHKIR KARAUGHTS VESSEL "
+    "BTRICOLONTIRRUP REK ONKAROM NTEUMLKULIZMYTISMOS E RASWADIOMANIAN OLLOWING "
+    "PLUS RUMON TIME SCOTS SOO TYPE LESS SHA SATCHELRASMIAN LESSER YSHORT ER "
+    "OVER KGVERGENCELF RING ECH YIWNSHOE JOTLFWIDTH  POLNAYANI ABOVE "
+    "TALENTSLUB SUITLTRY LEGFILE BOXWON SIGNNG RTAGSDAMMATAN8 KANAKOSIX "
+    "DOTSLOZHITIEJUNCTION KEMBANGA SIGN AZWARAKAYREATNESS LANTANGNINE OF "
+    "NEUTRAL ED BRICKKAIYARAAYRILLIC 0 BRONZEQUINTILEKASRATANKATAKANASMA "
+    "SIGNLORRAINELOW DOUBMIONIAN SIGN LAEOMMA BAR OF YARN1 HELMETSIFISTON ON "
+    "LEFTDDY BEARS OCHKOMEN NTEUMSCRIPT GLONG S T OTTAVA WN HEARTSE "
+    "WEDGEENICIAN DANTAJA  NUTILLUW PRINTSYPORROONNEIFORM LOW STOPL "
+    "POLISHL-LAKUNALA LENGA1 BARLEYNED FOODBOL SIGNBOT FACEGREAT SAEST "
+    "WINDPUSHPIKABOX TRAYBRA FACEGORAZDO BINOVILEHALF GURBIEE FONETA "
+    "SIGNBILLIONSICHAEAN TAR EYESARCASITEHAGALL HOT MBUAEBLE SIGNET SHOESBLED "
+    "CARBLINEAR COMBINEDARKLEAN GBASINNACABLEWAYGENITIVECAL DISCCANDICUSAPITAL "
+    "FC SIYAQ CLOSED TGARITIC ESH LOOPIGMOID SOVER BU "
+    "GLASNAYABUNDANCEARRIVINGYIDDISH OVER GA2TER FACEAR TSHESOVER "
+    "GI4AZHAAKKUASTERN WAST WINDSUPERSETAY-NIGHTUDAWADI ETRASEMEBACK "
+    "YERBACKWARDT NGGEETHESPIAN EVEN OF PUB DAWBEUFEUAETOTIFIED TICK IN "
+    "UKEUTNDAATH MARKSWIMMINGPROSTAYAATEBOARDWBOY HATHOP BELLATE MARKATAKANA "
+    "HREE OF AVY BANDBER POLEARTYRIA SUCCEEDSHARMONICHARBAHAYULLS LEGARSI "
+    "YEHUATRILLOUAREG YAHAN-AKATBEVERAGEEXCHANGEXCELLENTEVERANCETAALUJA "
+    "PRECEDESCOUNTERSBATBEIT COUNCIL ANC SIGNI SHAKTIUBJOINERTAI LUE PUN "
+    "IYEKIMANSIS YESIEUNGUNDERDOTYER YAGHY BEETLEUNDERTIEYENISEI CASSETTEANE "
+    "TREECK CHARTCHINESE CEILING CURLICUECLIMBINGFRICAN DANS SIGNFRAKTUR "
+    "OVERRIDETHOSCOPEINAGARI FEBRUARYTHIOPIC CER BALLCHATTAWAFINAL THUNG "
+    "DASHFOR STOPOVER TIROVER SAGFLOURISHOVER SHEY POPPERCURSIVE TURNED "
+    "MCHIEUCHRDO RJEVILLAINEIGHT K1 ARROWCRACKERCHEVRONMAI "
+    "SATSEXTILE-MU-MO-SERPINATRAINERPAYEROKHI SIGNPPROACHUBUFILIPAYANNAVILIK "
+    "BONGONANHEXAGONDIARGONBAMBOOSONG UEXTAISYOUCHEINAPTHKUQI "
+    "MAAYYAA-THIRTYVOICINGREATHY -TIKEUTNUMBERSLYGISMA BUTTONHEADINGCOPTIC "
+    "-WELSH BARREKHTHIEUTHCK LIMETA MARKSHAKINGHAYANNAFLUENCE0 WHEAT-SHIFT- "
+    "CHIKI  CER-WA0 SPEAR-MACRONOGDIAN AUNTLETDYNAMICAULDRONLEK "
+    "TOOVEMENT-LENGTH-FINAL Y3 WHEELRARIETY3 SWORD3 SPICERANGKEPRISIMOUSHORT "
+    "A3 OMEGA3 MONTHLEUT KALEYBALLWO FOR RAKHANGBAIRKANFINAGH "
+    "OCTOBEROCTAGONROGRESSP PIEETRRECTUSVAV YODATH OF VAYANNAVE DOT EULEUNGAU "
+    "MARKYANMAR 2 OLIVEWIGNYANSHIFT TE GLASSLJUDIJERAYANNAT ASHESTIVATE PLOYAN "
+    "VEW NOWWIFRUITRD DISKRD FACEHIUCHUSLF FACEYMAIC LSYNAGMA3 EIGHTROKEN L3 "
+    "AREPAE DRINKOF SOAPPRENKHA APLOUNONTIEEN26 EYYYAXIMATAEL PUMPAY SIGNLIGHT "
+    "X2 WOMANOFFICERDHALATHECEMBERSANGAN GLAGOLIBUFFALOSANDHI Y GREENOVER "
+    "ANBULANCESAMPHAOCAYANNAMUNGKAHOVER DUEAVY YANIKAHITCOASTERGHEUGHESA VAH "
+    "NANCIALBOURINGGRADUALEAD ORETORNADOF SASAKCLOSE EGOLIAN  ISLANDTHALIYA "
+    "RAMBATMRACHNYBREVIS ZQAPHA POMOFO NJAEMLI KEFULAPEGERMACANDRA "
+    "OKRYTIEGAYANNA OCLOCKCAP TEN MENDUT MAELEENEQUDAAOLAPUK FAYANNANESTED  "
+    "MUQDAM MUOMAENG MASKFATIGUEOWILO STYSCAPES-SAJDA PLOPHUCLOTHESRY "
+    "FACENAYANNACABINETSAYANNAVYSOKO GENERAL LONSUM OPEN-O "
+    "WOLOSOMASSAGEDIPLOUNRTHIAN DISIMOUOUR OF MBOL B0TALL AAFORKINGBIG "
+    "YUSHALANTACLEAVERYAYANNAPENGKALMEETORU WAAJIB-KIYEOKTHESEOSBERGINEMANCHU "
+    "BERRIESHANGUL WDRIVERCONTACT-CREE RMARCATOOW ALEFDU NJAAYA LAMPVOWEL "
+    "KCELSIUS TEDUNGOUT HUBTCHFORK STRIDECOMING BOARDEROX "
+    "LINEXOPHONEMINGKALMINIMA ED RICETAYANNA SLOWLYDRIL "
+    "BUBORZAYASCOOTEROMERANG SHAKERREREKANOX BACKF DAVIDTASHEELON "
+    "FACEMERICASHAARKAABLACHKOPECTIVEDOFONONRIPPLE POVODNYRESILLO FLEXUSURFACE "
+    "ASH FROL SEGNOSTERINGER THANUSSYERUDAYANNADA FACEIC "
+    "WANDILLEANNSUKUUDOALESMA TSECHKASIGN UDIBIFILI9 NGGAAUP "
+    "SIGNAELAENGKYLISMAUN MEUTYELLOW SOV ROGWO WAENURGLASSIL DRUMHYAAUSHUP "
+    "MARKANGOLATALLOT XOT REPHA NAME ARRED OPTHAHA LAGIOS ANGLONGAD NECKIMILAR "
+    "LAK-050ASHTRA QUEEZE PUSHPINA -PHRUPERVISERA REPAUP HANDTIKRAMAOP "
+    "MARKOREVMA ITON RAORTIETHENSHUETI NTEUMKHA YATAHAPAKHI RTAGSDANESE "
+    "KOMBUVAKEUAERIKOQNDONDANCINGAS SIGNKKURUNIAETMEUNSPRINGSISIBLE "
+    "IKHAHITTRYASKA7 NGUAND MOUTHIANGQI UP TACKTROLLEY7 NGGUAUP STEPRMUKHI "
+    "ITALIC KUTAARUKARO BAD MADDAETNAHTAKORONISR2 GUNUKPAK WAUT TIME9 "
+    "CLOTHAPEZIUMORKHON KAYANNAPALLAWAUYGHUR WORSHIPST "
+    "TUBESOLDIERLAYANNAJIBWAY YAH LI WAZ EOHWO MARKATAEAN SIDDHAMTTILIK "
+    "ICYCLESLASHES TTHACANPSTICKSJAYANNAPANESE JARATI JECTIVEESTIVALLE "
+    "LEAFORCULUS5 NGGEEQUARIUSVAPOURSVANESE JAIN OMPANSIOSUKKAKHAPURPLE AN "
+    "MARKERNIN AJERAN JARDNESSUM IYEKANDERERARRED BOT NGOMIFIED EAM ALEFACTER "
+    "TDEAVOURICOPTERYNAMIC EN LEAFIVE OF ALTILLOANGKUOQ6 NGGOOURATIONLAMITE "
+    "PHUTHAOASUTORUINNABARANGLED AMAKKANCALATENCH FRSOUNAP "
+    "QATANAPYRUSYAKASHPEPPERAEMMAEPOKOJIS TENTRKAANUISSANTGRASP GGLINGISSHARED "
+    "ICEGLAZ HEPACT POMMEERIISAPF CLEFPALUTACLOSETARBUTAGEDOLAAESURAESTAN S "
+    "SHOECODILEGNANT NDA TAITULUMNACLESGOBLINSAUCERN DASHIGGLESWN BOXITHER "
+    "YOMBO MPLINGWEORTHIEVAN ARADDON YANGU MBITF MAREN-NISFBURGERED CAPIYANNAC "
+    "CLEFIXTY PSPATHISTOLI SAADIYWN BOWGHEUAEIX OF "
+    "ITABLEGORGONGHETTIGHAMALISSIMOSTROFOGO NGUBOWTIE "
+    "RULERSPADESDUCEUSNTEVMANTIIMUSTANCENTOGENANGKATINHALE "
+    "CARETPICKETCHEIKHINGAATCHEMA RSIAN CHESS E WAVECEVITU EQUIDUP "
+    "BOWQETANACKNESSNOWMANNOZHEK "
+    "EPOCHCHADINQAMATSCHAMKONSANAQFORTISFORMEESTANCYINSHIPNSUZ A DIPLIOGONEKFF "
+    "OF OCIETYSSLESSOBELOSCHURCHOCENCEDVANCEANCHORUNGAAMINDHI  "
+    "AGUNGPENCILODHADHINAGMAOW TIERSHANARSENICCHIRETCHO CHIN "
+    "YEHOFOUNDERMATATUXEDOINCUNXGANGIATEUWENAPISMA MELIKNGBAT AILURECARIK "
+    "FATHA STLERS LONGAAJANI OSETTECASTLETHAKKUAPLI MGBASAQAFFIX TERON "
+    "SPITALSPLIT AGOGUEFAMILYIRINGUUPNAYAAGRANT MURDANEUME "
+    "CUMBERILBOATNKNOWNOITIC PWATCHILLAGENOKHUKTIMATENOR BUFRAMESX FACE "
+    "FACE-TOPBAR LELETCATAWAAK-668ANUARYREMEDYAKABATGEADALNIRUGUNISTERCUPPED "
+    "KAPALNIZKO RENGTHEAHMUKT NJAQ7 GUAN1 WINEHIBIT SHAYIM7 KAPOBAFILI7 "
+    "MBEERAAKANLONG E7 MBUURISEMEHEUAEPKY WAY1 NDEEVILIAN7 NDOORBITSAHINGE "
+    "LISHA 2 KPOOLITIKIHUR PARACINGHIMAHUTIRYAKCRAYON1 "
+    "HORNVERTKAONOCLEASHGABUDARKALLIPOPUCIBLEEIGHTY0 NYUNSUCKED00-102I "
+    "HOOKKRISISDICINEDIESISWINDOW0 NYON0 NGGO0 NGGIENIKI PUFFEDYIN-DOEVENTHI "
+    "MAIMUBLE X1 GOLDOPEN D1 GBOOKUSHU27 NGONHERMESBANWA VIRIAMOPEN PKTIKO "
+    "ZHITSAHEISEIWRENCHATTIC 4 MUAN5 WOOL4 KPEEWO OF 4 DEER4 DART4 "
+    "NGENSICKLEUZEIROUYANNAEUNYAMOTTED-5 MERIRICORNROCKETOOMUUTEUAENAEU "
+    "MBURAKLITAUTUMNHORT IDERMA WBERRYSWORDSEMASTILD MAP4 NYIN4 NJOOEMPUS "
+    "ATTERYRAVEL-SHMAAMLAMADHSURED SURANGASSINGDGEHOGTRIKE LIGIONLIGON LAMEDH6 "
+    "TREEDE DOGSYOUWAHUMBS 2 NGGULAFRON2 MBOOOOPED LASTONUGGAGEELLITE3 NGGA6 "
+    "GUEIUUMISHLEVEL-EUREUT6 HUANHO HOIEN GHESYNAFIHIVETE3 HEEI3 GBEE6 "
+    "NGGECREASEPBOARDA HAAMEENTH-TARGETPEAKS "
+    "EXISTSENTIMAUAEQTUBISCUSTIKENOPECIALON KEYBISHOPHAMILOIASMA IB YAMBETAN "
+    "KASAR 9 NJEEURNAMABGBIEEHAMEDHUANGXIHAM AIYRENE HALF HME "
+    "DIEEXHALETAMINGMECHIKAASHAEET KUTGURAMUIDE ESBLINK XO NEODOKMAIGS-PA "
+    "BOFILITRAPLI SPLITTE TSETE USEWORKERTAU ROTAUROSXIMIZEA-KARAPIRIT EYANNA "
+    "TIKHYDAGGERMALL FMALGAMHE MGOKEYCAPSKAPI "
+    "KLITONTURBANARSEOS-IEUNG-HIEUHMADR MKILLERMADDAH8 MBEE-PIEUP8 NYAN8 "
+    "NYENHASHKASIXTHSTAIKHUOPITSAM BULLMANYA 8 HOOUBEFILI9 MUENM BOARYSTICKKE "
+    "PHO-HIDETKAYAH QAAFUROGOMPONSERAIDAPSILIOKARAPITERPEN-PRICEMRITSIWIDE "
+    "WINDUPLHAUOUNCEREIWARONOSPASEQWISADRELA OPLETPI "
+    "RORILLAOMMAER-RUBOMBIEPTUNEWINJAOLD XPAATOOTERIPEITHPCHA QUIRYRCHIDPOLI "
+    "PLUTOPMUNKOQPENRACHYOTHALROWN RIEENPLUTAWIANGREGIAPATAKPEN ORELAAOKEE "
+    "OJKI RIEULORUTOPEAN "
+    "PEPETRDIONPPAGECHADACEREKCECEKCECAKCCOLICCEPTCAUSECAUDACHERYCANUSCALYACAKR"
+    "ACAKESCAANGBSTERU U UBREW CLIFFTUEUMCTRICCROWNTURN "
+    "YENAPCLUBSCLONECKTIECKAGECIEUCCHUTECHULATUUMUCHOOLCHOOICHIMECHESTASPERYIZE"
+    "TAWAY AVROSAUTHSUGUSTWBOATATIYAUKARAUDAATASEIAARTARARERUUMMERAR "
+    "AEAPPLEBHADHBORZYBOOTSBLANKBLAKOBISAHBHETHCUBEDBENDEUBITOBEITHBASSABASA "
+    "BALAGUBURUUBUTSBACUSBAARUENANOEMLJAEMBICTINNETIPPIEKEETEISMATKAANEIDONTMAA"
+    "UEGL HEGIONEGALITON AEESHIERINETIGMAET TUESO "
+    "EESHE3TILESERKHAEOPLEEO-"
+    "EUYAMOKENUTOENJETENENGENDEPDESTYTRIOLDEPTHDENCEDELTADBOATDATUSDHAM "
+    "TSADIDAIC TSEEBTSERETTOCKTTORUDSMANEBALLTORCHEAGLETORSOE "
+    "GEETRACKTRAIFDWICHYECEKDOTS-DLINGDKAR 2 HOO2 HENZHAIN1-VAS1 YOO1 WVI1 "
+    "TWO1 TEE1 PEEVIET 1 FAN1 DWE0-VASVITAE0 OIL2 KPA0 MAN0 JOO0 HEE0 HAN0 "
+    "GEE0 GBO0 DWO0 DOO0 BEEZIDI -SIOS-RING3 HIN4 LOO4 LEE4 KPU4 GBI4 ABB32 "
+    "JE3-VAS3 WEI3 VEE3 RA33 NDI3 HON-BEAM3 FOO3 BOO2-VAS2 SEE2 PTE2 POO2 NJU2 "
+    "NJA2 MBU2 MBE2 MBA2 KPIWAAVU KAWI JERA ILUT ICON HAA  GORAZYGOS FUJI LACA "
+    "DEKA COAT CHWV CAPOWAQFA AMPS ALLO-ALAFZILDE TELUVRIDO4 MBO "
+    "SARIZSEKAVZMET MOODAAMAEAEREEAEPENAEMAEADULTACHKAUQUETAGMA AADHUA YUEA "
+    "UNAYSTER9-VAS9 YEE9 WVE9 WVAURINEURITYALOG ANNONANGELUNGBAUNITYAMEKHUNOO "
+    "ALPHAALLI ALLEYALGARVAAVU7 FUA6-VASUTEUX6 WEE6 TA26 SOO6 SIA6 RA2UTIES6 "
+    "KOO6 GBA5-VASWATTO7 GBE5 NDU5 MBI5 KEEVATOR4-VAS4 WUI4 WOO4 VOO4 TOO4 "
+    "NDO4 MON8 KPO9 PU29 NUN9 NON9 NDE9 NDA9 MUN9 MEN9 KUA9 DEE8-VAS8 RO28 "
+    "NWA8 NAN8 MAN8 KPEURTLE8 GBU8 FEEYURII7-VAS7 TWE7 NIN7 NEN7 MIN7 JEE7 "
+    "HUNSAKINNABLAK-020JUEUIJUDULJUDGESADHENASHIJERVINCORAJANG "
+    "SOLVENEGARNEMKASALADKTOP KO LAKNOBSNENOEKHAPHWLINESKATEKESH2KERETKBALLNA "
+    "POKARORINGSARYASONGUE NIEUNIMMERIMMA IMGBANGMANSTARTRUSH ILVERNINTHILLU "
+    "IKURUIKARAITUALNGENTITHI "
+    "ISTLESPINEIRACYKUSMAWU318WUAETIPINGIPEHAINTHUINNA LURALMETEGMETRYMI "
+    "ROMIEUMMINGOMISRALWAY LOUREMMOTHSHAR2LOOP "
+    "SHARASHARULOMKAMEIZIMEEMUMELONSENTOSEGOLMENOEMAQAFSAUILMALONMAIZEMAI "
+    "KMADYAMACUSMAALAMAAEHMEPETM "
+    "RAMLAMDALEASEMROCKMSHAELAYARSICLELATIKLEERIMUCH MUOY "
+    "LAGUSLABORLABATL-JUZL NETKWAENSILA3LOBE LOAN MPARESATA "
+    "MPIRESHIMASHOOKLENISSHTINNUENGGHULUNZEUMGHNUTGESH2GEAN XTRA-TENSEO ANGXW "
+    "XWGAZE-O BOXO KAIGAMANGAMALGALGAO PLAHALA HAINUHADDAHAALUXING GVANGGURE "
+    "GULUSO RUANTHA GORGIGOGI TEGEHNTXIVEYYALFEARNFAIHUFAAFUF SOWF EWEF "
+    "COWOCADOEYBUSEVAL "
+    "EURAEEUAEMFLUTEGADOLXYOOJRRITOFSAAQFORCESTNUTFLICTOBYLAFLAGSRUHUAHOLARHOLA"
+    "MIARDSHIUTHHISTIHIRIQWFISHIAUDAHIMELRUDAAICHONRULAII KOISUKUNNNAN HUTA "
+    "HUMP SURYAHROOMHI ROI-RESHOUR "
+    "HOTELHAYINNSUAERUMP-NSYONHATHIHASE-"
+    "HANNAIHVUSHALQAHETHEICRONNSIEESTORMRUNAVEDESEENZZY "
+    "SEEVRUTUVUEQRPSERUSIWAHAVEUXVEYZWAIRVIDART "
+    "TWAETVIYORUKURUISRGU2RROIRRORVOS "
+    "SA-IRSO-VEUMSUNGTWAATURUSUABTUKIWDERTZELTFONTAXIUSA "
+    "SHTASHYASEYEUTTYROARROOKRIFYUTANUTAEUNAHULU SOKAUHURUGU SELFSLURUON "
+    "SINKSIKIWAW ROA IITOILUYILETALTAIK HALDAIGERIFATAILMIQAAIPODWULUINY "
+    "INORALAIHOKEHSDAAPAQAPONHOM XEYNARA3HMI "
+    "HILDHIINANAEHWAHHWAAXEIAHUVAHUENHUB29 PA8 PI8 QE8 SU8 WEYUDH9 JA8 KOLAAN9 "
+    "PI9 SEKWAA9 SI9 SO9 TA9 TO9 TUA IE8 BO7 VO7 "
+    "ZALIWNLIUMLIFUYUKULFIELFERA-HA8 DU8 EN8 FO8 GU8 JIJOT JIIMJEONKAAFAFELISI "
+    "KOKOKOKEKOETKOBAAACUKMA "
+    "KINIKICKKEUPAAMUKCETKAPHKAKOKAD3YEUXBUNGBUOYEKAAEIWSEIRTEIPTEHEHCANOEETACA"
+    "SECAYNEENUEENGBETHBORECWAACRETDIM2DGERDEADDDHIDDAKDAGSDAIRYAWNCHAUEEEECHEH"
+    "EANSEAAECKENDZHACOONCOREARUMGUINGRU GROMGORTGOALHID "
+    "HEYTHEYSHEYNARGIHEEPHEENHAYNAROOBAGSFITAFIRIBALDFFINFEUQFETHFEEMFASTBASHBA"
+    "YIEZZOBBITATYAAULAGIR2GIEAGIDAGIBAGHWAGHOMGGWSGEDEGAMEFWAAONAPONA 13581 "
+    "YIOJI 2 BUOFUM2 KA2 L22 NOOENG2 PE2 QO2 ROOPOD1 DA1 DO1 DU1 GAOOTH1 "
+    "HAOONU1 IN1 KI1 KUODLE1 PO1 QI1 RA1 SAONUT1 SI1 SU1 VUNJAM3 LE3 ME3 MI3 "
+    "MU3 PA3 RI3 TANOWC3 YUZAYNZATANGA2NUNG2 SO2 VIOBROOBATO-YO2 "
+    "YANWAANUUNNUTSOPUSZELO3 A33 EENTOC3 JENTAA3 JONSUB3 KU3 L3NRUANPEAQOPA R "
+    "SQHAUQEF  OHMPRILPOLOPLUMPLUG WEBREIA C DRAFE0 WI0 NI0 PU0 RA0 SAOUBT0 "
+    "YE0 ZOORII028BORAXPHABZIZ2PEUX-ONE-RAYPEEPPEEIPAWNZIET-UM 0 BIOXIA0 HO0 "
+    "JU0 KO5 MO7 DALUIS7 BEYWAA5 LIMWAA5 NUMVAT5 OO6 HINAG 5 AU5 BB7 EI5 "
+    "DEMMU25 FANAAU5 FE7 DD5 GI5 IN5 JU5 VA6 QAMUAS5 TOMARU6 PO5 VE5 WAMPET6 "
+    "NA5 WE6 LA6 L66 SE6 JE6 JOMUIN6 WU6 RUMARY5 TENDUELOLL4 L44 NE4 TE4 TU4 "
+    "KE4 WAMEAR6 HENDAP4 WI4 ZE7 LU4 DO7 TIMESOLLONMFAA6 DI4 FI6 FU7 "
+    "REMIIMMIINNEO 7 KIMLYALOVO7 JA5 A2NAM2BIBA7A9819E30 EZJEVOKTUJ8 "
+    "AZUPDA2D70D4272CCYA7 OCWIVOY6-0VUUZORCAICAHCA9BXG8F06D7CIG8 "
+    "I62018D2-0UMX20B1211-0AG-1-225314D1553053-031C4 E2DDAL23 D3 "
+    "I4-0ALK04AB890B9B57UDYAYDUEH5B65570 U550VNOUQA0-0AUJ5 UAEF1 "
+    "XUKY5-0UEZAWXAUMLULMU WOQKUEJAHJAWJEUJHAKUGK00LFALJELK "
+    "L00SIIPOQQIGPUQQ00QARQIFQOFQOTQUFO "
+    "YOAYRQANIBNIIOEHOGHOIXOMSY00F14F8CFAJFLYFOMFUEEYKEZHREXXWVEEGDZETOVE80TJED"
+    "UBX00DE6IMNXANHAQDJAHOJHOXHSASUSI-"
+    "IHHAZ0C0HZF3G0G916171A1D1F3638394048494B4E0964929599A4R0R7S0P0VDM0";
+uint8_t UnicodeNameToCodepointIndex_[231332] = {
+    0x18, 0xc0, 0x00, 0x6a, 0x16, 0xc0, 0x00, 0x80, 0x15, 0xc0, 0x00, 0xa4,
+    0x03, 0xc0, 0x00, 0xec, 0x04, 0xc0, 0x01, 0x49, 0x0e, 0xc0, 0x01, 0x6f,
+    0x17, 0xc0, 0x01, 0x93, 0x0a, 0xc0, 0x01, 0xb0, 0x0b, 0xc0, 0x01, 0xce,
+    0x05, 0xc0, 0x01, 0xee, 0x14, 0xc0, 0x02, 0x18, 0x19, 0xc0, 0x02, 0x32,
+    0x08, 0xc0, 0x02, 0x4a, 0x0f, 0xc0, 0x02, 0x66, 0x12, 0xc0, 0x02, 0x86,
+    0x0d, 0xc0, 0x02, 0xac, 0x06, 0xc0, 0x02, 0xca, 0x10, 0xc0, 0x02, 0xee,
+    0x1a, 0xc0, 0x03, 0x14, 0x07, 0xc0, 0x03, 0x2c, 0x09, 0xc0, 0x03, 0x83,
+    0x11, 0xc0, 0x03, 0xa5, 0x1c, 0xc0, 0x04, 0x09, 0x0c, 0xc0, 0x04, 0x2b,
+    0x42, 0x00, 0xe5, 0xc0, 0x04, 0x43, 0x1b, 0x40, 0x04, 0x59, 0x03, 0xc0,
+    0x04, 0x6d, 0x07, 0xc0, 0x04, 0x7f, 0x0b, 0xc0, 0x04, 0x95, 0x11, 0xc0,
+    0x04, 0xbd, 0x42, 0x04, 0x51, 0x40, 0x04, 0xc7, 0x03, 0xc0, 0x04, 0xd3,
+    0x1e, 0xc0, 0x05, 0x0d, 0x17, 0xc0, 0x05, 0x19, 0x0a, 0xc0, 0x05, 0x2f,
+    0x11, 0xc0, 0x05, 0x4b, 0x14, 0xc0, 0x05, 0x77, 0x07, 0xc0, 0x05, 0x87,
+    0x0b, 0xc0, 0x05, 0xa5, 0x19, 0x40, 0x05, 0xdd, 0x07, 0xc0, 0x05, 0xed,
+    0x16, 0xc0, 0x06, 0x34, 0x03, 0xc0, 0x06, 0x51, 0x0d, 0xc0, 0x06, 0x8d,
+    0x0e, 0xc0, 0x06, 0x9b, 0x0a, 0xc0, 0x06, 0xab, 0x05, 0xc0, 0x06, 0xc7,
+    0x10, 0xc0, 0x06, 0xdc, 0x11, 0xc0, 0x06, 0xec, 0x42, 0x00, 0xe5, 0xc0,
+    0x07, 0x1e, 0x1b, 0xc0, 0x07, 0x28, 0x12, 0xc0, 0x07, 0x3c, 0x0b, 0xc0,
+    0x07, 0x5b, 0x17, 0xc0, 0x07, 0x79, 0x0f, 0xc0, 0x07, 0xa5, 0x19, 0xc0,
+    0x07, 0xb3, 0xcc, 0x85, 0x50, 0x01, 0x4e, 0x60, 0x14, 0xc0, 0x07, 0xc3,
+    0xc2, 0x38, 0xf3, 0x0f, 0xd4, 0x99, 0x06, 0xc0, 0x07, 0xe5, 0x0e, 0xc0,
+    0x08, 0x07, 0x17, 0xc0, 0x08, 0x2f, 0xc7, 0x2c, 0x55, 0x01, 0x38, 0x43,
+    0x00, 0x08, 0x41, 0x10, 0xc0, 0x08, 0x45, 0x15, 0xc0, 0x08, 0x68, 0x16,
+    0xc0, 0x08, 0x7c, 0xc7, 0xc9, 0x53, 0x01, 0x32, 0x91, 0x44, 0xdf, 0x5c,
+    0xc0, 0x08, 0x88, 0x05, 0xc0, 0x08, 0xaa, 0x12, 0xc0, 0x08, 0xc8, 0xcb,
+    0x8e, 0xd5, 0x01, 0x0a, 0x69, 0x18, 0xc0, 0x08, 0xd6, 0x0f, 0xc0, 0x08,
+    0xe2, 0xcb, 0x8d, 0x6a, 0x00, 0x30, 0x59, 0x07, 0xc0, 0x08, 0xf8, 0xc5,
+    0xd5, 0xe9, 0x0f, 0xcf, 0x70, 0x11, 0xc0, 0x09, 0x04, 0x0e, 0xc0, 0x09,
+    0x44, 0x03, 0xc0, 0x09, 0x52, 0x0b, 0xc0, 0x09, 0x84, 0x07, 0xc0, 0x09,
+    0xb0, 0x17, 0xc0, 0x09, 0xd9, 0x14, 0xc0, 0x0a, 0x14, 0x1b, 0xc0, 0x0a,
+    0x24, 0x49, 0xb4, 0x86, 0x40, 0x0a, 0x30, 0x11, 0xc0, 0x0a, 0x5e, 0x07,
+    0xc0, 0x0a, 0x9c, 0x0b, 0xc0, 0x0a, 0xd1, 0x1b, 0xc0, 0x0b, 0x0a, 0x03,
+    0xc0, 0x0b, 0x1c, 0xcd, 0x7f, 0xbc, 0x01, 0x08, 0xa1, 0xc4, 0x0e, 0xf0,
+    0x0f, 0xcc, 0xc9, 0x17, 0x40, 0x0b, 0x49, 0x12, 0xc0, 0x0b, 0x55, 0x10,
+    0xc0, 0x0b, 0x71, 0xc7, 0x59, 0xfb, 0x01, 0x30, 0x13, 0x00, 0x0b, 0x8b,
+    0xc5, 0x1b, 0x31, 0x01, 0x32, 0x29, 0x48, 0xbc, 0x88, 0x40, 0x0b, 0x8f,
+    0x07, 0xc0, 0x0b, 0x9b, 0x11, 0xc0, 0x0b, 0xbf, 0x03, 0xc0, 0x0b, 0xed,
+    0x0b, 0xc0, 0x0c, 0x17, 0x1b, 0xc0, 0x0c, 0x41, 0xcb, 0x92, 0xc9, 0x01,
+    0x05, 0xa1, 0x17, 0x40, 0x0c, 0x51, 0x10, 0xc0, 0x0c, 0x67, 0x42, 0x00,
+    0x06, 0xc0, 0x0c, 0x93, 0x43, 0x07, 0xeb, 0xc0, 0x0c, 0x9f, 0x0f, 0xc0,
+    0x0c, 0xaf, 0xce, 0x6d, 0x06, 0x0f, 0x9f, 0x71, 0xd3, 0x43, 0x3b, 0x0f,
+    0xc8, 0xf8, 0x0a, 0xc0, 0x0c, 0xbf, 0x14, 0xc0, 0x0c, 0xdb, 0x03, 0xc0,
+    0x0c, 0xfa, 0x11, 0xc0, 0x0d, 0x29, 0x0e, 0xc0, 0x0d, 0x64, 0x0b, 0xc0,
+    0x0d, 0x76, 0x17, 0xc0, 0x0d, 0x8b, 0x07, 0xc0, 0x0d, 0xb1, 0x1b, 0xc0,
+    0x0d, 0xc9, 0x43, 0x2e, 0x2b, 0x40, 0x0d, 0xe1, 0x0b, 0xc0, 0x0d, 0xed,
+    0x11, 0xc0, 0x0e, 0x1d, 0x03, 0xc0, 0x0e, 0x5f, 0x07, 0xc0, 0x0e, 0x87,
+    0x17, 0xc0, 0x0e, 0xc3, 0xc9, 0xa8, 0x38, 0x0f, 0xcc, 0x78, 0x11, 0xc0,
+    0x0e, 0xeb, 0x0a, 0xc0, 0x0f, 0x05, 0x0b, 0xc0, 0x0f, 0x1a, 0x03, 0xc0,
+    0x0f, 0x36, 0x07, 0xc0, 0x0f, 0x58, 0x14, 0x40, 0x0f, 0x6c, 0x0e, 0xc0,
+    0x0f, 0x7c, 0x11, 0xc0, 0x0f, 0x95, 0x03, 0xc0, 0x0f, 0xbf, 0x14, 0xc0,
+    0x0f, 0xe5, 0x17, 0xc0, 0x0f, 0xf7, 0x07, 0xc0, 0x10, 0x0d, 0x0b, 0x40,
+    0x10, 0x21, 0x0b, 0xc0, 0x10, 0x45, 0x07, 0xc0, 0x10, 0x66, 0x11, 0xc0,
+    0x10, 0x98, 0x03, 0xc0, 0x10, 0xc7, 0x17, 0xc0, 0x11, 0x08, 0x43, 0x18,
+    0xa9, 0xc0, 0x11, 0x18, 0x47, 0xc1, 0xdc, 0x40, 0x11, 0x22, 0x0e, 0xc0,
+    0x11, 0x46, 0x14, 0xc0, 0x11, 0x4e, 0x0b, 0xc0, 0x11, 0x60, 0x03, 0xc0,
+    0x11, 0x89, 0x11, 0xc0, 0x11, 0xbd, 0x07, 0xc0, 0x11, 0xeb, 0x17, 0xc0,
+    0x12, 0x0d, 0x4f, 0x65, 0xed, 0xc0, 0x12, 0x29, 0x0a, 0x40, 0x12, 0x47,
+    0x10, 0xc0, 0x12, 0x55, 0x07, 0xc0, 0x12, 0x61, 0x03, 0xc0, 0x12, 0x6e,
+    0x0a, 0xc0, 0x12, 0x8a, 0x0b, 0xc0, 0x12, 0xa8, 0x11, 0xc0, 0x12, 0xc9,
+    0xc5, 0xd3, 0xcd, 0x01, 0x5f, 0x18, 0x0b, 0xc0, 0x12, 0xd5, 0x14, 0xc0,
+    0x13, 0x13, 0x11, 0xc0, 0x13, 0x2d, 0x07, 0xc0, 0x13, 0x79, 0x17, 0xc0,
+    0x13, 0xad, 0x03, 0xc0, 0x13, 0xbf, 0xc2, 0xe6, 0x4a, 0x0f, 0xa6, 0x01,
+    0xcf, 0x6b, 0x24, 0x0f, 0xcf, 0x60, 0x07, 0xc0, 0x13, 0xe4, 0x03, 0xc0,
+    0x14, 0x19, 0x11, 0xc0, 0x14, 0x48, 0x56, 0x2d, 0xfe, 0xc0, 0x14, 0x6d,
+    0x17, 0xc0, 0x14, 0x87, 0x45, 0x65, 0xdf, 0xc0, 0x14, 0x9d, 0x43, 0xc4,
+    0x6b, 0xc0, 0x14, 0xcc, 0x0b, 0x40, 0x14, 0xf2, 0x47, 0xc8, 0x1f, 0xc0,
+    0x14, 0xfe, 0xd3, 0x43, 0x28, 0x01, 0x19, 0x39, 0xc2, 0x00, 0x4b, 0x01,
+    0x15, 0xd9, 0xc4, 0xe3, 0x18, 0x0f, 0xd3, 0xd8, 0x0f, 0xc0, 0x15, 0x0a,
+    0x03, 0xc0, 0x15, 0x18, 0x09, 0xc0, 0x15, 0x2b, 0x1a, 0xc0, 0x15, 0x35,
+    0x48, 0xbf, 0x28, 0xc0, 0x15, 0x43, 0x0e, 0xc0, 0x15, 0x75, 0x44, 0x00,
+    0x65, 0xc0, 0x15, 0x89, 0x10, 0xc0, 0x15, 0x93, 0xcb, 0x90, 0xb9, 0x01,
+    0x1e, 0x79, 0x14, 0xc0, 0x15, 0xb2, 0x42, 0x00, 0xe5, 0xc0, 0x15, 0xc4,
+    0x15, 0xc0, 0x15, 0xce, 0x17, 0xc0, 0x15, 0xda, 0xcc, 0x8b, 0xf8, 0x0f,
+    0xa7, 0x39, 0xcd, 0x75, 0xfc, 0x0f, 0x99, 0x91, 0xc2, 0x0d, 0x1e, 0x0f,
+    0xa2, 0x0b, 0x00, 0x15, 0xe6, 0xd0, 0x5c, 0xc2, 0x01, 0x70, 0x70, 0x17,
+    0xc0, 0x15, 0xf0, 0x11, 0xc0, 0x16, 0x0c, 0x14, 0xc0, 0x16, 0x28, 0x07,
+    0xc0, 0x16, 0x38, 0x0b, 0xc0, 0x16, 0x5b, 0xc4, 0x6b, 0x89, 0x0f, 0xa3,
+    0xd9, 0x03, 0xc0, 0x16, 0x65, 0x0e, 0x40, 0x16, 0x71, 0xc5, 0xd8, 0xd2,
+    0x0f, 0xcd, 0x51, 0x14, 0xc0, 0x16, 0x7f, 0x42, 0x01, 0x94, 0xc0, 0x16,
+    0x9b, 0xc2, 0x0c, 0x28, 0x0f, 0xcc, 0x49, 0xc7, 0xc6, 0xe4, 0x0f, 0xb7,
+    0x11, 0x10, 0xc0, 0x16, 0xa7, 0x12, 0xc0, 0x16, 0xbd, 0x0e, 0xc0, 0x16,
+    0xd3, 0x17, 0xc0, 0x16, 0xe3, 0x05, 0xc0, 0x16, 0xed, 0x04, 0xc0, 0x16,
+    0xf7, 0xc7, 0xb5, 0x01, 0x01, 0x09, 0x31, 0x43, 0x00, 0x98, 0xc0, 0x17,
+    0x09, 0x09, 0xc0, 0x17, 0x13, 0xc8, 0xb1, 0x54, 0x0f, 0xaa, 0x49, 0xce,
+    0x70, 0xcc, 0x0f, 0x9f, 0x11, 0xc3, 0x02, 0x5d, 0x0f, 0x9b, 0x11, 0x9a,
+    0x0f, 0xa0, 0x11, 0x15, 0xc0, 0x17, 0x1f, 0xcb, 0x84, 0xe5, 0x0f, 0xa2,
+    0x60, 0xd0, 0x58, 0x62, 0x0f, 0xc8, 0x81, 0x48, 0xb8, 0xb8, 0xc0, 0x17,
+    0x2b, 0x50, 0x58, 0x32, 0xc0, 0x17, 0x3d, 0x4a, 0x16, 0x95, 0xc0, 0x17,
+    0x65, 0x07, 0xc0, 0x17, 0x85, 0xc5, 0xd3, 0xfa, 0x0f, 0xce, 0xf8, 0x03,
+    0xc0, 0x17, 0x97, 0x17, 0xc0, 0x17, 0xad, 0x11, 0xc0, 0x17, 0xbf, 0xc4,
+    0xe0, 0xd8, 0x0f, 0xa2, 0xb1, 0xd2, 0x49, 0x69, 0x0f, 0xcf, 0x48, 0xc6,
+    0xcd, 0x2e, 0x01, 0x35, 0xd9, 0x03, 0xc0, 0x17, 0xcb, 0x46, 0x30, 0xec,
+    0xc0, 0x17, 0xdd, 0xcc, 0x01, 0x5d, 0x00, 0x01, 0x10, 0x0b, 0xc0, 0x17,
+    0xe7, 0x07, 0xc0, 0x17, 0xf1, 0xcb, 0x96, 0x9c, 0x0f, 0xcb, 0x89, 0xc4,
+    0xe2, 0x60, 0x0f, 0xd4, 0x00, 0x51, 0x54, 0x87, 0xc0, 0x18, 0x03, 0x42,
+    0x02, 0x31, 0xc0, 0x18, 0x42, 0xc5, 0xdc, 0x51, 0x0f, 0xce, 0xd8, 0x14,
+    0xc0, 0x18, 0x60, 0xc3, 0x0d, 0xf4, 0x01, 0x35, 0xb1, 0x44, 0x02, 0x49,
+    0xc0, 0x18, 0x72, 0xd5, 0x37, 0x45, 0x01, 0x51, 0x78, 0x07, 0xc0, 0x18,
+    0x7e, 0xca, 0x86, 0xf6, 0x01, 0x38, 0x61, 0xc3, 0x14, 0x0f, 0x01, 0x32,
+    0x69, 0x43, 0x1a, 0x4d, 0xc0, 0x18, 0x8a, 0xcc, 0x86, 0x28, 0x0f, 0xa7,
+    0x99, 0xc4, 0x1e, 0xe6, 0x0f, 0x9d, 0xd9, 0x47, 0xc0, 0x3f, 0x40, 0x18,
+    0x94, 0x0e, 0xc0, 0x18, 0xa0, 0xd0, 0x57, 0x82, 0x0f, 0xdd, 0xd8, 0x4d,
+    0x76, 0x4a, 0xc0, 0x18, 0xb2, 0xc5, 0xd4, 0xc7, 0x01, 0x5f, 0x30, 0x09,
+    0xc0, 0x18, 0xcc, 0xc2, 0x0b, 0x0b, 0x0f, 0xb4, 0xa9, 0x49, 0x9a, 0xfd,
+    0xc0, 0x18, 0xdc, 0x10, 0xc0, 0x18, 0xe8, 0x0f, 0xc0, 0x18, 0xf2, 0x43,
+    0x28, 0x5f, 0xc0, 0x18, 0xfe, 0xc4, 0xde, 0x9d, 0x01, 0x32, 0x49, 0x0d,
+    0xc0, 0x19, 0x0a, 0x42, 0x02, 0x31, 0xc0, 0x19, 0x16, 0xda, 0x1b, 0xec,
+    0x0f, 0x9e, 0x99, 0xc2, 0x00, 0xaa, 0x0f, 0x99, 0x70, 0xc3, 0xe5, 0xd4,
+    0x0f, 0xcc, 0xb1, 0xc5, 0x46, 0xf5, 0x0f, 0xa2, 0xa8, 0x14, 0xc0, 0x19,
+    0x28, 0xc9, 0xb4, 0x7d, 0x01, 0x05, 0x71, 0xc3, 0x19, 0x2a, 0x0f, 0x99,
+    0xb9, 0xcb, 0x8e, 0x88, 0x0f, 0xca, 0x18, 0x43, 0x03, 0xe1, 0xc0, 0x19,
+    0x38, 0x0b, 0xc0, 0x19, 0x40, 0x11, 0xc0, 0x19, 0x4a, 0x17, 0xc0, 0x19,
+    0x56, 0x42, 0x00, 0x2c, 0xc0, 0x19, 0x62, 0x03, 0x40, 0x19, 0x6c, 0xc4,
+    0xdf, 0x18, 0x0f, 0xb5, 0xe9, 0x42, 0x05, 0x9e, 0xc0, 0x19, 0x78, 0x16,
+    0xc0, 0x19, 0xae, 0x57, 0x29, 0x14, 0xc0, 0x19, 0xba, 0xc4, 0x33, 0x7a,
+    0x0f, 0x9a, 0x29, 0xc9, 0xad, 0xf3, 0x0f, 0xaf, 0xe1, 0xc4, 0x58, 0xae,
+    0x0f, 0xa2, 0x29, 0x11, 0x40, 0x19, 0xc6, 0x03, 0xc0, 0x19, 0xd5, 0x0b,
+    0xc0, 0x19, 0xf2, 0x17, 0xc0, 0x1a, 0x10, 0x11, 0x40, 0x1a, 0x1d, 0x4c,
+    0x81, 0x18, 0xc0, 0x1a, 0x2a, 0x03, 0xc0, 0x1a, 0x8a, 0x0e, 0xc0, 0x1a,
+    0x9a, 0x10, 0xc0, 0x1a, 0xa4, 0xc7, 0xc8, 0xb9, 0x0f, 0xcf, 0x51, 0xc8,
+    0xba, 0xe8, 0x0f, 0xcf, 0xc0, 0x09, 0xc0, 0x1a, 0xb4, 0x42, 0x00, 0xf1,
+    0xc0, 0x1a, 0xc3, 0xc3, 0x15, 0xf7, 0x00, 0x03, 0xf3, 0x00, 0x1a, 0xcf,
+    0x14, 0xc0, 0x1a, 0xd3, 0xc2, 0x16, 0xc7, 0x01, 0x4f, 0xf3, 0x00, 0x1a,
+    0xe5, 0xc4, 0x00, 0x3d, 0x0f, 0x9d, 0x59, 0xcf, 0x62, 0xff, 0x01, 0x4e,
+    0xe9, 0x46, 0xd1, 0xf0, 0xc0, 0x1a, 0xeb, 0x47, 0xc1, 0x88, 0x40, 0x1b,
+    0x1a, 0xd7, 0x23, 0xc6, 0x01, 0x39, 0xc9, 0x11, 0xc0, 0x1b, 0x32, 0xd7,
+    0x27, 0xbb, 0x0f, 0xa8, 0x00, 0xc5, 0x60, 0x12, 0x01, 0x18, 0x9b, 0x00,
+    0x1b, 0x3c, 0xcb, 0x99, 0xbf, 0x0f, 0xd5, 0x09, 0x03, 0xc0, 0x1b, 0x42,
+    0x15, 0xc0, 0x1b, 0x4a, 0x42, 0x01, 0x33, 0xc0, 0x1b, 0x56, 0xc5, 0xbf,
+    0xca, 0x01, 0x35, 0xc9, 0x05, 0xc0, 0x1b, 0x66, 0x42, 0x00, 0x32, 0xc0,
+    0x1b, 0x70, 0x14, 0xc0, 0x1b, 0x7c, 0x07, 0xc0, 0x1b, 0x88, 0xc4, 0xdf,
+    0xf4, 0x0f, 0xc9, 0x99, 0xc3, 0x90, 0x93, 0x01, 0x5f, 0x91, 0xce, 0x6e,
+    0xaa, 0x01, 0x5f, 0xd8, 0x07, 0xc0, 0x1b, 0x94, 0x03, 0xc0, 0x1b, 0xa6,
+    0x14, 0xc0, 0x1b, 0xc6, 0x11, 0xc0, 0x1b, 0xd4, 0x17, 0xc0, 0x1b, 0xe0,
+    0xca, 0x9e, 0x6c, 0x0f, 0xde, 0x2a, 0x00, 0x1b, 0xf2, 0x0e, 0xc0, 0x1b,
+    0xf6, 0x42, 0x00, 0x35, 0xc0, 0x1c, 0x00, 0x10, 0xc0, 0x1c, 0x0c, 0xc6,
+    0xcd, 0xdc, 0x01, 0x37, 0xa9, 0xc9, 0xb1, 0x14, 0x01, 0x32, 0x81, 0x16,
+    0xc0, 0x1c, 0x18, 0x48, 0x6a, 0xcb, 0xc0, 0x1c, 0x27, 0xc7, 0xc5, 0x8d,
+    0x0f, 0x9d, 0xb9, 0xd1, 0x4f, 0x26, 0x0f, 0x9b, 0xb1, 0xc2, 0x00, 0x4c,
+    0x0f, 0xcb, 0xd9, 0x45, 0x72, 0xb7, 0x40, 0x1c, 0x43, 0x17, 0xc0, 0x1c,
+    0x4f, 0x0b, 0xc0, 0x1c, 0x5e, 0xc8, 0xbd, 0x88, 0x0f, 0xb7, 0xc8, 0x11,
+    0xc0, 0x1c, 0x6a, 0x07, 0xc0, 0x1c, 0x72, 0x0b, 0xc0, 0x1c, 0x82, 0x03,
+    0x40, 0x1c, 0x8e, 0x14, 0xc0, 0x1c, 0x9a, 0x03, 0xc0, 0x1c, 0xa6, 0x11,
+    0xc0, 0x1c, 0xc0, 0x0b, 0xc0, 0x1c, 0xe4, 0xcd, 0x7b, 0xfa, 0x01, 0x4f,
+    0x11, 0xc3, 0x2f, 0x75, 0x0f, 0xa0, 0x88, 0x11, 0xc0, 0x1c, 0xfa, 0x03,
+    0xc0, 0x1d, 0x06, 0x14, 0xc0, 0x1d, 0x12, 0xc4, 0xd5, 0x36, 0x0f, 0x9f,
+    0x5a, 0x00, 0x1d, 0x28, 0xcb, 0x92, 0x66, 0x0f, 0xc9, 0x39, 0x42, 0x00,
+    0x2a, 0xc0, 0x1d, 0x2e, 0x03, 0x40, 0x1d, 0x49, 0x17, 0xc0, 0x1d, 0x55,
+    0x43, 0x2a, 0x13, 0xc0, 0x1d, 0x61, 0xde, 0x0e, 0x70, 0x0f, 0xa8, 0xe1,
+    0x46, 0xcb, 0x24, 0xc0, 0x1d, 0x73, 0x05, 0xc0, 0x1d, 0xaa, 0x42, 0x00,
+    0x31, 0xc0, 0x1d, 0xb6, 0xc6, 0x52, 0xc7, 0x01, 0x06, 0x01, 0x4b, 0x95,
+    0x5d, 0xc0, 0x1d, 0xc6, 0x46, 0xc0, 0xef, 0x40, 0x1d, 0xd2, 0x03, 0xc0,
+    0x1d, 0xf0, 0xc2, 0x00, 0x9d, 0x0f, 0xcc, 0x88, 0x0f, 0xc0, 0x1d, 0xfc,
+    0x10, 0xc0, 0x1e, 0x08, 0x42, 0x00, 0x4c, 0xc0, 0x1e, 0x14, 0x4b, 0x91,
+    0x53, 0x40, 0x1e, 0x20, 0x07, 0xc0, 0x1e, 0x38, 0x03, 0xc0, 0x1e, 0x48,
+    0xcd, 0x7e, 0x84, 0x01, 0x11, 0x13, 0x00, 0x1e, 0x5a, 0x0b, 0xc0, 0x1e,
+    0x60, 0xd4, 0x3c, 0xf2, 0x0f, 0xa5, 0x31, 0x11, 0x40, 0x1e, 0x6f, 0x42,
+    0x00, 0x8f, 0xc0, 0x1e, 0x85, 0x1a, 0xc0, 0x1e, 0x91, 0x06, 0xc0, 0x1e,
+    0xa3, 0x10, 0xc0, 0x1e, 0xaf, 0xd1, 0x53, 0x55, 0x0f, 0xaf, 0xf1, 0x46,
+    0xc7, 0x39, 0x40, 0x1e, 0xc1, 0x43, 0x02, 0x0d, 0xc0, 0x1e, 0xd3, 0x90,
+    0x01, 0x30, 0x4b, 0x00, 0x1e, 0xe3, 0x48, 0xb8, 0xa8, 0xc0, 0x1f, 0x02,
+    0xc6, 0xbd, 0xd2, 0x01, 0x13, 0xdb, 0x00, 0x1f, 0x14, 0x42, 0x0e, 0x6c,
+    0xc0, 0x1f, 0x18, 0x42, 0x18, 0x3f, 0xc0, 0x1f, 0x2a, 0x15, 0x40, 0x1f,
+    0x36, 0x0b, 0xc0, 0x1f, 0x42, 0x03, 0xc0, 0x1f, 0x4c, 0xcc, 0x74, 0xbe,
+    0x0f, 0xb5, 0x60, 0xc8, 0xbf, 0x48, 0x01, 0x02, 0x99, 0xc5, 0xda, 0xd0,
+    0x0f, 0x9e, 0x51, 0x03, 0x40, 0x1f, 0x58, 0x43, 0x00, 0x85, 0xc0, 0x1f,
+    0x62, 0xc3, 0x8e, 0xd7, 0x01, 0x32, 0x41, 0x85, 0x01, 0x18, 0x91, 0x44,
+    0x01, 0x8d, 0xc0, 0x1f, 0x6e, 0x47, 0x31, 0x18, 0xc0, 0x1f, 0x78, 0x42,
+    0x00, 0x45, 0x40, 0x1f, 0xa8, 0xce, 0x6b, 0xd2, 0x0f, 0xd3, 0xc9, 0xc8,
+    0xbe, 0x60, 0x01, 0x31, 0x61, 0xd6, 0x2b, 0xd8, 0x01, 0x08, 0x09, 0x0f,
+    0xc0, 0x1f, 0xb4, 0xc3, 0x1d, 0xa4, 0x0f, 0xce, 0x89, 0x44, 0x0f, 0xc3,
+    0x40, 0x1f, 0xc0, 0x54, 0x39, 0xd2, 0xc0, 0x1f, 0xf2, 0x46, 0x0d, 0x4a,
+    0xc0, 0x20, 0x56, 0x07, 0xc0, 0x20, 0x62, 0xc9, 0xaf, 0x37, 0x01, 0x1f,
+    0x81, 0x42, 0x00, 0x53, 0xc0, 0x20, 0x74, 0x4b, 0x66, 0x0d, 0xc0, 0x20,
+    0x80, 0xcb, 0x90, 0xae, 0x0f, 0xa3, 0xf0, 0x42, 0x00, 0x5d, 0xc0, 0x20,
+    0x8f, 0xca, 0x9a, 0xe8, 0x01, 0x05, 0x99, 0xc7, 0xc5, 0x01, 0x0f, 0x9a,
+    0x30, 0x01, 0x40, 0x20, 0x99, 0x43, 0x12, 0x28, 0xc0, 0x20, 0xa5, 0x96,
+    0x0f, 0xa0, 0xe3, 0x00, 0x20, 0xb1, 0xca, 0xa6, 0x00, 0x01, 0x3e, 0x89,
+    0xc4, 0xcc, 0xd0, 0x01, 0x34, 0x99, 0xc2, 0x0b, 0x48, 0x01, 0x31, 0x29,
+    0x09, 0x40, 0x20, 0xbd, 0x16, 0xc0, 0x20, 0xde, 0x05, 0xc0, 0x20, 0xee,
+    0xc7, 0x5a, 0x15, 0x01, 0x15, 0x31, 0xd5, 0x2d, 0x0d, 0x01, 0x12, 0x18,
+    0xc9, 0xb1, 0x53, 0x01, 0x34, 0xd9, 0xcb, 0x92, 0x24, 0x0f, 0xa2, 0xf8,
+    0x47, 0x01, 0x92, 0xc0, 0x20, 0xfa, 0x15, 0xc0, 0x21, 0x41, 0x48, 0xa0,
+    0x7e, 0xc0, 0x21, 0x4d, 0x46, 0x04, 0x99, 0xc0, 0x21, 0x59, 0x4b, 0x6e,
+    0xbb, 0xc0, 0x21, 0x7d, 0x56, 0x2c, 0x5c, 0x40, 0x21, 0x9a, 0xc8, 0xb5,
+    0x48, 0x01, 0x1f, 0x31, 0x42, 0x00, 0xaa, 0xc0, 0x21, 0xa4, 0x47, 0xc2,
+    0x14, 0xc0, 0x21, 0xb0, 0x45, 0x34, 0xfb, 0xc0, 0x21, 0xbc, 0xc9, 0x4b,
+    0x22, 0x00, 0x00, 0x30, 0x54, 0x3e, 0x6e, 0xc0, 0x21, 0xc8, 0x12, 0xc0,
+    0x22, 0x24, 0x11, 0x40, 0x22, 0x30, 0x46, 0xca, 0xd6, 0xc0, 0x22, 0x3c,
+    0xc5, 0xdd, 0x28, 0x0f, 0xca, 0x88, 0xcf, 0x60, 0x3e, 0x0f, 0x9e, 0x41,
+    0x12, 0xc0, 0x22, 0x48, 0xd7, 0x27, 0x5f, 0x01, 0x51, 0xf9, 0xc7, 0xc2,
+    0xfb, 0x0f, 0xb4, 0x88, 0xcc, 0x8a, 0x84, 0x0f, 0xb5, 0x09, 0x45, 0xdc,
+    0x83, 0x40, 0x22, 0x54, 0x1a, 0xc0, 0x22, 0x76, 0x43, 0x1e, 0x6c, 0xc0,
+    0x22, 0x82, 0x42, 0x01, 0x94, 0xc0, 0x22, 0x9e, 0x19, 0xc0, 0x22, 0xaa,
+    0x11, 0xc0, 0x22, 0xbd, 0xc2, 0x03, 0xb2, 0x0f, 0xa5, 0x19, 0xc5, 0xd8,
+    0xb9, 0x0f, 0xa4, 0x83, 0x00, 0x22, 0xca, 0xc2, 0x00, 0x72, 0x0f, 0xa0,
+    0xb9, 0x9b, 0x0f, 0xa3, 0x33, 0x00, 0x22, 0xd0, 0xc2, 0x00, 0xe1, 0x0f,
+    0xcd, 0xa1, 0x47, 0xc3, 0xa3, 0x40, 0x22, 0xd6, 0x11, 0xc0, 0x22, 0xe2,
+    0x03, 0xc0, 0x22, 0xf4, 0x42, 0x0e, 0x21, 0x40, 0x23, 0x00, 0x10, 0xc0,
+    0x23, 0x0a, 0x0e, 0xc0, 0x23, 0x1d, 0x15, 0xc0, 0x23, 0x27, 0x06, 0xc0,
+    0x23, 0x3c, 0xc2, 0x06, 0xba, 0x0f, 0xa3, 0xb3, 0x00, 0x23, 0x48, 0x44,
+    0x82, 0xbc, 0xc0, 0x23, 0x4c, 0x05, 0xc0, 0x23, 0x70, 0x96, 0x0f, 0xcc,
+    0x3b, 0x00, 0x23, 0x80, 0x14, 0xc0, 0x23, 0x93, 0x09, 0x40, 0x23, 0x9d,
+    0xc3, 0x17, 0x4f, 0x0f, 0xcd, 0x61, 0xcc, 0x84, 0xb4, 0x01, 0x31, 0x19,
+    0x16, 0xc0, 0x23, 0xaf, 0x42, 0x00, 0xb8, 0xc0, 0x23, 0xbb, 0x14, 0xc0,
+    0x23, 0xc7, 0x42, 0x00, 0xb3, 0xc0, 0x23, 0xd1, 0xc4, 0xe0, 0x44, 0x0f,
+    0xa2, 0xc9, 0x44, 0x1e, 0xda, 0x40, 0x23, 0xdd, 0x03, 0xc0, 0x23, 0xe7,
+    0x10, 0xc0, 0x24, 0x09, 0xc2, 0x00, 0xb8, 0x0f, 0xa8, 0xa3, 0x00, 0x24,
+    0x1c, 0x16, 0xc0, 0x24, 0x26, 0xc5, 0xd4, 0xb8, 0x01, 0x11, 0xa9, 0x07,
+    0xc0, 0x24, 0x32, 0x86, 0x0f, 0xb6, 0x79, 0xca, 0xa5, 0x9c, 0x0f, 0xce,
+    0x18, 0xc4, 0x01, 0x94, 0x0f, 0xce, 0x43, 0x00, 0x24, 0x3e, 0x95, 0x0f,
+    0xb4, 0x63, 0x00, 0x24, 0x44, 0x42, 0x00, 0xb8, 0xc0, 0x24, 0x4e, 0x89,
+    0x0f, 0xa0, 0xdb, 0x00, 0x24, 0x66, 0x44, 0xe1, 0x08, 0xc0, 0x24, 0x6c,
+    0xd3, 0x45, 0x3c, 0x0f, 0x9e, 0xb9, 0x44, 0x74, 0x55, 0xc0, 0x24, 0x78,
+    0xc4, 0x00, 0x3d, 0x0f, 0xd5, 0x19, 0xc5, 0xdd, 0x50, 0x0f, 0x99, 0x78,
+    0x0b, 0xc0, 0x24, 0x82, 0x03, 0xc0, 0x24, 0x92, 0x11, 0xc0, 0x24, 0x9c,
+    0x07, 0x40, 0x24, 0xb4, 0x57, 0x26, 0xbe, 0xc0, 0x24, 0xbe, 0xcd, 0x7d,
+    0x4c, 0x07, 0xf7, 0xf8, 0xd2, 0x4a, 0x0b, 0x08, 0xe3, 0x61, 0x47, 0x37,
+    0xb8, 0xc0, 0x25, 0x12, 0x06, 0xc0, 0x25, 0x36, 0x4b, 0x90, 0x2a, 0xc0,
+    0x25, 0x48, 0xce, 0x74, 0x3e, 0x08, 0xe2, 0x19, 0x45, 0x00, 0x8d, 0xc0,
+    0x25, 0x50, 0x4b, 0x6e, 0xbb, 0xc0, 0x25, 0x60, 0x47, 0x01, 0x92, 0x40,
+    0x25, 0x80, 0x19, 0xc0, 0x25, 0xe7, 0x43, 0x00, 0xb2, 0xc0, 0x25, 0xf1,
+    0xc5, 0x0a, 0x44, 0x01, 0x2e, 0x53, 0x00, 0x26, 0x01, 0x46, 0x1a, 0x0b,
+    0xc0, 0x26, 0x07, 0xc2, 0x00, 0x3d, 0x0f, 0xa8, 0x93, 0x00, 0x26, 0x19,
+    0x43, 0x00, 0xd5, 0xc0, 0x26, 0x25, 0xc6, 0xcf, 0x38, 0x0f, 0x9b, 0x69,
+    0xd0, 0x5e, 0xd2, 0x0f, 0xb1, 0x69, 0xc5, 0xd4, 0xe0, 0x0f, 0xcc, 0xf1,
+    0x16, 0x40, 0x26, 0x31, 0x42, 0x00, 0x31, 0xc0, 0x26, 0x3d, 0x42, 0x0f,
+    0xbb, 0xc0, 0x26, 0x4b, 0x91, 0x01, 0x32, 0x63, 0x00, 0x26, 0x57, 0x48,
+    0x00, 0xca, 0xc0, 0x26, 0x5d, 0x45, 0xd4, 0x1d, 0xc0, 0x26, 0x86, 0xc4,
+    0xe0, 0xb0, 0x0f, 0xa6, 0x91, 0xca, 0xa5, 0x60, 0x0f, 0x9c, 0xd1, 0xc3,
+    0x13, 0x6f, 0x0f, 0x9a, 0x59, 0x89, 0x0f, 0xcd, 0xa8, 0xc7, 0xc5, 0xf6,
+    0x0f, 0xcc, 0x09, 0x09, 0xc0, 0x26, 0xa8, 0x43, 0x23, 0xeb, 0xc0, 0x26,
+    0xb4, 0xc3, 0x00, 0x3a, 0x01, 0x32, 0x71, 0xd1, 0x50, 0xad, 0x01, 0x05,
+    0xb1, 0xc7, 0x7a, 0xd5, 0x01, 0x05, 0x21, 0x10, 0xc0, 0x26, 0xc0, 0x0f,
+    0xc0, 0x26, 0xc8, 0xc2, 0x11, 0x18, 0x0f, 0xaf, 0x13, 0x00, 0x26, 0xd4,
+    0xc4, 0x84, 0xb7, 0x0f, 0xcc, 0x70, 0xc8, 0x21, 0x55, 0x0f, 0xc9, 0x29,
+    0x45, 0x5e, 0x93, 0xc0, 0x26, 0xda, 0x4c, 0x8b, 0xa4, 0x40, 0x26, 0xe6,
+    0x14, 0xc0, 0x27, 0x4f, 0x44, 0x09, 0x35, 0xc0, 0x27, 0x5b, 0xca, 0xa1,
+    0xa0, 0x70, 0x00, 0x09, 0xcf, 0x69, 0x80, 0x01, 0x31, 0xf3, 0x00, 0x27,
+    0x6f, 0x04, 0xc0, 0x27, 0x73, 0x06, 0xc0, 0x27, 0x7f, 0xd5, 0x35, 0xcb,
+    0x0f, 0xca, 0x69, 0x42, 0x00, 0x5e, 0x40, 0x27, 0x8b, 0xc5, 0xd1, 0x31,
+    0x0f, 0xcf, 0x99, 0xc3, 0x0c, 0x4a, 0x0f, 0xd6, 0x08, 0x44, 0x06, 0x52,
+    0xc0, 0x27, 0xc5, 0x46, 0x00, 0x71, 0xc0, 0x27, 0xf9, 0x4a, 0x01, 0x4b,
+    0xc0, 0x28, 0x37, 0xce, 0x6e, 0x10, 0x0f, 0xb2, 0x19, 0x01, 0x40, 0x28,
+    0x55, 0x0b, 0xc0, 0x28, 0x7c, 0xda, 0x1a, 0xce, 0x01, 0x35, 0x79, 0x06,
+    0xc0, 0x28, 0x95, 0xcb, 0x99, 0xd5, 0x0f, 0xb0, 0x91, 0xce, 0x72, 0x0e,
+    0x01, 0x5e, 0x88, 0x01, 0x40, 0x28, 0xa1, 0x47, 0x01, 0x92, 0xc0, 0x28,
+    0xad, 0xcc, 0x1e, 0x78, 0x08, 0x1c, 0xf8, 0x03, 0xc0, 0x29, 0x10, 0x0e,
+    0xc0, 0x29, 0x1e, 0x50, 0x5f, 0x52, 0xc0, 0x29, 0x2e, 0x14, 0xc0, 0x29,
+    0x70, 0x45, 0xd4, 0xea, 0xc0, 0x29, 0x7a, 0xc6, 0xd0, 0xdc, 0x0f, 0xcc,
+    0xa1, 0x4b, 0x90, 0x77, 0x40, 0x29, 0x94, 0x14, 0xc0, 0x29, 0xec, 0x16,
+    0xc0, 0x29, 0xfb, 0x17, 0xc0, 0x2a, 0x05, 0xc8, 0x6f, 0x52, 0x01, 0x11,
+    0xd9, 0x0e, 0xc0, 0x2a, 0x17, 0xc3, 0x6a, 0x12, 0x0f, 0xa9, 0x51, 0xc6,
+    0xcd, 0xa0, 0x0f, 0x9f, 0x29, 0x43, 0xae, 0xcc, 0xc0, 0x2a, 0x24, 0xc2,
+    0x00, 0x58, 0x0f, 0xd4, 0xe8, 0x0f, 0xc0, 0x2a, 0x30, 0x10, 0xc0, 0x2a,
+    0x43, 0x42, 0x00, 0x7d, 0xc0, 0x2a, 0x57, 0xc7, 0xc2, 0x30, 0x0f, 0xad,
+    0xa1, 0x16, 0xc0, 0x2a, 0x63, 0xdb, 0x17, 0x48, 0x0f, 0xb2, 0x59, 0x48,
+    0xb9, 0xb8, 0xc0, 0x2a, 0x6f, 0xc3, 0x04, 0x47, 0x01, 0x5f, 0x08, 0x42,
+    0x00, 0x09, 0xc0, 0x2a, 0xab, 0x47, 0x0d, 0xbf, 0xc0, 0x2a, 0xb3, 0xcb,
+    0x8d, 0x1d, 0x01, 0x37, 0x61, 0xc6, 0xd1, 0xc0, 0x0f, 0x99, 0xd1, 0xca,
+    0xa1, 0x64, 0x0f, 0xb6, 0xa9, 0xc9, 0xae, 0x44, 0x0f, 0xcb, 0xf1, 0xca,
+    0x9e, 0x26, 0x0f, 0xcc, 0xd8, 0xcf, 0x62, 0x00, 0x01, 0x1c, 0x71, 0x12,
+    0xc0, 0x2a, 0xcb, 0xc4, 0xe1, 0x6c, 0x01, 0x5e, 0xd0, 0xd3, 0x45, 0xfa,
+    0x0f, 0xa5, 0x79, 0xc9, 0x86, 0xc7, 0x0f, 0xb1, 0x79, 0x96, 0x0f, 0xb6,
+    0xb1, 0xca, 0x9b, 0xa6, 0x0f, 0xc8, 0xb8, 0x18, 0xc0, 0x2a, 0xda, 0x4f,
+    0x64, 0x76, 0xc0, 0x2a, 0xe6, 0x42, 0x00, 0xbe, 0xc0, 0x2a, 0xf8, 0x15,
+    0xc0, 0x2b, 0x05, 0x08, 0xc0, 0x2b, 0x11, 0x05, 0xc0, 0x2b, 0x20, 0x06,
+    0xc0, 0x2b, 0x2c, 0x46, 0xce, 0x8a, 0xc0, 0x2b, 0x39, 0xc8, 0xbb, 0xb0,
+    0x0f, 0xa7, 0x28, 0x43, 0x01, 0x4f, 0xc0, 0x2b, 0x45, 0x49, 0x1a, 0x4f,
+    0x40, 0x2b, 0x51, 0xc5, 0xda, 0x9e, 0x01, 0x37, 0xc1, 0x05, 0xc0, 0x2b,
+    0x9b, 0xd5, 0x32, 0x05, 0x0f, 0x9e, 0x90, 0xc6, 0x3d, 0x80, 0x01, 0x15,
+    0xbb, 0x00, 0x2b, 0xa7, 0x92, 0x0f, 0xa3, 0xfa, 0x00, 0x2b, 0xad, 0x07,
+    0xc0, 0x2b, 0xb3, 0x03, 0xc0, 0x2b, 0xcd, 0xc4, 0xcc, 0xbe, 0x01, 0x37,
+    0x51, 0x0b, 0xc0, 0x2b, 0xe1, 0x11, 0xc0, 0x2c, 0x02, 0xcc, 0x81, 0x48,
+    0x0f, 0x9c, 0x20, 0x17, 0xc0, 0x2c, 0x14, 0xc2, 0x00, 0x03, 0x0f, 0xcc,
+    0x01, 0x1b, 0xc0, 0x2c, 0x20, 0x11, 0xc0, 0x2c, 0x2c, 0x07, 0xc0, 0x2c,
+    0x44, 0xc5, 0x73, 0xac, 0x0f, 0xcc, 0xba, 0x00, 0x2c, 0x50, 0x10, 0xc0,
+    0x2c, 0x56, 0xc4, 0xcd, 0x64, 0x01, 0x37, 0x59, 0x14, 0xc0, 0x2c, 0x72,
+    0x12, 0xc0, 0x2c, 0x94, 0x06, 0xc0, 0x2c, 0xa0, 0x17, 0xc0, 0x2c, 0xac,
+    0x0f, 0xc0, 0x2c, 0xb8, 0x0e, 0xc0, 0x2c, 0xc7, 0xc4, 0xc1, 0xae, 0x0f,
+    0x99, 0xa9, 0x96, 0x0f, 0xa0, 0x42, 0x00, 0x2c, 0xd3, 0x05, 0xc0, 0x2c,
+    0xdc, 0x0f, 0xc0, 0x2c, 0xe6, 0x17, 0xc0, 0x2c, 0xfa, 0xc4, 0xe1, 0x3c,
+    0x01, 0x35, 0x81, 0x10, 0xc0, 0x2d, 0x0c, 0x14, 0xc0, 0x2d, 0x32, 0x0e,
+    0xc0, 0x2d, 0x44, 0x42, 0x00, 0x58, 0xc0, 0x2d, 0x53, 0x12, 0xc0, 0x2d,
+    0x5d, 0x99, 0x0f, 0xa0, 0x23, 0x00, 0x2d, 0x67, 0xc2, 0x01, 0x17, 0x0f,
+    0xcf, 0x29, 0xc2, 0x00, 0xaf, 0x0f, 0xd4, 0xc8, 0x0b, 0xc0, 0x2d, 0x6d,
+    0x11, 0xc0, 0x2d, 0x79, 0xd1, 0x53, 0xdd, 0x01, 0x1c, 0xd1, 0x03, 0x40,
+    0x2d, 0x94, 0x42, 0x00, 0x7e, 0xc0, 0x2d, 0xa6, 0xc4, 0xa9, 0x44, 0x0f,
+    0x9d, 0x31, 0xc7, 0xc4, 0x2f, 0x0f, 0x9e, 0xca, 0x00, 0x2d, 0xb0, 0x42,
+    0x00, 0x15, 0xc0, 0x2d, 0xb6, 0x48, 0xbb, 0x50, 0xc0, 0x2d, 0xc2, 0x14,
+    0xc0, 0x2d, 0xd4, 0x12, 0xc0, 0x2d, 0xe2, 0xc7, 0xac, 0x4e, 0x01, 0x10,
+    0xd9, 0xc6, 0xcd, 0xd6, 0x0f, 0xca, 0x91, 0xc9, 0xab, 0x50, 0x0f, 0xcb,
+    0x48, 0xca, 0xa4, 0xc0, 0x0f, 0xaa, 0x41, 0xc3, 0x0a, 0x67, 0x01, 0x35,
+    0x99, 0x42, 0x00, 0x50, 0xc0, 0x2d, 0xf2, 0x42, 0x01, 0xa9, 0x40, 0x2d,
+    0xfe, 0x42, 0x04, 0x82, 0xc0, 0x2e, 0x0a, 0xca, 0xa3, 0xf8, 0x01, 0x19,
+    0x69, 0x47, 0xba, 0x71, 0xc0, 0x2e, 0x16, 0xc5, 0xd5, 0x12, 0x0f, 0x98,
+    0x00, 0x48, 0x8e, 0x49, 0xc0, 0x2e, 0x3a, 0x47, 0x01, 0x1d, 0x40, 0x2e,
+    0x88, 0x43, 0x00, 0x66, 0xc0, 0x2e, 0xc2, 0xc2, 0x00, 0xb2, 0x0f, 0xa4,
+    0x6b, 0x00, 0x2e, 0xd6, 0xc4, 0x79, 0x93, 0x0f, 0x9c, 0x03, 0x00, 0x2e,
+    0xe6, 0x43, 0x07, 0xeb, 0xc0, 0x2e, 0xec, 0x57, 0x28, 0xe6, 0xc0, 0x2e,
+    0xf8, 0xc7, 0x41, 0xf1, 0x07, 0xef, 0xe1, 0xc3, 0x06, 0x2b, 0x0f, 0xca,
+    0x30, 0xc2, 0x00, 0x3d, 0x0f, 0xd5, 0x43, 0x00, 0x2f, 0x04, 0x42, 0x00,
+    0xb8, 0xc0, 0x2f, 0x0a, 0xc8, 0xbb, 0x90, 0x0f, 0xc8, 0xb1, 0x43, 0x0c,
+    0xe8, 0xc0, 0x2f, 0x1a, 0x46, 0x19, 0xb1, 0xc0, 0x2f, 0x24, 0x44, 0x12,
+    0xf2, 0xc0, 0x2f, 0x42, 0xd2, 0x47, 0x71, 0x0f, 0x9b, 0x01, 0xc2, 0x00,
+    0x42, 0x0f, 0x99, 0xcb, 0x00, 0x2f, 0x68, 0xc5, 0xc6, 0x50, 0x0f, 0xa0,
+    0x99, 0xc5, 0xd5, 0x67, 0x0f, 0xb5, 0x18, 0xc3, 0xe4, 0xb4, 0x0f, 0xd4,
+    0x91, 0x0b, 0xc0, 0x2f, 0x6e, 0x42, 0x01, 0xa9, 0xc0, 0x2f, 0x81, 0x96,
+    0x0f, 0xa0, 0x03, 0x00, 0x2f, 0x8e, 0x8f, 0x0f, 0xa0, 0x79, 0x05, 0xc0,
+    0x2f, 0x94, 0xc4, 0xe1, 0x5c, 0x0f, 0xa0, 0x3a, 0x00, 0x2f, 0xa0, 0x18,
+    0xc0, 0x2f, 0xa6, 0x15, 0xc0, 0x2f, 0xb2, 0x05, 0xc0, 0x2f, 0xbe, 0x45,
+    0xd5, 0x03, 0xc0, 0x2f, 0xd6, 0xcc, 0x8a, 0x48, 0x01, 0x01, 0xd9, 0xcd,
+    0x79, 0x8a, 0x0f, 0x9c, 0xb9, 0x42, 0x00, 0x6d, 0xc0, 0x2f, 0xe8, 0x42,
+    0x03, 0x8d, 0xc0, 0x2f, 0xf4, 0x45, 0xda, 0x67, 0xc0, 0x30, 0x00, 0xcb,
+    0x53, 0x17, 0x0f, 0xb0, 0x61, 0xd3, 0x19, 0x4f, 0x07, 0xff, 0xe8, 0xc8,
+    0xbc, 0x18, 0x01, 0x05, 0xe9, 0xc8, 0x7c, 0xb5, 0x01, 0x05, 0x41, 0x43,
+    0x57, 0xf0, 0xc0, 0x30, 0x16, 0x10, 0xc0, 0x30, 0x28, 0xcc, 0x87, 0x6c,
+    0x0f, 0x9e, 0x49, 0xca, 0xa5, 0x10, 0x01, 0x4f, 0xa1, 0x5a, 0x19, 0xfe,
+    0x40, 0x30, 0x32, 0x14, 0xc0, 0x30, 0x56, 0xc6, 0x0a, 0x0c, 0x01, 0x05,
+    0x49, 0xc7, 0xc2, 0x45, 0x0f, 0xa1, 0xd1, 0x0f, 0xc0, 0x30, 0x6c, 0xc2,
+    0x04, 0x84, 0x0f, 0xd5, 0xa8, 0x43, 0x00, 0xbd, 0xc0, 0x30, 0x7b, 0xc3,
+    0x0e, 0xa4, 0x0f, 0xb6, 0xf3, 0x00, 0x30, 0x85, 0xc3, 0x02, 0x17, 0x0f,
+    0xa0, 0x58, 0x4a, 0x15, 0x99, 0xc0, 0x30, 0x91, 0xcc, 0x80, 0x70, 0x0f,
+    0xad, 0x71, 0x10, 0xc0, 0x30, 0xb5, 0xcb, 0x90, 0x40, 0x0f, 0xca, 0x01,
+    0xd2, 0x4d, 0xc5, 0x01, 0x71, 0xf0, 0x16, 0xc0, 0x30, 0xc5, 0x10, 0xc0,
+    0x30, 0xd1, 0x14, 0xc0, 0x30, 0xdd, 0x18, 0xc0, 0x30, 0xe9, 0xc9, 0xad,
+    0x5a, 0x0f, 0xae, 0x89, 0x45, 0xdc, 0xd3, 0xc0, 0x30, 0xfb, 0xc4, 0x7b,
+    0xfb, 0x0f, 0xce, 0x38, 0x06, 0xc0, 0x31, 0x07, 0xcf, 0x6a, 0x25, 0x01,
+    0x33, 0x81, 0x0b, 0xc0, 0x31, 0x13, 0x44, 0x13, 0x2d, 0x40, 0x31, 0x1f,
+    0xca, 0x8e, 0xaa, 0x01, 0x38, 0x69, 0x07, 0xc0, 0x31, 0x2b, 0xcd, 0x7c,
+    0x6f, 0x0f, 0x9c, 0x08, 0x9b, 0x0f, 0xd5, 0x83, 0x00, 0x31, 0x3d, 0x03,
+    0xc0, 0x31, 0x43, 0x11, 0xc0, 0x31, 0x53, 0x07, 0xc0, 0x31, 0x68, 0xca,
+    0xa2, 0x7c, 0x0f, 0xb1, 0x98, 0xc6, 0xce, 0x12, 0x0f, 0xcc, 0x51, 0x17,
+    0xc0, 0x31, 0x74, 0x14, 0xc0, 0x31, 0x7e, 0xc4, 0x15, 0xf7, 0x0f, 0xae,
+    0x01, 0x89, 0x0f, 0x99, 0x5b, 0x00, 0x31, 0x9a, 0xc2, 0x01, 0x5d, 0x0f,
+    0xcd, 0xb3, 0x00, 0x31, 0xa0, 0xc4, 0xe3, 0xf8, 0x0f, 0xd6, 0xa8, 0x05,
+    0xc0, 0x31, 0xa6, 0x42, 0x06, 0x2e, 0xc0, 0x31, 0xb8, 0x0e, 0xc0, 0x31,
+    0xc4, 0xca, 0xa0, 0x88, 0x01, 0x31, 0x59, 0xce, 0x71, 0x2e, 0x0f, 0x9c,
+    0x29, 0xc3, 0xcf, 0x0f, 0x0f, 0xce, 0xd1, 0xc4, 0xcd, 0xb4, 0x0f, 0xa3,
+    0x50, 0x07, 0xc0, 0x31, 0xce, 0x11, 0xc0, 0x31, 0xda, 0x03, 0xc0, 0x31,
+    0xef, 0xca, 0x9b, 0x2e, 0x0f, 0x9b, 0x20, 0x42, 0x00, 0xb8, 0xc0, 0x31,
+    0xfb, 0xc7, 0xc2, 0xa0, 0x01, 0x37, 0xe9, 0x10, 0xc0, 0x32, 0x05, 0xc2,
+    0x00, 0x42, 0x01, 0x1e, 0xd8, 0x42, 0x00, 0x84, 0xc0, 0x32, 0x11, 0x0f,
+    0xc0, 0x32, 0x1b, 0x03, 0xc0, 0x32, 0x27, 0xc4, 0x87, 0x81, 0x0f, 0xc9,
+    0xd0, 0x14, 0xc0, 0x32, 0x33, 0x15, 0xc0, 0x32, 0x40, 0x47, 0xc1, 0xc7,
+    0xc0, 0x32, 0x4d, 0x45, 0xdc, 0xdd, 0xc0, 0x32, 0x59, 0x0e, 0xc0, 0x32,
+    0x65, 0xd2, 0x4e, 0x67, 0x01, 0x50, 0x69, 0xd9, 0x20, 0xdc, 0x0f, 0x9e,
+    0x88, 0xc4, 0xde, 0x80, 0x0f, 0xd4, 0xf3, 0x00, 0x32, 0x71, 0x0e, 0xc0,
+    0x32, 0x77, 0x43, 0x6f, 0x29, 0xc0, 0x32, 0x89, 0x42, 0x02, 0x11, 0xc0,
+    0x32, 0xa1, 0x06, 0xc0, 0x32, 0xa9, 0x10, 0x40, 0x32, 0xb5, 0x49, 0xb3,
+    0x6f, 0xc0, 0x32, 0xc3, 0x06, 0xc0, 0x32, 0xcf, 0x42, 0x00, 0x56, 0xc0,
+    0x32, 0xd9, 0x10, 0xc0, 0x32, 0xe3, 0x14, 0xc0, 0x32, 0xf5, 0x03, 0xc0,
+    0x33, 0x07, 0xc2, 0x08, 0x04, 0x0f, 0xa6, 0xe9, 0x4b, 0x8d, 0x33, 0xc0,
+    0x33, 0x13, 0x0e, 0xc0, 0x33, 0x37, 0xcd, 0x78, 0xe1, 0x00, 0x04, 0xa8,
+    0x16, 0xc0, 0x33, 0x43, 0x17, 0xc0, 0x33, 0x4f, 0x10, 0xc0, 0x33, 0x64,
+    0x06, 0xc0, 0x33, 0x7d, 0x43, 0x09, 0x2b, 0xc0, 0x33, 0x8b, 0xca, 0x47,
+    0x0d, 0x0f, 0xa7, 0x8b, 0x00, 0x33, 0x95, 0xca, 0xa4, 0x48, 0x0f, 0x9d,
+    0x29, 0x11, 0xc0, 0x33, 0x99, 0xc3, 0x90, 0xac, 0x0f, 0xaf, 0xf8, 0x16,
+    0xc0, 0x33, 0xa5, 0x4c, 0x83, 0xb8, 0xc0, 0x33, 0xb1, 0x46, 0xd1, 0xf6,
+    0xc0, 0x33, 0xd6, 0x15, 0xc0, 0x33, 0xf4, 0x14, 0xc0, 0x34, 0x0c, 0x0e,
+    0xc0, 0x34, 0x1e, 0x12, 0xc0, 0x34, 0x30, 0x90, 0x0f, 0xa3, 0x43, 0x00,
+    0x34, 0x3c, 0x0a, 0xc0, 0x34, 0x6a, 0xc6, 0xd2, 0xa4, 0x0f, 0xae, 0xb1,
+    0xc4, 0x69, 0x7c, 0x00, 0x05, 0x79, 0xc5, 0xdb, 0x75, 0x0f, 0xcd, 0x19,
+    0x09, 0x40, 0x34, 0x76, 0x15, 0xc0, 0x34, 0x86, 0x42, 0x03, 0x30, 0xc0,
+    0x34, 0x92, 0x43, 0x1a, 0x79, 0x40, 0x34, 0x9c, 0x06, 0xc0, 0x34, 0xa8,
+    0x47, 0x01, 0x92, 0x40, 0x34, 0xba, 0x15, 0xc0, 0x35, 0x1a, 0x0e, 0xc0,
+    0x35, 0x2c, 0x50, 0x0f, 0x60, 0xc0, 0x35, 0x38, 0x16, 0xc0, 0x35, 0x44,
+    0x4b, 0x6e, 0xbb, 0xc0, 0x35, 0x50, 0x4f, 0x2c, 0x5c, 0xc0, 0x35, 0x91,
+    0x46, 0x04, 0x99, 0x40, 0x35, 0x9b, 0x03, 0xc0, 0x35, 0xbf, 0x17, 0x40,
+    0x35, 0xd0, 0x11, 0xc0, 0x35, 0xe3, 0x0b, 0xc0, 0x35, 0xff, 0x07, 0xc0,
+    0x36, 0x0f, 0xca, 0x9d, 0x5e, 0x0f, 0xa7, 0xf8, 0x10, 0xc0, 0x36, 0x2e,
+    0xc2, 0x00, 0x3d, 0x01, 0x36, 0x7b, 0x00, 0x36, 0x44, 0x15, 0xc0, 0x36,
+    0x4a, 0xc7, 0xc5, 0x6a, 0x01, 0x16, 0xa3, 0x00, 0x36, 0x56, 0x0e, 0xc0,
+    0x36, 0x5c, 0x89, 0x0f, 0xa0, 0xb3, 0x00, 0x36, 0x6c, 0x87, 0x0f, 0xcb,
+    0x38, 0x42, 0x00, 0xca, 0xc0, 0x36, 0x70, 0x09, 0xc0, 0x36, 0x80, 0x4a,
+    0x9b, 0xce, 0xc0, 0x36, 0x8d, 0x0e, 0xc0, 0x36, 0xb2, 0x14, 0xc0, 0x36,
+    0xbc, 0x4b, 0x8f, 0x01, 0xc0, 0x36, 0xd0, 0xc5, 0xd5, 0x1c, 0x0f, 0xa7,
+    0x31, 0xc7, 0x7d, 0x03, 0x0f, 0xa6, 0x71, 0x10, 0xc0, 0x36, 0xf2, 0xc8,
+    0xbb, 0x40, 0x0f, 0xa1, 0xf0, 0x16, 0xc0, 0x36, 0xfe, 0x17, 0xc0, 0x37,
+    0x0e, 0x44, 0x00, 0x2b, 0xc0, 0x37, 0x2c, 0x15, 0xc0, 0x37, 0x36, 0x12,
+    0xc0, 0x37, 0x46, 0xcf, 0x64, 0xee, 0x0f, 0xad, 0x49, 0xcd, 0x7d, 0x3f,
+    0x0f, 0xa7, 0xf1, 0x45, 0x9b, 0x76, 0xc0, 0x37, 0x52, 0xc4, 0xe1, 0xf4,
+    0x0f, 0xa1, 0x48, 0x14, 0xc0, 0x37, 0x61, 0x10, 0xc0, 0x37, 0x84, 0x03,
+    0xc0, 0x37, 0xa2, 0x15, 0xc0, 0x37, 0xb0, 0xc8, 0xa5, 0xf7, 0x0f, 0xb5,
+    0xb1, 0xc8, 0xb6, 0x70, 0x0f, 0xcf, 0x59, 0xcc, 0x88, 0x20, 0x0f, 0xd6,
+    0x10, 0x44, 0x05, 0x20, 0xc0, 0x37, 0xbc, 0xd8, 0x24, 0xfd, 0x0f, 0xa7,
+    0x11, 0xc5, 0xc7, 0x56, 0x0f, 0xa6, 0x61, 0x14, 0xc0, 0x37, 0xc8, 0xdc,
+    0x12, 0x3b, 0x0f, 0xb5, 0x70, 0x47, 0x37, 0xb8, 0xc0, 0x37, 0xd4, 0x4f,
+    0x64, 0x67, 0xc0, 0x37, 0xe7, 0xd3, 0x46, 0xcb, 0x08, 0x5c, 0xd1, 0xcc,
+    0x46, 0xd2, 0x08, 0x5c, 0xc9, 0x47, 0x01, 0x92, 0x40, 0x37, 0xf3, 0x49,
+    0xad, 0x51, 0xc0, 0x38, 0x4e, 0x11, 0xc0, 0x38, 0x5a, 0x03, 0x40, 0x38,
+    0x66, 0xc2, 0x01, 0x5d, 0x0f, 0xd5, 0x11, 0xcd, 0x7d, 0x66, 0x0f, 0xce,
+    0x70, 0x9b, 0x0f, 0xa8, 0x8b, 0x00, 0x38, 0x72, 0xc9, 0xa9, 0x97, 0x01,
+    0x09, 0x50, 0x46, 0x5e, 0x42, 0xc0, 0x38, 0x81, 0x45, 0xdb, 0x11, 0xc0,
+    0x38, 0x8b, 0xc3, 0x58, 0x34, 0x0f, 0xaa, 0x59, 0x47, 0xc8, 0xd5, 0xc0,
+    0x38, 0xb4, 0x10, 0x40, 0x38, 0xd2, 0xd8, 0x21, 0xfd, 0x0b, 0x7f, 0x21,
+    0x48, 0xbd, 0x10, 0xc0, 0x38, 0xdc, 0x45, 0xd4, 0x77, 0xc0, 0x38, 0xf4,
+    0x44, 0x02, 0x28, 0xc0, 0x39, 0x14, 0x49, 0xaf, 0x01, 0x40, 0x39, 0x36,
+    0xc6, 0x08, 0x75, 0x01, 0x05, 0x69, 0xc2, 0x00, 0xca, 0x0f, 0xa4, 0x7b,
+    0x00, 0x39, 0x5e, 0xc4, 0x13, 0x6f, 0x0f, 0xa2, 0xc1, 0xc7, 0xc2, 0x29,
+    0x0f, 0xca, 0xe9, 0xc2, 0x00, 0xbe, 0x0f, 0xd4, 0x08, 0xc3, 0x12, 0x91,
+    0x0f, 0xa1, 0x41, 0xd4, 0x3e, 0x32, 0x01, 0x93, 0xf8, 0xc7, 0xc5, 0x47,
+    0x0f, 0xd4, 0xa1, 0x44, 0xde, 0x38, 0xc0, 0x39, 0x6a, 0x09, 0xc0, 0x39,
+    0x76, 0x46, 0xcd, 0x4c, 0xc0, 0x39, 0x82, 0x15, 0xc0, 0x39, 0x8e, 0x18,
+    0xc0, 0x39, 0x9e, 0x07, 0xc0, 0x39, 0xae, 0x45, 0x04, 0x7d, 0xc0, 0x39,
+    0xba, 0xce, 0x71, 0x82, 0x01, 0x19, 0x89, 0x03, 0xc0, 0x39, 0xc6, 0xd0,
+    0x5a, 0x92, 0x01, 0x12, 0x79, 0xc8, 0xb6, 0xd0, 0x01, 0x80, 0x18, 0x11,
+    0xc0, 0x39, 0xd0, 0x03, 0xc0, 0x39, 0xe0, 0xcd, 0x75, 0x39, 0x01, 0x36,
+    0xd1, 0xc3, 0x00, 0xc9, 0x0f, 0xa2, 0xb9, 0xd2, 0x4e, 0x55, 0x0f, 0xca,
+    0x08, 0xc2, 0x00, 0xd8, 0x0f, 0xcd, 0x21, 0x42, 0x04, 0x68, 0xc0, 0x39,
+    0xf5, 0x4a, 0x9e, 0xe4, 0xc0, 0x3a, 0x05, 0x17, 0xc0, 0x3a, 0x11, 0x16,
+    0xc0, 0x3a, 0x1d, 0x89, 0x0f, 0xa0, 0xab, 0x00, 0x3a, 0x27, 0x47, 0x70,
+    0x34, 0xc0, 0x3a, 0x33, 0xc7, 0xb3, 0x3b, 0x01, 0x05, 0x59, 0xc6, 0xb6,
+    0x1a, 0x0f, 0xae, 0x73, 0x00, 0x3a, 0x57, 0xcb, 0x96, 0x65, 0x0f, 0xaa,
+    0x51, 0x0e, 0xc0, 0x3a, 0x5d, 0xc2, 0x00, 0x4b, 0x0f, 0xb5, 0x51, 0xd2,
+    0x47, 0x3b, 0x0f, 0xb5, 0x78, 0xc2, 0x00, 0x2c, 0x0f, 0xcc, 0x61, 0x15,
+    0xc0, 0x3a, 0x69, 0x05, 0xc0, 0x3a, 0x7b, 0x55, 0x37, 0x84, 0xc0, 0x3a,
+    0x85, 0x0e, 0xc0, 0x3a, 0x9d, 0x45, 0x9c, 0x3c, 0xc0, 0x3a, 0xaf, 0x18,
+    0xc0, 0x3a, 0xc1, 0xd5, 0x32, 0x6e, 0x0f, 0x9e, 0xd1, 0xce, 0x6e, 0x56,
+    0x0f, 0x9f, 0x61, 0xc9, 0xab, 0x59, 0x0f, 0xce, 0x78, 0x47, 0xc2, 0x1b,
+    0xc0, 0x3a, 0xcd, 0xc6, 0xcb, 0x2a, 0x0f, 0xca, 0xf9, 0xc2, 0x00, 0x3d,
+    0x0f, 0xcc, 0x30, 0x42, 0x00, 0xa7, 0xc0, 0x3a, 0xf1, 0x44, 0x3e, 0x24,
+    0xc0, 0x3a, 0xfb, 0xca, 0xa5, 0x92, 0x01, 0x09, 0xc1, 0xc4, 0xd2, 0xc4,
+    0x01, 0x01, 0x03, 0x00, 0x3b, 0x07, 0x10, 0xc0, 0x3b, 0x0b, 0xce, 0x62,
+    0x79, 0x00, 0x00, 0x80, 0x15, 0xc0, 0x3b, 0x17, 0x42, 0x06, 0x4d, 0xc0,
+    0x3b, 0x21, 0x19, 0xc0, 0x3b, 0x2d, 0x43, 0x10, 0xb6, 0xc0, 0x3b, 0x43,
+    0xc5, 0xd3, 0xff, 0x01, 0x32, 0x33, 0x00, 0x3b, 0x4f, 0x43, 0x5c, 0x1b,
+    0xc0, 0x3b, 0x55, 0x46, 0xcb, 0x1e, 0xc0, 0x3b, 0x61, 0xc5, 0xd5, 0x17,
+    0x0f, 0xa2, 0xa1, 0xc7, 0xc2, 0x37, 0x0f, 0xc8, 0x98, 0xcc, 0x87, 0xf0,
+    0x0f, 0xc9, 0x11, 0xc2, 0x00, 0x6c, 0x01, 0x15, 0xe3, 0x00, 0x3b, 0x71,
+    0x04, 0xc0, 0x3b, 0x77, 0x0b, 0xc0, 0x3b, 0x83, 0x47, 0x37, 0xf0, 0xc0,
+    0x3b, 0x8f, 0xd3, 0x40, 0x43, 0x01, 0x01, 0x79, 0xc8, 0xb6, 0xf8, 0x0f,
+    0xa6, 0xd9, 0xca, 0xa4, 0xe8, 0x0f, 0xcf, 0xf8, 0x10, 0xc0, 0x3b, 0x9b,
+    0x94, 0x01, 0x15, 0xeb, 0x00, 0x3b, 0xa5, 0x16, 0xc0, 0x3b, 0xba, 0x01,
+    0xc0, 0x3b, 0xcb, 0x42, 0x01, 0x33, 0xc0, 0x3b, 0xee, 0xcc, 0x40, 0x4a,
+    0x00, 0x05, 0x01, 0xc2, 0x00, 0x42, 0x0f, 0xa2, 0x18, 0xca, 0x9c, 0x82,
+    0x0f, 0x0a, 0x79, 0x0e, 0xc0, 0x3b, 0xfa, 0x46, 0x04, 0x99, 0xc0, 0x3c,
+    0x06, 0x15, 0xc0, 0x3c, 0x2a, 0x45, 0x27, 0x2c, 0x40, 0x3c, 0x36, 0xd2,
+    0x4c, 0xff, 0x0b, 0x7f, 0x09, 0x0f, 0xc0, 0x3c, 0x52, 0xca, 0x9d, 0x54,
+    0x0f, 0xa9, 0x49, 0xc2, 0x00, 0xb8, 0x00, 0x00, 0x00, 0xc5, 0x14, 0x9e,
+    0x01, 0x16, 0x1b, 0x00, 0x3c, 0x5e, 0xcc, 0x07, 0xdd, 0x01, 0x16, 0x11,
+    0x48, 0x1a, 0x09, 0xc0, 0x3c, 0x64, 0x15, 0xc0, 0x3c, 0x70, 0x05, 0xc0,
+    0x3c, 0x7c, 0xc7, 0x04, 0x82, 0x01, 0x10, 0x79, 0xce, 0x6f, 0x36, 0x01,
+    0x50, 0x49, 0xd2, 0x4a, 0x65, 0x01, 0x57, 0xf8, 0xca, 0x9e, 0x30, 0x00,
+    0x3f, 0xf9, 0x06, 0xc0, 0x3c, 0x88, 0x0e, 0xc0, 0x3c, 0x9a, 0xd0, 0x0e,
+    0xed, 0x00, 0x3f, 0xc9, 0x43, 0x04, 0x0c, 0xc0, 0x3c, 0xac, 0x47, 0x12,
+    0x2d, 0xc0, 0x3c, 0xb8, 0xd4, 0x3c, 0x7a, 0x00, 0x3f, 0xa0, 0xc3, 0x85,
+    0x38, 0x0f, 0xcb, 0xb9, 0xce, 0x6c, 0x6c, 0x0f, 0x98, 0x18, 0x46, 0x06,
+    0x64, 0xc0, 0x3c, 0xc4, 0x44, 0x09, 0x2f, 0x40, 0x3c, 0xe6, 0x44, 0xe1,
+    0xa0, 0xc0, 0x3d, 0x08, 0x12, 0xc0, 0x3d, 0x14, 0x01, 0x40, 0x3d, 0x20,
+    0xc3, 0x00, 0xc6, 0x0f, 0xcc, 0x29, 0xcf, 0x6a, 0x25, 0x01, 0x33, 0x89,
+    0x94, 0x0f, 0xa2, 0x12, 0x00, 0x3d, 0x32, 0x89, 0x0f, 0xca, 0xd1, 0x52,
+    0x47, 0xdd, 0x40, 0x3d, 0x3f, 0x16, 0xc0, 0x3d, 0xc5, 0x05, 0xc0, 0x3d,
+    0xcf, 0xd1, 0x50, 0xe0, 0x0f, 0xb0, 0x88, 0x15, 0xc0, 0x3d, 0xdb, 0x42,
+    0x00, 0xaa, 0xc0, 0x3d, 0xe5, 0xc9, 0xae, 0xe6, 0x00, 0x9b, 0x09, 0xc9,
+    0x11, 0xa1, 0x00, 0x9b, 0x11, 0x12, 0xc0, 0x3d, 0xef, 0xcd, 0x30, 0xea,
+    0x00, 0x9b, 0x39, 0x46, 0x04, 0x99, 0xc0, 0x3d, 0xfb, 0x47, 0x37, 0xb8,
+    0xc0, 0x3e, 0x19, 0x4b, 0x92, 0x5b, 0x40, 0x3e, 0x37, 0x07, 0xc0, 0x3e,
+    0x5d, 0x47, 0xc2, 0x4c, 0xc0, 0x3e, 0x78, 0x88, 0x0f, 0xce, 0xe9, 0x4d,
+    0x7f, 0x6e, 0x40, 0x3e, 0x84, 0x01, 0xc0, 0x3e, 0xfd, 0xc6, 0x59, 0x96,
+    0x01, 0x33, 0x50, 0xc6, 0x31, 0x3c, 0x01, 0x38, 0x4b, 0x00, 0x3f, 0x0d,
+    0xca, 0x3d, 0xec, 0x01, 0x1c, 0x31, 0x42, 0x00, 0x6d, 0xc0, 0x3f, 0x13,
+    0x01, 0xc0, 0x3f, 0x1f, 0xc5, 0xd4, 0x22, 0x00, 0x00, 0x28, 0x4b, 0x95,
+    0xc0, 0xc0, 0x3f, 0x31, 0x4b, 0x8c, 0x83, 0xc0, 0x3f, 0x3d, 0x48, 0xb5,
+    0x18, 0x40, 0x3f, 0x49, 0x42, 0x00, 0x52, 0xc0, 0x3f, 0x55, 0x0b, 0x40,
+    0x3f, 0x5f, 0x46, 0xce, 0x00, 0xc0, 0x3f, 0x6b, 0xc4, 0x62, 0x83, 0x00,
+    0x00, 0xd8, 0xcc, 0x85, 0xc8, 0x01, 0x08, 0x39, 0x42, 0x00, 0x57, 0x40,
+    0x3f, 0x75, 0x95, 0x0f, 0xa2, 0x01, 0xc7, 0xad, 0x0b, 0x0f, 0xa2, 0x98,
+    0x0b, 0xc0, 0x3f, 0x87, 0x4c, 0x85, 0x38, 0xc0, 0x3f, 0x93, 0x42, 0x00,
+    0x72, 0xc0, 0x3f, 0xaf, 0x47, 0xc8, 0x42, 0xc0, 0x3f, 0xbb, 0x47, 0xc9,
+    0x29, 0x40, 0x3f, 0xef, 0xc5, 0xd3, 0xeb, 0x0f, 0xcc, 0x69, 0xc4, 0xdf,
+    0xf8, 0x0f, 0x9e, 0x61, 0x03, 0xc0, 0x40, 0x19, 0xc5, 0xcb, 0x13, 0x0f,
+    0xcb, 0xe9, 0x4c, 0x8a, 0x6c, 0x40, 0x40, 0x23, 0x07, 0xc0, 0x40, 0x97,
+    0x03, 0xc0, 0x40, 0xa1, 0x11, 0xc0, 0x40, 0xb9, 0x0b, 0x40, 0x40, 0xc5,
+    0xc2, 0x00, 0x72, 0x01, 0x34, 0xcb, 0x00, 0x40, 0xd1, 0x0f, 0xc0, 0x40,
+    0xd7, 0x11, 0xc0, 0x40, 0xe3, 0xcf, 0x6b, 0x6f, 0x01, 0x05, 0x81, 0xc3,
+    0x6c, 0xd0, 0x0f, 0xce, 0xf1, 0xc7, 0xc0, 0xa8, 0x01, 0x80, 0x98, 0xca,
+    0xa0, 0x24, 0x01, 0x09, 0xb9, 0x14, 0x40, 0x40, 0xef, 0xc6, 0xd2, 0x2c,
+    0x0f, 0x9d, 0x91, 0xc4, 0xbe, 0xe2, 0x0f, 0xce, 0x20, 0x11, 0xc0, 0x40,
+    0xfc, 0xca, 0xa5, 0xe2, 0x01, 0x4f, 0x31, 0x03, 0x40, 0x41, 0x0e, 0x43,
+    0x00, 0xc4, 0xc0, 0x41, 0x1a, 0xd0, 0x5d, 0x02, 0x01, 0x3e, 0x39, 0xcc,
+    0x8b, 0x14, 0x01, 0x31, 0x31, 0x0b, 0xc0, 0x41, 0x26, 0x45, 0x0d, 0x4d,
+    0x40, 0x41, 0x32, 0xc2, 0x00, 0x2c, 0x0f, 0xcd, 0x31, 0x4b, 0x91, 0x06,
+    0x40, 0x41, 0x3e, 0x47, 0xc5, 0x78, 0xc0, 0x41, 0x56, 0x07, 0xc0, 0x41,
+    0x74, 0x52, 0x27, 0x32, 0xc0, 0x41, 0x7e, 0xc3, 0x00, 0x46, 0x0f, 0xce,
+    0x28, 0x07, 0xc0, 0x41, 0x84, 0xc7, 0xc2, 0x3e, 0x01, 0x36, 0x71, 0xc8,
+    0x12, 0x81, 0x01, 0x30, 0x69, 0x42, 0x00, 0x45, 0x40, 0x41, 0x8e, 0x06,
+    0xc0, 0x41, 0x9d, 0x47, 0xc0, 0xd2, 0xc0, 0x41, 0xa7, 0xc3, 0x0c, 0xf7,
+    0x0f, 0xd6, 0x90, 0x16, 0xc0, 0x41, 0xcf, 0xc8, 0xb8, 0x88, 0x01, 0x09,
+    0x28, 0x42, 0x00, 0x2d, 0xc0, 0x41, 0xdb, 0x16, 0x40, 0x41, 0xff, 0xd1,
+    0x57, 0x40, 0x01, 0x1f, 0xf9, 0x46, 0x3d, 0x5e, 0xc0, 0x42, 0x0b, 0xda,
+    0x19, 0x48, 0x07, 0xff, 0xe0, 0x0e, 0xc0, 0x42, 0x17, 0xcb, 0x8f, 0x85,
+    0x0f, 0xcb, 0xa8, 0x44, 0x7e, 0xab, 0xc0, 0x42, 0x26, 0xc4, 0xcc, 0xa0,
+    0x00, 0x16, 0xd8, 0x46, 0xd3, 0x4c, 0xc0, 0x42, 0x3e, 0x44, 0x3d, 0x80,
+    0x40, 0x42, 0x4a, 0x46, 0xcd, 0xd0, 0xc0, 0x42, 0x56, 0x51, 0x50, 0x25,
+    0xc0, 0x42, 0x99, 0x4a, 0x57, 0x0d, 0x40, 0x42, 0xb1, 0x15, 0xc0, 0x42,
+    0xc9, 0x42, 0x00, 0x7f, 0xc0, 0x42, 0xd5, 0x48, 0x11, 0x2a, 0xc0, 0x42,
+    0xe1, 0x45, 0x01, 0x69, 0xc0, 0x42, 0xed, 0xd4, 0x3d, 0x92, 0x08, 0xd1,
+    0x99, 0x47, 0x01, 0x92, 0xc0, 0x43, 0x05, 0x46, 0x35, 0x43, 0x40, 0x43,
+    0x61, 0xce, 0x73, 0xea, 0x01, 0x17, 0xf9, 0x15, 0xc0, 0x43, 0x6d, 0x14,
+    0xc0, 0x43, 0x79, 0x45, 0x00, 0x2f, 0xc0, 0x43, 0x8b, 0xca, 0x9b, 0x9c,
+    0x01, 0x4c, 0x11, 0xd6, 0x2d, 0x90, 0x01, 0x53, 0x20, 0x49, 0xae, 0xc2,
+    0xc0, 0x43, 0x97, 0xc8, 0xbb, 0xb8, 0x0f, 0xcc, 0x99, 0xc2, 0x10, 0x85,
+    0x01, 0x5f, 0x10, 0x47, 0xc9, 0x22, 0xc0, 0x43, 0xa9, 0x47, 0xc9, 0x61,
+    0xc0, 0x43, 0xd9, 0xcc, 0x8b, 0xb0, 0x0f, 0x9c, 0x19, 0x94, 0x0f, 0xd6,
+    0xc8, 0xc2, 0x00, 0x10, 0x01, 0x35, 0xa9, 0xc5, 0xd3, 0xa0, 0x01, 0x32,
+    0x19, 0xc6, 0xca, 0x88, 0x0f, 0xc9, 0xc8, 0xc6, 0xd3, 0x6a, 0x0f, 0xab,
+    0xc9, 0xc2, 0x00, 0xaf, 0x01, 0x50, 0xe8, 0xc9, 0x47, 0xce, 0x01, 0x33,
+    0x49, 0x42, 0x06, 0x5e, 0xc0, 0x44, 0x09, 0xd9, 0x1e, 0x52, 0x01, 0x50,
+    0xb0, 0xcb, 0x5d, 0xd7, 0x01, 0x12, 0xf9, 0x01, 0x40, 0x44, 0x15, 0xc6,
+    0xcb, 0x42, 0x01, 0x31, 0x79, 0x01, 0x40, 0x44, 0x21, 0x45, 0xd7, 0x88,
+    0xc0, 0x44, 0x2d, 0xca, 0xa4, 0x34, 0x0f, 0xa4, 0xd9, 0xc6, 0x0a, 0x0c,
+    0x00, 0x05, 0x28, 0xa0, 0x07, 0xf0, 0x03, 0x00, 0x44, 0x3f, 0xa1, 0x07,
+    0xf0, 0x0b, 0x00, 0x44, 0x85, 0xa8, 0x07, 0xf0, 0x43, 0x00, 0x44, 0xbf,
+    0xa7, 0x07, 0xf0, 0x3b, 0x00, 0x44, 0xe7, 0xa6, 0x07, 0xf0, 0x33, 0x00,
+    0x45, 0x0f, 0xa5, 0x07, 0xf0, 0x2b, 0x00, 0x45, 0x37, 0xa4, 0x07, 0xf0,
+    0x23, 0x00, 0x45, 0x5f, 0xa3, 0x07, 0xf0, 0x1b, 0x00, 0x45, 0x87, 0xa2,
+    0x07, 0xf0, 0x12, 0x00, 0x45, 0xaf, 0x42, 0x07, 0xf3, 0xc0, 0x45, 0xd7,
+    0xc5, 0x04, 0x0c, 0x05, 0x30, 0x69, 0xc9, 0x11, 0xa1, 0x05, 0x30, 0x71,
+    0xcd, 0x30, 0xea, 0x05, 0x30, 0x79, 0x46, 0x04, 0x99, 0x40, 0x45, 0xe3,
+    0x46, 0x05, 0x69, 0xc0, 0x46, 0x07, 0x42, 0x00, 0x38, 0xc0, 0x46, 0x4a,
+    0xc5, 0xdc, 0x01, 0x01, 0x09, 0x18, 0x45, 0x00, 0x8d, 0xc0, 0x46, 0x5c,
+    0x45, 0x2a, 0xc0, 0x40, 0x46, 0x9a, 0x5f, 0x0d, 0x40, 0xc0, 0x46, 0xce,
+    0xcc, 0x89, 0x70, 0x01, 0x18, 0xb8, 0xc8, 0xbe, 0xb8, 0x0f, 0xa7, 0xe1,
+    0x01, 0x40, 0x46, 0xda, 0x4f, 0x09, 0x39, 0xc0, 0x46, 0xe6, 0x4d, 0x28,
+    0xa7, 0x40, 0x47, 0x66, 0xcc, 0x83, 0xc4, 0x01, 0x11, 0x81, 0xc4, 0xe0,
+    0x84, 0x0f, 0x98, 0x59, 0xc7, 0xc1, 0x6c, 0x0f, 0x9e, 0x80, 0xcb, 0x97,
+    0x57, 0x01, 0x0c, 0x49, 0xcd, 0x46, 0x59, 0x01, 0x0a, 0xf1, 0x08, 0xc0,
+    0x47, 0xe6, 0x16, 0xc0, 0x47, 0xf2, 0x44, 0x05, 0x16, 0x40, 0x47, 0xfe,
+    0x01, 0xc0, 0x48, 0x24, 0x46, 0xcf, 0xd4, 0xc0, 0x48, 0x6e, 0x45, 0xd8,
+    0xf5, 0x40, 0x48, 0x7a, 0xc4, 0x0c, 0xf6, 0x0e, 0x9b, 0xc1, 0xc3, 0x05,
+    0x16, 0x0e, 0x9b, 0xb8, 0x09, 0xc0, 0x48, 0x8c, 0xca, 0xa3, 0x8a, 0x0f,
+    0x9c, 0x58, 0x43, 0x5c, 0x89, 0xc0, 0x48, 0x9e, 0xc3, 0x02, 0x17, 0x0f,
+    0xd6, 0xa0, 0xc5, 0xc5, 0x1e, 0x01, 0x38, 0x39, 0xc9, 0xb0, 0xa8, 0x0f,
+    0xad, 0x68, 0x43, 0x02, 0x53, 0xc0, 0x48, 0xf2, 0xc8, 0xb6, 0x38, 0x0f,
+    0xcb, 0x08, 0x45, 0x91, 0x5e, 0xc0, 0x49, 0x10, 0x4a, 0xa5, 0x06, 0xc0,
+    0x49, 0x34, 0x45, 0xd7, 0x38, 0x40, 0x49, 0x9a, 0x0d, 0xc0, 0x49, 0xb8,
+    0x44, 0x07, 0xd4, 0xc0, 0x49, 0xc4, 0xc3, 0x0e, 0x2d, 0x0f, 0xa1, 0x10,
+    0x01, 0xc0, 0x49, 0xf2, 0x1e, 0x40, 0x4a, 0x1c, 0x10, 0xc0, 0x4a, 0x2e,
+    0xce, 0x6b, 0xfc, 0x0f, 0xca, 0x48, 0xcc, 0x85, 0xbc, 0x0f, 0xa5, 0x69,
+    0xc9, 0xb0, 0xcc, 0x0f, 0xd3, 0xa0, 0x44, 0x15, 0x1d, 0xc0, 0x4a, 0x38,
+    0x44, 0x87, 0xc2, 0x40, 0x4a, 0x44, 0x07, 0xc0, 0x4a, 0x50, 0x42, 0x08,
+    0x04, 0x40, 0x4a, 0x5a, 0x44, 0x0d, 0xc2, 0xc0, 0x4a, 0x66, 0x42, 0x02,
+    0x31, 0x40, 0x4a, 0x8a, 0xd8, 0x25, 0x75, 0x0f, 0xa8, 0xe9, 0xd6, 0x06,
+    0xea, 0x01, 0x1f, 0x01, 0xcd, 0x00, 0x34, 0x01, 0x1e, 0xf1, 0xcb, 0x1a,
+    0x38, 0x01, 0x1e, 0xe1, 0xce, 0x22, 0x37, 0x01, 0x1d, 0xa1, 0x42, 0x00,
+    0xce, 0xc0, 0x4a, 0x94, 0x46, 0x01, 0x78, 0xc0, 0x4a, 0x9e, 0x45, 0x00,
+    0x2f, 0xc0, 0x4a, 0xa8, 0x44, 0x13, 0xe3, 0x40, 0x4a, 0xb2, 0x42, 0x00,
+    0x5e, 0xc0, 0x4a, 0xc1, 0xc9, 0xab, 0xf2, 0x01, 0x19, 0x80, 0x56, 0x2e,
+    0x2a, 0xc0, 0x4a, 0xcd, 0xd6, 0x2d, 0xe8, 0x0f, 0x89, 0x50, 0xc2, 0x00,
+    0x60, 0x0f, 0xcd, 0xbb, 0x00, 0x4a, 0xdf, 0xc4, 0x7a, 0x5d, 0x0f, 0xcf,
+    0x80, 0x8f, 0x0f, 0xb4, 0x53, 0x00, 0x4a, 0xe5, 0xc2, 0x00, 0xaf, 0x0f,
+    0xb4, 0x31, 0xcc, 0x82, 0x98, 0x01, 0x09, 0x11, 0x05, 0xc0, 0x4a, 0xeb,
+    0x42, 0x05, 0x83, 0x40, 0x4a, 0xf7, 0x43, 0x00, 0xc4, 0xc0, 0x4b, 0x03,
+    0x49, 0x81, 0x1b, 0xc0, 0x4b, 0x0f, 0x44, 0x16, 0x57, 0xc0, 0x4b, 0x37,
+    0xc5, 0x36, 0xec, 0x01, 0x02, 0xe9, 0xcb, 0x95, 0xf7, 0x0f, 0xa9, 0x88,
+    0x87, 0x01, 0x15, 0x43, 0x00, 0x4b, 0x6b, 0xc4, 0xe3, 0xc4, 0x0f, 0x9d,
+    0xd0, 0x12, 0xc0, 0x4b, 0x71, 0xc2, 0x00, 0xb8, 0x0f, 0xce, 0x62, 0x00,
+    0x4b, 0x7d, 0x08, 0xc0, 0x4b, 0x83, 0x0e, 0xc0, 0x4b, 0x99, 0x06, 0xc0,
+    0x4b, 0xa3, 0x11, 0xc0, 0x4b, 0xbd, 0x05, 0xc0, 0x4b, 0xc9, 0x03, 0xc0,
+    0x4b, 0xdf, 0x0a, 0xc0, 0x4b, 0xf7, 0x15, 0xc0, 0x4c, 0x03, 0x07, 0xc0,
+    0x4c, 0x13, 0x42, 0x00, 0xaf, 0xc0, 0x4c, 0x2f, 0x42, 0x00, 0x71, 0xc0,
+    0x4c, 0x3b, 0x0f, 0xc0, 0x4c, 0x47, 0x09, 0xc0, 0x4c, 0x59, 0xc5, 0xd9,
+    0x09, 0x0e, 0x99, 0xd9, 0xd3, 0x41, 0xac, 0x0e, 0x99, 0xb9, 0x14, 0xc0,
+    0x4c, 0x74, 0x12, 0xc0, 0x4c, 0x7e, 0x0d, 0xc0, 0x4c, 0x8e, 0x04, 0xc0,
+    0x4c, 0x9a, 0xc3, 0x86, 0x3d, 0x0e, 0x98, 0xe9, 0xcc, 0x87, 0x3c, 0x0e,
+    0x98, 0x88, 0x14, 0xc0, 0x4c, 0xac, 0xd2, 0x4a, 0xd1, 0x0f, 0x9b, 0xa9,
+    0xc3, 0x3d, 0xe2, 0x0f, 0xd6, 0xb0, 0x07, 0xc0, 0x4c, 0xb8, 0x44, 0xde,
+    0xf0, 0x40, 0x4c, 0xca, 0x96, 0x01, 0x37, 0xd1, 0xc7, 0x8b, 0x3d, 0x01,
+    0x05, 0xc1, 0xd4, 0x3c, 0xde, 0x0f, 0x9d, 0xf0, 0xd7, 0x2a, 0x56, 0x01,
+    0x3a, 0x29, 0xc2, 0x00, 0x2c, 0x0f, 0xa0, 0x2a, 0x00, 0x4c, 0xee, 0xc7,
+    0x15, 0x36, 0x01, 0x1f, 0x91, 0x47, 0x52, 0x3a, 0x40, 0x4c, 0xf4, 0x01,
+    0x40, 0x4d, 0x00, 0x45, 0xdd, 0xc3, 0xc0, 0x4d, 0x0f, 0x4b, 0x91, 0x8a,
+    0xc0, 0x4d, 0x37, 0xc7, 0x10, 0x8a, 0x0f, 0xb1, 0x58, 0x42, 0x00, 0x5c,
+    0x40, 0x4d, 0x43, 0x15, 0xc0, 0x4d, 0x49, 0x45, 0x01, 0x69, 0xc0, 0x4d,
+    0x59, 0x0e, 0xc0, 0x4d, 0xa5, 0x52, 0x4e, 0x1f, 0xc0, 0x4d, 0xb1, 0x46,
+    0x04, 0x99, 0xc0, 0x4d, 0xbb, 0x4b, 0x6e, 0xbb, 0xc0, 0x4d, 0xe5, 0xc9,
+    0xad, 0xfc, 0x00, 0x7d, 0xf3, 0x00, 0x4e, 0x16, 0x52, 0x4b, 0x3d, 0x40,
+    0x4e, 0x1c, 0x47, 0x01, 0x92, 0xc0, 0x4e, 0x34, 0x42, 0x08, 0x04, 0xc0,
+    0x4e, 0x46, 0xce, 0x72, 0x70, 0x01, 0x6b, 0x81, 0xd0, 0x5c, 0xe2, 0x01,
+    0x6b, 0xf8, 0x01, 0xc0, 0x4e, 0x4c, 0xc8, 0xb7, 0xe0, 0x01, 0x71, 0xd0,
+    0x49, 0xb3, 0xb7, 0x40, 0x4e, 0x8e, 0x8e, 0x0f, 0xcd, 0x69, 0x96, 0x0f,
+    0xa5, 0xd0, 0xcb, 0x99, 0xa9, 0x01, 0x35, 0xe1, 0xc7, 0xad, 0x14, 0x07,
+    0xf2, 0x28, 0xc7, 0xbf, 0xc8, 0x01, 0x35, 0xd1, 0x06, 0xc0, 0x4e, 0xb2,
+    0xc5, 0x36, 0xec, 0x00, 0x01, 0xd8, 0x16, 0xc0, 0x4e, 0xb8, 0xcf, 0x68,
+    0x81, 0x0f, 0xca, 0x40, 0xc5, 0x19, 0x43, 0x01, 0x10, 0xb1, 0xce, 0x70,
+    0x08, 0x00, 0x04, 0x98, 0xc9, 0xaa, 0x54, 0x01, 0x09, 0x01, 0x45, 0x29,
+    0xc3, 0x40, 0x4e, 0xc4, 0xc5, 0xd7, 0x01, 0x0f, 0x99, 0x89, 0xcf, 0x67,
+    0x0a, 0x0f, 0xb2, 0x40, 0xc8, 0xbf, 0x10, 0x0f, 0xd3, 0xd1, 0x42, 0x03,
+    0x84, 0xc0, 0x4e, 0xca, 0xd3, 0x45, 0x88, 0x01, 0x71, 0xe0, 0x16, 0xc0,
+    0x4e, 0xd6, 0x14, 0xc0, 0x4e, 0xe2, 0x46, 0xcc, 0xa4, 0xc0, 0x4e, 0xec,
+    0xcd, 0x31, 0x35, 0x0f, 0xac, 0x19, 0xc4, 0x04, 0x3f, 0x0f, 0x9e, 0xf9,
+    0xcc, 0x82, 0xf8, 0x0f, 0xce, 0x68, 0xd7, 0x26, 0xa7, 0x01, 0x39, 0x49,
+    0x03, 0xc0, 0x4e, 0xf8, 0x0b, 0x40, 0x4f, 0x04, 0xc6, 0xcd, 0xee, 0x01,
+    0x1f, 0x89, 0xc8, 0xbe, 0xc8, 0x0f, 0xaf, 0x00, 0xce, 0x70, 0x4e, 0x0f,
+    0x9c, 0xc9, 0xc2, 0x04, 0xf2, 0x0f, 0xb6, 0x99, 0xce, 0x70, 0xbe, 0x0f,
+    0xca, 0xc8, 0x01, 0x40, 0x4f, 0x10, 0x16, 0xc0, 0x4f, 0x1c, 0xca, 0x89,
+    0x66, 0x0f, 0xd7, 0x08, 0xc4, 0xe1, 0xc8, 0x0f, 0xcc, 0xa9, 0x47, 0xc7,
+    0x46, 0x40, 0x4f, 0x28, 0x48, 0x11, 0x71, 0xc0, 0x4f, 0x44, 0xc5, 0xd6,
+    0xf2, 0x0f, 0xcb, 0x50, 0xc3, 0x05, 0x81, 0x01, 0x32, 0x21, 0xc6, 0xd1,
+    0x36, 0x0f, 0xb7, 0x82, 0x00, 0x4f, 0x50, 0x4c, 0x10, 0x43, 0xc0, 0x4f,
+    0x56, 0xd1, 0x4d, 0x59, 0x00, 0x41, 0xb1, 0x0f, 0xc0, 0x4f, 0x80, 0x4b,
+    0x6e, 0xbb, 0xc0, 0x4f, 0x8c, 0x47, 0x01, 0x92, 0x40, 0x4f, 0xb0, 0xc4,
+    0x58, 0xe0, 0x0f, 0xcd, 0xd1, 0xc3, 0x0d, 0x9c, 0x0f, 0xcf, 0xb8, 0xc2,
+    0x1f, 0x3b, 0x0f, 0xcd, 0x41, 0xc2, 0x00, 0xb8, 0x0f, 0xa4, 0x02, 0x00,
+    0x50, 0x08, 0xc2, 0x00, 0x2c, 0x01, 0x37, 0xb9, 0xcd, 0x7f, 0xc9, 0x0f,
+    0x9d, 0xf8, 0x16, 0xc0, 0x50, 0x0e, 0x12, 0x40, 0x50, 0x18, 0x86, 0x0f,
+    0xb7, 0xb9, 0xca, 0xa2, 0xb8, 0x0f, 0xab, 0xa9, 0x42, 0x02, 0x59, 0x40,
+    0x50, 0x22, 0x46, 0x6d, 0xf6, 0xc0, 0x50, 0x2e, 0xcb, 0x98, 0xe3, 0x0f,
+    0x9a, 0xa8, 0x45, 0x05, 0x5f, 0xc0, 0x50, 0x3a, 0xce, 0x71, 0x04, 0x05,
+    0x33, 0x98, 0xc3, 0x18, 0x3b, 0x0f, 0xcc, 0x81, 0xc2, 0x05, 0xa9, 0x0f,
+    0xc9, 0xb8, 0x14, 0xc0, 0x50, 0x46, 0x4c, 0x02, 0xed, 0xc0, 0x50, 0x50,
+    0xc5, 0xdb, 0xf2, 0x01, 0x30, 0xc1, 0x18, 0xc0, 0x50, 0x62, 0xd0, 0x5b,
+    0x82, 0x0f, 0xca, 0xc0, 0xc3, 0x00, 0x2b, 0x0f, 0xb5, 0xf9, 0x42, 0x03,
+    0xc3, 0xc0, 0x50, 0x6e, 0xd0, 0x57, 0xb2, 0x01, 0x1b, 0xe9, 0xca, 0x9d,
+    0x40, 0x0f, 0x99, 0x01, 0x46, 0x29, 0x76, 0xc0, 0x50, 0x82, 0xdd, 0x10,
+    0x88, 0x0f, 0xc9, 0x78, 0xca, 0xa0, 0x74, 0x01, 0x37, 0x49, 0x43, 0x00,
+    0x31, 0xc0, 0x50, 0x8e, 0x92, 0x0f, 0xb5, 0x11, 0xc3, 0x20, 0xdc, 0x0f,
+    0xb7, 0x08, 0x43, 0x56, 0x84, 0xc0, 0x50, 0x9a, 0xc4, 0x5b, 0xa0, 0x0f,
+    0xb7, 0xa0, 0xc3, 0x02, 0xa0, 0x01, 0x34, 0xb1, 0xc2, 0x18, 0x3f, 0x0f,
+    0xcf, 0x18, 0x44, 0x02, 0x13, 0xc0, 0x50, 0xa6, 0xc4, 0x41, 0xfd, 0x01,
+    0x08, 0x41, 0x07, 0xc0, 0x50, 0xb8, 0xc3, 0x1e, 0xb4, 0x0f, 0xa6, 0xe0,
+    0xc8, 0xb9, 0x70, 0x0f, 0x9c, 0x90, 0xc5, 0x2a, 0x68, 0x01, 0x3a, 0x21,
+    0xc3, 0x12, 0xf2, 0x01, 0x30, 0x1b, 0x00, 0x50, 0xc4, 0xc7, 0xc5, 0x7f,
+    0x0f, 0x9e, 0x11, 0xd0, 0x5e, 0x32, 0x0f, 0x9e, 0xa0, 0xc2, 0x00, 0x3e,
+    0x0f, 0xa0, 0x69, 0xc2, 0x01, 0xd7, 0x0f, 0xa0, 0x60, 0x43, 0x00, 0x94,
+    0xc0, 0x50, 0xca, 0xd6, 0x30, 0xbe, 0x01, 0x08, 0xb8, 0xd6, 0x1f, 0x9a,
+    0x0f, 0xb3, 0x53, 0x00, 0x50, 0xd6, 0xc2, 0x10, 0x85, 0x00, 0x01, 0x7a,
+    0x00, 0x50, 0xdc, 0x4e, 0x6e, 0x02, 0xc0, 0x50, 0xe2, 0xdb, 0x17, 0x63,
+    0x08, 0xd5, 0x03, 0x00, 0x50, 0xea, 0x45, 0x01, 0x69, 0xc0, 0x50, 0xf0,
+    0x15, 0xc0, 0x51, 0x08, 0xcf, 0x64, 0x58, 0x08, 0xd4, 0xc1, 0x55, 0x32,
+    0xc2, 0xc0, 0x51, 0x14, 0x57, 0x27, 0xa4, 0xc0, 0x51, 0x44, 0x47, 0x01,
+    0x92, 0xc0, 0x51, 0x54, 0x46, 0x35, 0x43, 0x40, 0x51, 0xae, 0xc8, 0xbf,
+    0x30, 0x01, 0x35, 0xe9, 0xc2, 0x00, 0xa3, 0x0f, 0xcf, 0x30, 0xd4, 0x3a,
+    0x22, 0x01, 0x1c, 0xa1, 0x01, 0xc0, 0x51, 0xba, 0xc4, 0x17, 0x31, 0x0f,
+    0xca, 0x70, 0x46, 0x04, 0x99, 0xc0, 0x51, 0xcc, 0x47, 0x01, 0x92, 0x40,
+    0x51, 0xf0, 0x4c, 0x10, 0x43, 0xc0, 0x52, 0x6a, 0x47, 0x37, 0xb8, 0xc0,
+    0x52, 0x7c, 0x4a, 0x57, 0x0d, 0xc0, 0x52, 0x89, 0xd0, 0x58, 0x92, 0x08,
+    0x7a, 0x29, 0x47, 0x01, 0x92, 0x40, 0x52, 0xb3, 0x42, 0x03, 0xe1, 0xc0,
+    0x53, 0x10, 0xd8, 0x23, 0x65, 0x01, 0x3d, 0x38, 0x48, 0x1b, 0x28, 0xc0,
+    0x53, 0x1a, 0xc5, 0xdb, 0x52, 0x01, 0x19, 0x78, 0xc6, 0xcd, 0xac, 0x0f,
+    0xaa, 0x69, 0xcd, 0x65, 0x59, 0x00, 0x00, 0xb0, 0x43, 0x6a, 0x2c, 0xc0,
+    0x53, 0x6e, 0xc3, 0x01, 0x3c, 0x0f, 0xa4, 0x48, 0x47, 0x01, 0x92, 0xc0,
+    0x53, 0xc6, 0x45, 0x00, 0x8d, 0xc0, 0x54, 0x1c, 0x4b, 0x6e, 0xbb, 0xc0,
+    0x54, 0x2c, 0x4c, 0x87, 0x00, 0x40, 0x54, 0x42, 0x07, 0xc0, 0x54, 0x52,
+    0xca, 0xa3, 0x80, 0x01, 0x05, 0xb9, 0x42, 0x07, 0x42, 0x40, 0x54, 0x5e,
+    0x43, 0x24, 0xe3, 0xc0, 0x54, 0x73, 0xc6, 0xcb, 0xa8, 0x0f, 0x9a, 0xe9,
+    0xc2, 0x01, 0x0e, 0x00, 0x01, 0x00, 0x49, 0x74, 0xcf, 0x40, 0x54, 0x80,
+    0x44, 0x01, 0xdc, 0xc0, 0x54, 0x8c, 0xc3, 0x0a, 0xa8, 0x0f, 0xab, 0xba,
+    0x00, 0x54, 0x9e, 0xc9, 0xb3, 0x5d, 0x0f, 0x9e, 0x29, 0xcb, 0x96, 0xc8,
+    0x0f, 0xa1, 0x99, 0x11, 0xc0, 0x54, 0xa4, 0xc3, 0x01, 0x3c, 0x0f, 0xcf,
+    0xe8, 0x48, 0xb5, 0xe8, 0xc0, 0x54, 0xae, 0xcd, 0x7e, 0xec, 0x0f, 0xc8,
+    0xc0, 0x42, 0x04, 0x81, 0xc0, 0x55, 0x00, 0xd5, 0x36, 0x0a, 0x01, 0x39,
+    0xd1, 0xcd, 0x7a, 0x40, 0x01, 0x00, 0x30, 0x45, 0xd6, 0xa7, 0xc0, 0x55,
+    0x0c, 0x46, 0x3f, 0x61, 0x40, 0x55, 0x2c, 0xc6, 0xcc, 0x2c, 0x01, 0x11,
+    0xf9, 0x43, 0x00, 0xc6, 0xc0, 0x55, 0x38, 0x45, 0xdc, 0xbf, 0x40, 0x55,
+    0x42, 0xcd, 0x79, 0xa4, 0x01, 0x53, 0x61, 0x43, 0x04, 0x74, 0xc0, 0x55,
+    0x5e, 0x46, 0x00, 0xd2, 0x40, 0x55, 0x6a, 0x15, 0xc0, 0x55, 0x76, 0xc4,
+    0x8c, 0x81, 0x0f, 0xcd, 0xc1, 0xc7, 0xbf, 0x9e, 0x0f, 0xcd, 0xc8, 0x01,
+    0xc0, 0x55, 0x82, 0x47, 0xc7, 0xbd, 0xc0, 0x55, 0x8e, 0xc6, 0x90, 0x45,
+    0x0f, 0x99, 0xd9, 0xc4, 0xb2, 0x42, 0x0f, 0x98, 0x2b, 0x00, 0x55, 0xb8,
+    0xd2, 0x47, 0x95, 0x0f, 0x98, 0x38, 0xc6, 0x0b, 0xfc, 0x01, 0x1d, 0x99,
+    0xc3, 0x06, 0xa9, 0x01, 0x1d, 0x91, 0xcd, 0x7c, 0x55, 0x01, 0x50, 0x58,
+    0x01, 0x40, 0x55, 0xbe, 0x43, 0x00, 0x3f, 0xc0, 0x55, 0xd6, 0x46, 0x02,
+    0x11, 0xc0, 0x55, 0xeb, 0xc6, 0xab, 0x41, 0x00, 0x00, 0xd0, 0xcc, 0x86,
+    0xdc, 0x01, 0x11, 0x79, 0xc2, 0x00, 0x2c, 0x0f, 0x9e, 0x20, 0xc2, 0x00,
+    0x0a, 0x0f, 0x9b, 0x19, 0xcf, 0x62, 0x0f, 0x0f, 0xb4, 0xf8, 0x0e, 0xc0,
+    0x56, 0x25, 0xca, 0xa3, 0x76, 0x0f, 0xb0, 0x78, 0x42, 0x00, 0xb8, 0xc0,
+    0x56, 0x2f, 0xca, 0x48, 0xbd, 0x01, 0x51, 0x98, 0xd5, 0x33, 0xd3, 0x0f,
+    0xb3, 0xa9, 0x90, 0x0f, 0xcd, 0x10, 0xd3, 0x42, 0xb6, 0x0f, 0xdd, 0x81,
+    0x4a, 0x09, 0x9f, 0x40, 0x56, 0x3c, 0x01, 0xc0, 0x56, 0x4e, 0x47, 0x04,
+    0x92, 0x40, 0x56, 0xb5, 0x47, 0x0a, 0x3c, 0xc0, 0x56, 0xcd, 0xc9, 0xb3,
+    0x30, 0x00, 0x2c, 0x79, 0xc6, 0x58, 0x02, 0x00, 0x2c, 0x51, 0xc9, 0x11,
+    0xa1, 0x00, 0x2c, 0x49, 0x03, 0xc0, 0x56, 0xd9, 0xcd, 0x30, 0xea, 0x00,
+    0x2a, 0xf1, 0x05, 0xc0, 0x56, 0xe5, 0x07, 0xc0, 0x56, 0xf1, 0xde, 0x0f,
+    0x60, 0x00, 0x2a, 0xc8, 0xca, 0x9b, 0x06, 0x0f, 0x9d, 0x41, 0xcd, 0x7a,
+    0xa8, 0x0f, 0xb4, 0xd8, 0xce, 0x73, 0xa4, 0x0f, 0x9c, 0xf9, 0xc4, 0x7e,
+    0x1f, 0x01, 0x5f, 0x28, 0x05, 0xc0, 0x56, 0xfd, 0x4d, 0x28, 0xa7, 0xc0,
+    0x57, 0x09, 0xcf, 0x66, 0x74, 0x0f, 0x4a, 0x21, 0xd0, 0x5d, 0x52, 0x0f,
+    0x4a, 0x29, 0x47, 0x64, 0x58, 0xc0, 0x57, 0x89, 0xc5, 0x07, 0x2b, 0x0f,
+    0x4a, 0x39, 0x10, 0xc0, 0x57, 0x95, 0x46, 0x04, 0x99, 0xc0, 0x57, 0xa1,
+    0x48, 0x11, 0x2a, 0x40, 0x57, 0xc5, 0x04, 0xc0, 0x57, 0xd1, 0x05, 0xc0,
+    0x57, 0xf2, 0x06, 0xc0, 0x58, 0x06, 0x12, 0xc0, 0x58, 0x12, 0x16, 0xc0,
+    0x58, 0x26, 0x14, 0xc0, 0x58, 0x41, 0x18, 0xc0, 0x58, 0x4e, 0x15, 0xc0,
+    0x58, 0x58, 0x03, 0xc0, 0x58, 0x7e, 0x0e, 0xc0, 0x58, 0xac, 0x42, 0x00,
+    0xb0, 0xc0, 0x58, 0xb8, 0x0f, 0xc0, 0x58, 0xc4, 0x42, 0x00, 0x71, 0xc0,
+    0x58, 0xd9, 0xc5, 0x67, 0x41, 0x0f, 0xb8, 0x19, 0x43, 0x01, 0xd5, 0xc0,
+    0x58, 0xe3, 0xc4, 0x87, 0xbc, 0x0f, 0xb8, 0x11, 0x09, 0xc0, 0x58, 0xef,
+    0x44, 0x19, 0x6b, 0xc0, 0x58, 0xfb, 0xc3, 0xd7, 0x53, 0x0f, 0xba, 0x31,
+    0xc5, 0xd8, 0xeb, 0x0f, 0xba, 0xa9, 0x0a, 0x40, 0x59, 0x0a, 0xda, 0x1c,
+    0xa2, 0x01, 0x36, 0xa9, 0xce, 0x73, 0xb2, 0x01, 0x1c, 0x38, 0xc4, 0xd5,
+    0xfe, 0x01, 0x34, 0xb9, 0xc8, 0x95, 0x08, 0x01, 0x09, 0xa9, 0xc2, 0x03,
+    0xc3, 0x00, 0x00, 0x38, 0xce, 0x72, 0xc4, 0x01, 0x19, 0x71, 0xc8, 0x0b,
+    0x21, 0x01, 0x12, 0x60, 0xcb, 0x24, 0x62, 0x01, 0x12, 0x51, 0xc2, 0x00,
+    0x5d, 0x01, 0x12, 0x42, 0x00, 0x59, 0x14, 0xc9, 0xb4, 0x74, 0x0f, 0xb7,
+    0xd1, 0x0f, 0x40, 0x59, 0x1a, 0xc8, 0xbc, 0xb8, 0x0f, 0xb7, 0x61, 0xc9,
+    0xa8, 0x5c, 0x0f, 0xb7, 0x58, 0x51, 0x53, 0x33, 0xc0, 0x59, 0x26, 0xcb,
+    0x92, 0xd4, 0x0f, 0xd6, 0x00, 0x4b, 0x04, 0x59, 0xc0, 0x59, 0x3e, 0xce,
+    0x6e, 0xfe, 0x0f, 0xa7, 0xb0, 0xc2, 0x00, 0x2f, 0x01, 0x11, 0x03, 0x00,
+    0x59, 0x5e, 0xca, 0x9a, 0xac, 0x01, 0x09, 0x59, 0xc9, 0x24, 0x4c, 0x0f,
+    0xa5, 0x11, 0xcb, 0x97, 0x20, 0x0f, 0xb1, 0x39, 0xc7, 0xc4, 0x4b, 0x0f,
+    0xb1, 0x00, 0x14, 0xc0, 0x59, 0x64, 0x44, 0x09, 0x84, 0xc0, 0x59, 0x70,
+    0xcc, 0x86, 0xc4, 0x0f, 0xb1, 0x90, 0xcb, 0x87, 0x31, 0x01, 0x30, 0x51,
+    0xc9, 0xae, 0x95, 0x08, 0x0c, 0xe0, 0x0e, 0xc0, 0x59, 0x7b, 0x10, 0xc0,
+    0x59, 0x85, 0x06, 0xc0, 0x59, 0x9b, 0x16, 0xc0, 0x59, 0xa9, 0x05, 0xc0,
+    0x59, 0xb7, 0x83, 0x08, 0xb8, 0x93, 0x00, 0x59, 0xc1, 0x0c, 0xc0, 0x59,
+    0xc7, 0x04, 0xc0, 0x59, 0xd1, 0x09, 0xc0, 0x59, 0xdb, 0xc2, 0x00, 0xce,
+    0x08, 0xb8, 0x89, 0xc2, 0x0d, 0x01, 0x08, 0xb8, 0x79, 0xc2, 0x00, 0x3b,
+    0x08, 0xb8, 0x69, 0xc2, 0x00, 0xb6, 0x08, 0xb8, 0x49, 0x12, 0xc0, 0x59,
+    0xe5, 0x0d, 0x40, 0x59, 0xef, 0xc8, 0x93, 0x43, 0x08, 0xb9, 0xf9, 0x44,
+    0x00, 0x8e, 0x40, 0x59, 0xf9, 0xc5, 0x26, 0x6c, 0x08, 0xb9, 0xd9, 0xc2,
+    0x00, 0x79, 0x08, 0xb9, 0xd0, 0xc4, 0x28, 0x74, 0x08, 0xb9, 0xc9, 0xc5,
+    0x0a, 0xfd, 0x08, 0xb9, 0xc1, 0x15, 0xc0, 0x5a, 0x09, 0x08, 0xc0, 0x5a,
+    0x15, 0x16, 0xc0, 0x5a, 0x21, 0xc3, 0x05, 0x16, 0x08, 0xb9, 0x89, 0xc4,
+    0x18, 0xa7, 0x08, 0xb9, 0x80, 0x83, 0x08, 0xb9, 0x03, 0x00, 0x5a, 0x2d,
+    0x91, 0x08, 0xb9, 0x41, 0x87, 0x08, 0xb9, 0x31, 0x97, 0x08, 0xb9, 0x23,
+    0x00, 0x5a, 0x3d, 0x8b, 0x08, 0xb9, 0x12, 0x00, 0x5a, 0x41, 0x0e, 0xc0,
+    0x5a, 0x45, 0xc2, 0x00, 0x3b, 0x08, 0xb8, 0xf0, 0xc6, 0x68, 0xde, 0x01,
+    0x08, 0x01, 0xc5, 0xd4, 0x90, 0x0f, 0xd4, 0xb8, 0xd3, 0x45, 0x29, 0x01,
+    0x03, 0x69, 0xd2, 0x47, 0x17, 0x01, 0x03, 0x58, 0xc4, 0x00, 0xc5, 0x01,
+    0x4c, 0xf9, 0xc5, 0x0a, 0x24, 0x00, 0x05, 0xa0, 0x42, 0x00, 0xe5, 0xc0,
+    0x5a, 0x4f, 0xc5, 0xd9, 0x18, 0x01, 0x1b, 0xd3, 0x00, 0x5a, 0x5e, 0xc5,
+    0x9e, 0x99, 0x01, 0x1b, 0xab, 0x00, 0x5a, 0x64, 0x0b, 0xc0, 0x5a, 0x6a,
+    0xd0, 0x5b, 0xc2, 0x01, 0x1b, 0xb9, 0x14, 0xc0, 0x5a, 0x79, 0x42, 0x00,
+    0x6f, 0xc0, 0x5a, 0x85, 0x06, 0xc0, 0x5a, 0x8f, 0x15, 0xc0, 0x5a, 0xa1,
+    0xc5, 0xd8, 0x73, 0x01, 0x1b, 0x61, 0x05, 0xc0, 0x5a, 0xb7, 0xd6, 0x30,
+    0x24, 0x01, 0x1b, 0x49, 0xcf, 0x60, 0x7a, 0x01, 0x1b, 0x41, 0x44, 0x00,
+    0x2f, 0xc0, 0x5a, 0xc3, 0x44, 0xe0, 0x14, 0xc0, 0x5a, 0xcf, 0xcd, 0x7f,
+    0xaf, 0x01, 0x1a, 0x00, 0x42, 0x00, 0x57, 0xc0, 0x5a, 0xdb, 0xd8, 0x24,
+    0xe5, 0x00, 0x04, 0xf8, 0xc7, 0x2e, 0xd3, 0x00, 0x01, 0x39, 0xc4, 0xe4,
+    0x3c, 0x01, 0x5f, 0x20, 0xd1, 0x4d, 0x59, 0x08, 0x59, 0xc9, 0x47, 0x01,
+    0x92, 0x40, 0x5a, 0xe7, 0xc4, 0x3a, 0xa6, 0x0f, 0x9f, 0xd1, 0xc6, 0x33,
+    0xd9, 0x00, 0x01, 0x30, 0xca, 0x9c, 0xb4, 0x08, 0x08, 0x11, 0x47, 0x37,
+    0xb8, 0xc0, 0x5b, 0x68, 0x19, 0xc0, 0x5b, 0x8f, 0xd9, 0x1e, 0x20, 0x08,
+    0x09, 0xe1, 0xdc, 0x13, 0xa7, 0x08, 0x09, 0xe9, 0x48, 0x13, 0xae, 0x40,
+    0x5b, 0x9b, 0x4a, 0xa0, 0x60, 0xc0, 0x5b, 0xa7, 0xc9, 0xac, 0xca, 0x0f,
+    0xca, 0x50, 0xd4, 0x3e, 0x46, 0x0f, 0xbd, 0x89, 0xcb, 0x57, 0x87, 0x0f,
+    0xbd, 0x21, 0x46, 0x00, 0xbb, 0xc0, 0x5b, 0xc9, 0x15, 0xc0, 0x5b, 0xd5,
+    0xd5, 0x33, 0x94, 0x0f, 0xbd, 0xe8, 0x43, 0x08, 0x3c, 0xc0, 0x5b, 0xe1,
+    0xd4, 0x3d, 0x6a, 0x0f, 0x9b, 0xf0, 0xc3, 0x1e, 0x1b, 0x01, 0x16, 0x43,
+    0x00, 0x5c, 0x14, 0x0e, 0xc0, 0x5c, 0x1a, 0xca, 0xa0, 0xd8, 0x0f, 0x9f,
+    0xc8, 0x8d, 0x0f, 0xab, 0x73, 0x00, 0x5c, 0x24, 0xc6, 0xc5, 0xcd, 0x0f,
+    0xd4, 0x18, 0xcb, 0x97, 0xf1, 0x0f, 0x9c, 0xa8, 0xc8, 0x46, 0x05, 0x0f,
+    0xb6, 0x48, 0x47, 0x01, 0x92, 0xc0, 0x5c, 0x31, 0x4d, 0x7a, 0x0c, 0x40,
+    0x5c, 0xbb, 0x4b, 0x98, 0x6a, 0xc0, 0x5c, 0xcf, 0xc4, 0xb3, 0x47, 0x0f,
+    0x99, 0xe1, 0xc5, 0xdd, 0x96, 0x0f, 0xa1, 0x08, 0x42, 0x00, 0x3d, 0xc0,
+    0x5c, 0xf6, 0xc9, 0x94, 0x8e, 0x01, 0x21, 0x10, 0x01, 0xc0, 0x5c, 0xfe,
+    0xc7, 0xc5, 0x0f, 0x0f, 0xd6, 0x80, 0xc2, 0x07, 0xd1, 0x0f, 0xd4, 0xa9,
+    0x8d, 0x0f, 0x9f, 0x33, 0x00, 0x5d, 0x0a, 0xc3, 0x0d, 0xc2, 0x0f, 0x9a,
+    0x60, 0x0e, 0xc0, 0x5d, 0x10, 0x46, 0x7c, 0x97, 0x40, 0x5d, 0x20, 0xc3,
+    0x00, 0x3e, 0x0f, 0xcf, 0xd3, 0x00, 0x5d, 0x56, 0xc5, 0xd6, 0xcf, 0x01,
+    0x35, 0xf1, 0x47, 0xc3, 0x3a, 0x40, 0x5d, 0x5c, 0xc3, 0x01, 0x3d, 0x0f,
+    0xcd, 0x09, 0xde, 0x0e, 0x16, 0x0f, 0x9f, 0xc0, 0x01, 0x40, 0x5d, 0x6e,
+    0x47, 0x01, 0x92, 0xc0, 0x5d, 0x86, 0x42, 0x00, 0xaa, 0xc0, 0x5d, 0xcb,
+    0xc7, 0xc3, 0xaa, 0x05, 0x37, 0x91, 0xc9, 0x11, 0xa1, 0x05, 0x37, 0x99,
+    0xc9, 0xa9, 0xd6, 0x05, 0x37, 0xb1, 0xcd, 0x30, 0xea, 0x05, 0x37, 0xb8,
+    0x0d, 0xc0, 0x5d, 0xd5, 0xcb, 0x94, 0x3f, 0x0f, 0xa1, 0x59, 0xc2, 0x00,
+    0x47, 0x0f, 0xca, 0x98, 0x43, 0x40, 0x4e, 0xc0, 0x5d, 0xe3, 0xc4, 0x92,
+    0xc7, 0x0f, 0xa8, 0x59, 0x8a, 0x0f, 0xb6, 0x02, 0x00, 0x5d, 0xff, 0x01,
+    0xc0, 0x5e, 0x05, 0xc8, 0xbd, 0xc0, 0x0f, 0xa4, 0x40, 0xca, 0x9d, 0x0e,
+    0x0f, 0xb6, 0x21, 0xcb, 0x96, 0x86, 0x0f, 0xca, 0xb1, 0xc2, 0x01, 0x25,
+    0x0f, 0xcb, 0x78, 0xc9, 0xb1, 0x4a, 0x01, 0x05, 0xf9, 0xc7, 0x85, 0xd8,
+    0x0f, 0xd7, 0x30, 0xc5, 0xdd, 0x82, 0x0f, 0x9d, 0x89, 0xc6, 0xcb, 0x60,
+    0x0f, 0xcf, 0x10, 0xca, 0x9c, 0xe6, 0x0f, 0x9c, 0x11, 0x86, 0x0f, 0xa1,
+    0x30, 0xcf, 0x69, 0x62, 0x01, 0x4f, 0xc9, 0xc7, 0x2a, 0x11, 0x01, 0x4f,
+    0xc0, 0x87, 0x0f, 0xb5, 0x91, 0xc3, 0x1d, 0xbd, 0x0f, 0xb5, 0xa0, 0xc3,
+    0x00, 0x98, 0x0f, 0xcd, 0x59, 0x44, 0x8e, 0x5c, 0xc0, 0x5e, 0x11, 0xca,
+    0xa6, 0x6e, 0x0f, 0xa4, 0x99, 0xd0, 0x59, 0xf2, 0x0f, 0x9e, 0xb1, 0x14,
+    0xc0, 0x5e, 0x29, 0xc2, 0x05, 0x83, 0x0f, 0xd6, 0xc0, 0xc9, 0xa7, 0xf0,
+    0x01, 0x19, 0x63, 0x00, 0x5e, 0x35, 0x16, 0xc0, 0x5e, 0x3b, 0x45, 0xad,
+    0x79, 0x40, 0x5e, 0x47, 0x01, 0xc0, 0x5e, 0x79, 0xc8, 0xbd, 0x98, 0x0f,
+    0xb6, 0x70, 0xc4, 0x02, 0x6d, 0x01, 0x13, 0x61, 0xc7, 0x07, 0xf2, 0x01,
+    0x09, 0xb0, 0xc5, 0xa9, 0x6d, 0x0f, 0x9b, 0xd1, 0xc3, 0x0e, 0x2d, 0x0f,
+    0xd5, 0x90, 0xc3, 0xe5, 0xc5, 0x0f, 0xcc, 0x58, 0xc5, 0x08, 0x71, 0x0f,
+    0xb4, 0x79, 0x16, 0x40, 0x5e, 0x8b, 0xc4, 0xde, 0xc4, 0x01, 0x2e, 0x71,
+    0xc2, 0x00, 0x3f, 0x01, 0x01, 0x13, 0x00, 0x5e, 0x97, 0xc4, 0x27, 0x7b,
+    0x0f, 0xab, 0x5a, 0x00, 0x5e, 0x9d, 0x46, 0x7c, 0x97, 0x40, 0x5e, 0xa3,
+    0x4b, 0x6e, 0xbb, 0xc0, 0x5e, 0xbb, 0x47, 0x01, 0x92, 0x40, 0x5e, 0xc3,
+    0xc4, 0x4d, 0xf5, 0x0f, 0xce, 0x59, 0x95, 0x0f, 0xd7, 0x38, 0x06, 0xc0,
+    0x5f, 0x21, 0x42, 0x00, 0x07, 0xc0, 0x5f, 0x2d, 0xc2, 0x00, 0x3d, 0x0f,
+    0xcf, 0x88, 0x0b, 0xc0, 0x5f, 0x37, 0x44, 0xdf, 0x68, 0x40, 0x5f, 0x41,
+    0x44, 0x09, 0x88, 0xc0, 0x5f, 0x61, 0xc8, 0xbb, 0x18, 0x0f, 0xc8, 0x71,
+    0xc5, 0xd4, 0xae, 0x0f, 0xcb, 0x31, 0xc2, 0x04, 0x0d, 0x0f, 0xcf, 0xc8,
+    0x03, 0xc0, 0x5f, 0x73, 0xc2, 0x00, 0x98, 0x00, 0x16, 0xc0, 0x09, 0xc0,
+    0x5f, 0x83, 0x0d, 0xc0, 0x5f, 0x95, 0x03, 0xc0, 0x5f, 0xb8, 0x15, 0xc0,
+    0x5f, 0xca, 0x06, 0xc0, 0x5f, 0xe7, 0x1b, 0xc0, 0x5f, 0xf7, 0x08, 0xc0,
+    0x60, 0x01, 0x42, 0x11, 0x99, 0xc0, 0x60, 0x13, 0x0b, 0xc0, 0x60, 0x25,
+    0x07, 0xc0, 0x60, 0x35, 0x0f, 0xc0, 0x60, 0x57, 0x16, 0xc0, 0x60, 0x63,
+    0x0e, 0xc0, 0x60, 0x75, 0x11, 0xc0, 0x60, 0x7f, 0x12, 0xc0, 0x60, 0x97,
+    0xcc, 0x89, 0x88, 0x0e, 0x83, 0x51, 0x42, 0x02, 0x63, 0xc0, 0x60, 0xad,
+    0xc4, 0xdf, 0x73, 0x0e, 0x82, 0x01, 0x14, 0x40, 0x60, 0xb9, 0xc4, 0x28,
+    0x74, 0x08, 0xe3, 0x13, 0x00, 0x60, 0xc5, 0xc5, 0x0a, 0xfd, 0x08, 0xe3,
+    0x0b, 0x00, 0x60, 0xcb, 0x15, 0xc0, 0x60, 0xcf, 0x08, 0xc0, 0x60, 0xe1,
+    0x16, 0xc0, 0x60, 0xe9, 0xc3, 0x05, 0x16, 0x08, 0xe2, 0xd0, 0x45, 0x04,
+    0x9a, 0xc0, 0x60, 0xf7, 0xcb, 0x8c, 0xe6, 0x08, 0xe2, 0x11, 0xc4, 0x19,
+    0xf1, 0x08, 0xe2, 0x08, 0xa1, 0x08, 0xe2, 0x29, 0xa0, 0x08, 0xe2, 0x20,
+    0x03, 0xc0, 0x61, 0x1b, 0x42, 0x06, 0xb4, 0xc0, 0x61, 0x27, 0xcb, 0x1f,
+    0xe9, 0x08, 0xe1, 0xe0, 0x03, 0xc0, 0x61, 0x33, 0x91, 0x08, 0xe1, 0xd1,
+    0x87, 0x08, 0xe1, 0xc1, 0x48, 0xaa, 0xd2, 0xc0, 0x61, 0x3f, 0x97, 0x08,
+    0xe1, 0x93, 0x00, 0x61, 0x4a, 0x8b, 0x08, 0xe1, 0x82, 0x00, 0x61, 0x4e,
+    0xc2, 0x00, 0xce, 0x08, 0xe1, 0x71, 0x15, 0xc0, 0x61, 0x52, 0x18, 0xc0,
+    0x61, 0x62, 0xc2, 0x00, 0x89, 0x08, 0xe1, 0x49, 0xc2, 0x00, 0x3b, 0x08,
+    0xe1, 0x41, 0xc2, 0x1a, 0x18, 0x08, 0xe1, 0x39, 0xc2, 0x00, 0xb6, 0x08,
+    0xe1, 0x31, 0x04, 0xc0, 0x61, 0x6c, 0x12, 0xc0, 0x61, 0x76, 0x10, 0xc0,
+    0x61, 0x80, 0x06, 0xc0, 0x61, 0x96, 0x16, 0xc0, 0x61, 0xa4, 0x0c, 0xc0,
+    0x61, 0xb2, 0x05, 0xc0, 0x61, 0xbc, 0x09, 0xc0, 0x61, 0xc6, 0x0d, 0xc0,
+    0x61, 0xd0, 0x83, 0x08, 0xe0, 0x03, 0x00, 0x61, 0xda, 0x91, 0x08, 0xe0,
+    0x61, 0x87, 0x08, 0xe0, 0x51, 0x97, 0x08, 0xe0, 0x23, 0x00, 0x61, 0xe6,
+    0x8b, 0x08, 0xe0, 0x12, 0x00, 0x61, 0xea, 0x43, 0x00, 0x2c, 0xc0, 0x61,
+    0xee, 0x01, 0x40, 0x62, 0x1c, 0x45, 0x00, 0x64, 0xc0, 0x62, 0x3b, 0x44,
+    0x00, 0x2f, 0xc0, 0x62, 0x47, 0x06, 0x40, 0x62, 0x51, 0xdb, 0x16, 0x1f,
+    0x01, 0x3f, 0x00, 0xc2, 0x00, 0x4b, 0x01, 0x11, 0x43, 0x00, 0x62, 0x63,
+    0xc3, 0x00, 0x6b, 0x01, 0x11, 0x3a, 0x00, 0x62, 0x67, 0xcd, 0x78, 0x6c,
+    0x0f, 0xa8, 0x79, 0x4a, 0x9b, 0x42, 0x40, 0x62, 0x6d, 0xc6, 0x01, 0x92,
+    0x0f, 0xa4, 0x61, 0xc5, 0xdd, 0xe6, 0x0f, 0x9f, 0x48, 0xca, 0xa2, 0xfe,
+    0x0f, 0xcf, 0xa1, 0xc2, 0x10, 0x85, 0x0f, 0xd5, 0xb8, 0x01, 0xc0, 0x62,
+    0x79, 0x46, 0x00, 0x71, 0xc0, 0x62, 0xc8, 0x1e, 0x40, 0x63, 0x0f, 0xc7,
+    0xc2, 0xed, 0x0f, 0xcb, 0x61, 0xd3, 0x42, 0x0b, 0x0f, 0x9a, 0x18, 0xc4,
+    0x09, 0x48, 0x0f, 0xa0, 0x30, 0x4b, 0x34, 0x27, 0xc0, 0x63, 0x2b, 0xd8,
+    0x21, 0xcd, 0x01, 0x16, 0xd1, 0x45, 0x00, 0x92, 0xc0, 0x63, 0x37, 0x11,
+    0xc0, 0x63, 0x49, 0x03, 0xc0, 0x63, 0x55, 0xc4, 0x00, 0x8d, 0x00, 0x01,
+    0xe1, 0xcf, 0x64, 0xdf, 0x01, 0x55, 0x32, 0x00, 0x63, 0x61, 0x47, 0x01,
+    0x92, 0xc0, 0x63, 0x67, 0x46, 0x04, 0x99, 0xc0, 0x63, 0xbf, 0x4c, 0x10,
+    0x43, 0xc0, 0x63, 0xe3, 0x15, 0xc0, 0x63, 0xf3, 0x4f, 0x2c, 0x5c, 0xc0,
+    0x63, 0xff, 0x4b, 0x6e, 0xbb, 0x40, 0x64, 0x21, 0x42, 0x00, 0x67, 0xc0,
+    0x64, 0x3d, 0xd6, 0x25, 0xef, 0x0f, 0xb3, 0x90, 0x47, 0x01, 0x92, 0xc0,
+    0x64, 0x4a, 0x4c, 0x10, 0x43, 0x40, 0x64, 0xc0, 0x07, 0xc0, 0x64, 0xcc,
+    0x0d, 0x40, 0x64, 0xd6, 0x43, 0xbc, 0xa5, 0xc0, 0x64, 0xe2, 0xd3, 0x3f,
+    0xe4, 0x01, 0x96, 0x78, 0xc4, 0x20, 0xe8, 0x0f, 0xa4, 0x20, 0x47, 0x01,
+    0x92, 0xc0, 0x65, 0x04, 0xcf, 0x61, 0xa6, 0x08, 0x49, 0xf8, 0x83, 0x08,
+    0x14, 0x03, 0x00, 0x65, 0x66, 0x87, 0x08, 0x14, 0x0b, 0x00, 0x65, 0x6a,
+    0x84, 0x08, 0x14, 0x13, 0x00, 0x65, 0x6e, 0x89, 0x08, 0x14, 0x21, 0x86,
+    0x08, 0x14, 0x29, 0x8b, 0x08, 0x14, 0x31, 0x99, 0x08, 0x14, 0x39, 0x9c,
+    0x08, 0x14, 0x41, 0x96, 0x08, 0x14, 0xbb, 0x00, 0x65, 0x72, 0x8c, 0x08,
+    0x14, 0x51, 0x8d, 0x08, 0x14, 0x5b, 0x00, 0x65, 0x7a, 0x93, 0x08, 0x14,
+    0x61, 0x8e, 0x08, 0x14, 0x69, 0x8f, 0x08, 0x14, 0x73, 0x00, 0x65, 0x7e,
+    0x90, 0x08, 0x14, 0x7b, 0x00, 0x65, 0x82, 0x97, 0x08, 0x14, 0x91, 0x92,
+    0x08, 0x14, 0x99, 0x94, 0x08, 0x14, 0xa9, 0x95, 0x08, 0x14, 0xb1, 0x8a,
+    0x08, 0x14, 0xd9, 0x9a, 0x08, 0x14, 0xe0, 0x42, 0x01, 0x3d, 0xc0, 0x65,
+    0x86, 0xc6, 0x8d, 0x6f, 0x01, 0x05, 0xf0, 0x15, 0xc0, 0x65, 0x93, 0x47,
+    0x01, 0x92, 0xc0, 0x65, 0x9f, 0x05, 0xc0, 0x65, 0xef, 0x52, 0x47, 0xa7,
+    0x40, 0x65, 0xfb, 0x01, 0x40, 0x66, 0x11, 0xc2, 0x01, 0x25, 0x0f, 0x9f,
+    0xb9, 0xc5, 0xd8, 0x50, 0x0f, 0xcb, 0xe0, 0xc8, 0xbe, 0xa0, 0x0f, 0xa0,
+    0xf1, 0xc3, 0x0a, 0xa8, 0x0f, 0xd4, 0xe0, 0x47, 0x01, 0x92, 0xc0, 0x66,
+    0x1d, 0xc8, 0x26, 0x15, 0x00, 0x75, 0x79, 0x4b, 0x6e, 0xbb, 0xc0, 0x66,
+    0x74, 0x15, 0xc0, 0x66, 0xa1, 0xc5, 0xda, 0x85, 0x00, 0x76, 0x31, 0x49,
+    0xb4, 0x98, 0xc0, 0x66, 0xad, 0xd1, 0x53, 0x88, 0x00, 0x76, 0x61, 0xc9,
+    0xb0, 0x7b, 0x00, 0x76, 0x69, 0x46, 0x04, 0x99, 0xc0, 0x66, 0xbd, 0x43,
+    0x61, 0x7d, 0x40, 0x66, 0xe1, 0x46, 0x01, 0x78, 0xc0, 0x66, 0xed, 0x45,
+    0x00, 0x2f, 0xc0, 0x67, 0x15, 0x44, 0x00, 0x6b, 0xc0, 0x67, 0x31, 0x45,
+    0x04, 0x30, 0xc0, 0x67, 0x3b, 0xce, 0x6c, 0x5e, 0x01, 0x38, 0x09, 0x44,
+    0x05, 0x16, 0xc0, 0x67, 0x56, 0x16, 0xc0, 0x67, 0x62, 0xd2, 0x4d, 0x23,
+    0x0f, 0xdc, 0x21, 0xd3, 0x46, 0x59, 0x0f, 0xdc, 0x30, 0x46, 0x00, 0xbb,
+    0xc0, 0x67, 0x6e, 0x16, 0xc0, 0x67, 0x80, 0x15, 0xc0, 0x67, 0x8c, 0xd0,
+    0x5c, 0xd2, 0x0f, 0xc1, 0xe9, 0xd1, 0x51, 0x9b, 0x0f, 0xc1, 0xa9, 0x03,
+    0xc0, 0x67, 0x98, 0xcf, 0x66, 0xdd, 0x01, 0x3f, 0x81, 0x06, 0xc0, 0x67,
+    0xa7, 0xcd, 0x79, 0x7d, 0x01, 0x0e, 0x41, 0x0a, 0xc0, 0x67, 0xb3, 0x46,
+    0x06, 0x64, 0xc0, 0x67, 0xbf, 0xc6, 0xd0, 0x58, 0x0f, 0xb3, 0x68, 0x46,
+    0x00, 0xb5, 0xc0, 0x67, 0xcb, 0x4e, 0x6e, 0x48, 0xc0, 0x67, 0xd7, 0xcc,
+    0x47, 0x53, 0x0f, 0xa9, 0xd1, 0xd1, 0x50, 0xbe, 0x0f, 0xb7, 0x31, 0xc8,
+    0x2c, 0x54, 0x0f, 0xb7, 0x38, 0xc4, 0x32, 0xbe, 0x01, 0x15, 0x2b, 0x00,
+    0x67, 0xe3, 0x45, 0x00, 0x83, 0xc0, 0x67, 0xe9, 0xd7, 0x26, 0x34, 0x01,
+    0x17, 0x81, 0x45, 0x10, 0xc2, 0xc0, 0x67, 0xf8, 0xc9, 0xb2, 0xdf, 0x01,
+    0x4b, 0xf1, 0x45, 0x05, 0x40, 0x40, 0x68, 0x1f, 0xc9, 0xa9, 0x8e, 0x0f,
+    0xcc, 0x21, 0xd7, 0x1e, 0xd1, 0x01, 0x33, 0x91, 0xc2, 0x00, 0x47, 0x01,
+    0x11, 0x53, 0x00, 0x68, 0x2b, 0x16, 0x40, 0x68, 0x2f, 0xc8, 0xa1, 0x5c,
+    0x01, 0x1c, 0x61, 0xc5, 0xbe, 0xab, 0x01, 0x01, 0xf8, 0xc9, 0xb3, 0xed,
+    0x01, 0x37, 0x89, 0xcf, 0x6a, 0x34, 0x01, 0x30, 0xa0, 0x03, 0xc0, 0x68,
+    0x3b, 0xc4, 0x95, 0x10, 0x08, 0x1c, 0x09, 0x09, 0xc0, 0x68, 0x47, 0x0d,
+    0xc0, 0x68, 0x53, 0x06, 0xc0, 0x68, 0x5f, 0xc2, 0x00, 0x4a, 0x08, 0x1c,
+    0x2b, 0x00, 0x68, 0x6b, 0xc2, 0x01, 0xa2, 0x08, 0x1c, 0x31, 0x1c, 0xc0,
+    0x68, 0x71, 0x16, 0xc0, 0x68, 0x7b, 0xc3, 0x4e, 0x09, 0x08, 0x1c, 0x51,
+    0x15, 0xc0, 0x68, 0x8b, 0xc5, 0xdb, 0xe8, 0x08, 0x1c, 0x69, 0xc3, 0x03,
+    0xb0, 0x08, 0x1c, 0x71, 0xc3, 0x20, 0xb0, 0x08, 0x1c, 0x81, 0xc2, 0x05,
+    0x1e, 0x08, 0x1c, 0xa1, 0xc4, 0xe2, 0xa8, 0x08, 0x1c, 0xb1, 0xc5, 0xa4,
+    0x50, 0x08, 0x1c, 0xb9, 0x8b, 0x08, 0x1c, 0xd9, 0x97, 0x08, 0x1c, 0xe0,
+    0x43, 0x10, 0xe7, 0xc0, 0x68, 0x9b, 0x06, 0xc0, 0x68, 0xf7, 0x14, 0x40,
+    0x69, 0x06, 0xc7, 0xc9, 0xd8, 0x0f, 0xb4, 0x09, 0x0f, 0xc0, 0x69, 0x12,
+    0xd7, 0x28, 0x2e, 0x01, 0x5f, 0xf8, 0x14, 0xc0, 0x69, 0x1e, 0x0a, 0xc0,
+    0x69, 0x3c, 0x10, 0xc0, 0x69, 0x5a, 0x0d, 0xc0, 0x69, 0x7e, 0x42, 0x29,
+    0x2c, 0xc0, 0x69, 0x9c, 0x42, 0x00, 0xdd, 0xc0, 0x69, 0xa8, 0x42, 0x33,
+    0x5c, 0xc0, 0x69, 0xc0, 0x42, 0x31, 0x45, 0xc0, 0x69, 0xd4, 0x42, 0x12,
+    0xa3, 0xc0, 0x69, 0xe4, 0x19, 0xc0, 0x69, 0xf6, 0x1b, 0xc0, 0x6a, 0x0e,
+    0x0f, 0xc0, 0x6a, 0x20, 0x16, 0xc0, 0x6a, 0x3e, 0x15, 0x40, 0x6a, 0x5c,
+    0xd7, 0x2b, 0x3c, 0x01, 0x15, 0xc9, 0x84, 0x0f, 0x99, 0xf8, 0x0e, 0xc0,
+    0x6a, 0x7a, 0x12, 0xc0, 0x6a, 0x86, 0xcc, 0x8b, 0x8c, 0x00, 0x2f, 0x79,
+    0x45, 0x01, 0x69, 0xc0, 0x6a, 0x92, 0x47, 0x27, 0xf4, 0x40, 0x6a, 0xa4,
+    0x16, 0xc0, 0x6a, 0xee, 0x06, 0xc0, 0x6a, 0xfa, 0xce, 0x75, 0x02, 0x02,
+    0x6e, 0x19, 0x19, 0xc0, 0x6b, 0x0e, 0x42, 0x00, 0xaa, 0xc0, 0x6b, 0x1a,
+    0xd0, 0x5e, 0xc2, 0x02, 0x6e, 0x39, 0x15, 0xc0, 0x6b, 0x24, 0x12, 0xc0,
+    0x6b, 0x36, 0x08, 0xc0, 0x6b, 0x48, 0x09, 0xc0, 0x6b, 0x54, 0x42, 0x08,
+    0x04, 0xc0, 0x6b, 0x5e, 0xca, 0xa6, 0x8c, 0x02, 0x6e, 0x79, 0x03, 0xc0,
+    0x6b, 0x6a, 0x04, 0xc0, 0x6b, 0x7c, 0x42, 0x03, 0xe1, 0xc0, 0x6b, 0x8e,
+    0x42, 0x00, 0xaf, 0xc0, 0x6b, 0x98, 0x11, 0xc0, 0x6b, 0xa8, 0xca, 0xa3,
+    0xee, 0x02, 0x6f, 0xd8, 0x48, 0x00, 0x4d, 0xc0, 0x6b, 0xb4, 0xc2, 0x00,
+    0x42, 0x0f, 0xa0, 0x72, 0x00, 0x6b, 0xda, 0x01, 0xc0, 0x6b, 0xde, 0xc2,
+    0x01, 0x25, 0x0f, 0x9f, 0x40, 0xc6, 0xc6, 0xde, 0x01, 0x18, 0xdb, 0x00,
+    0x6b, 0xf6, 0xc2, 0x00, 0x42, 0x01, 0x18, 0x12, 0x00, 0x6b, 0xfc, 0x87,
+    0x0f, 0xab, 0x99, 0xd9, 0x1f, 0x97, 0x0f, 0xb3, 0x42, 0x00, 0x6c, 0x00,
+    0xc4, 0x47, 0x7c, 0x0f, 0x9b, 0x79, 0xc3, 0xa9, 0x6a, 0x0f, 0xa0, 0xe8,
+    0x15, 0xc0, 0x6c, 0x06, 0xc3, 0x02, 0x28, 0x0f, 0xa9, 0x43, 0x00, 0x6c,
+    0x10, 0xc6, 0xcb, 0x5a, 0x0f, 0x9a, 0xa0, 0x06, 0xc0, 0x6c, 0x16, 0x4d,
+    0x76, 0xbf, 0xc0, 0x6c, 0x28, 0x45, 0xd9, 0x13, 0xc0, 0x6c, 0x46, 0x09,
+    0x40, 0x6c, 0x58, 0xc6, 0x40, 0x50, 0x01, 0x00, 0x51, 0xc3, 0x21, 0x2a,
+    0x0f, 0xa4, 0x38, 0x44, 0x9f, 0x95, 0xc0, 0x6c, 0x64, 0xcb, 0x98, 0x3e,
+    0x0f, 0xa1, 0x18, 0x4c, 0x1a, 0x4c, 0xc0, 0x6c, 0x70, 0x44, 0x00, 0x2f,
+    0xc0, 0x6c, 0x7c, 0x45, 0x00, 0x64, 0xc0, 0x6c, 0x88, 0x48, 0xba, 0x90,
+    0xc0, 0x6c, 0x94, 0x47, 0xc5, 0x16, 0xc0, 0x6c, 0x9e, 0xd4, 0x39, 0x5a,
+    0x07, 0xff, 0x41, 0xcd, 0x1a, 0xa7, 0x07, 0xff, 0x51, 0xcf, 0x13, 0xd0,
+    0x07, 0xff, 0x61, 0xcc, 0x0d, 0xb0, 0x07, 0xff, 0x69, 0xcc, 0x0d, 0xa0,
+    0x07, 0xff, 0x70, 0x1e, 0xc0, 0x6c, 0xaa, 0x01, 0x40, 0x6c, 0xb9, 0x47,
+    0x01, 0x92, 0xc0, 0x6c, 0xc5, 0xce, 0x1a, 0x58, 0x01, 0x84, 0xe9, 0xd5,
+    0x32, 0x83, 0x01, 0x84, 0xf1, 0xcc, 0x82, 0x50, 0x01, 0x84, 0xf8, 0xc3,
+    0x08, 0x9b, 0x01, 0x00, 0x83, 0x00, 0x6d, 0x1d, 0xc9, 0xb2, 0x61, 0x01,
+    0x70, 0x90, 0x42, 0x00, 0x2c, 0xc0, 0x6d, 0x2d, 0x47, 0xc7, 0xfc, 0x40,
+    0x6d, 0x39, 0x46, 0x09, 0x33, 0xc0, 0x6d, 0x4b, 0xc7, 0x07, 0xf3, 0x0f,
+    0xa9, 0x19, 0xc7, 0xc0, 0x69, 0x0f, 0xa9, 0x10, 0x14, 0xc0, 0x6d, 0x5d,
+    0xc4, 0x1e, 0x5e, 0x01, 0x11, 0x5a, 0x00, 0x6d, 0x7c, 0xcd, 0x7a, 0xe9,
+    0x01, 0x1c, 0x01, 0x4d, 0x77, 0xd0, 0x40, 0x6d, 0x80, 0xc5, 0x63, 0x09,
+    0x01, 0x10, 0xf3, 0x00, 0x6d, 0x8c, 0x49, 0x4f, 0x4a, 0x40, 0x6d, 0x92,
+    0x42, 0x03, 0xe1, 0xc0, 0x6d, 0x9c, 0x42, 0x04, 0x0d, 0x40, 0x6d, 0xa8,
+    0x0b, 0xc0, 0x6d, 0xb4, 0xc2, 0x01, 0x41, 0x00, 0x04, 0x22, 0x00, 0x6d,
+    0xc0, 0xd3, 0x45, 0x29, 0x01, 0x03, 0x61, 0xd2, 0x47, 0x17, 0x01, 0x03,
+    0x50, 0xcd, 0x78, 0x52, 0x0f, 0xd5, 0x51, 0x44, 0x05, 0x6b, 0x40, 0x6d,
+    0xc6, 0x16, 0xc0, 0x6d, 0xd5, 0x42, 0x00, 0x06, 0xc0, 0x6d, 0xe1, 0xc5,
+    0x40, 0x51, 0x01, 0x80, 0x01, 0x05, 0xc0, 0x6d, 0xed, 0xc9, 0x11, 0xa1,
+    0x01, 0x80, 0x11, 0xce, 0x1a, 0x58, 0x01, 0x80, 0x29, 0xcb, 0x8f, 0x9b,
+    0x01, 0x80, 0x39, 0xcf, 0x66, 0xbf, 0x01, 0x81, 0x51, 0xd0, 0x57, 0x62,
+    0x01, 0x81, 0x59, 0xd2, 0x4d, 0x7d, 0x01, 0x81, 0x69, 0xd3, 0x41, 0x86,
+    0x01, 0x81, 0xf1, 0xcf, 0x63, 0x86, 0x01, 0x81, 0xf9, 0x4b, 0x56, 0x03,
+    0x40, 0x6d, 0xf9, 0xc4, 0x5d, 0x73, 0x0f, 0x9b, 0x41, 0xc3, 0xac, 0x4d,
+    0x0f, 0xce, 0x50, 0xda, 0x1c, 0x88, 0x01, 0x12, 0x98, 0x4e, 0x71, 0x9e,
+    0x40, 0x6e, 0x2f, 0x42, 0x00, 0x3d, 0xc0, 0x6e, 0x41, 0x07, 0xc0, 0x6e,
+    0x50, 0xcb, 0x99, 0x0f, 0x0f, 0x9e, 0x09, 0x14, 0xc0, 0x6e, 0x5c, 0xc5,
+    0xdd, 0x5f, 0x0f, 0x99, 0x80, 0x0b, 0xc0, 0x6e, 0x66, 0x14, 0xc0, 0x6e,
+    0x70, 0x44, 0xe0, 0x40, 0xc0, 0x6e, 0x7c, 0x42, 0x03, 0xa9, 0x40, 0x6e,
+    0xa6, 0xc3, 0x01, 0x09, 0x01, 0x35, 0xb9, 0xc4, 0x7f, 0x6a, 0x01, 0x31,
+    0x39, 0xc4, 0xe0, 0xe0, 0x0f, 0xa0, 0xa1, 0xc5, 0xd4, 0x36, 0x0f, 0xa1,
+    0xf9, 0xc2, 0x15, 0xf7, 0x0f, 0xce, 0x92, 0x00, 0x6e, 0xc4, 0x48, 0xb9,
+    0x78, 0xc0, 0x6e, 0xca, 0xca, 0xa6, 0xf0, 0x0f, 0x9b, 0x59, 0xc7, 0xc9,
+    0x14, 0x0f, 0xcb, 0x10, 0xc3, 0x1a, 0x78, 0x0f, 0xd3, 0xe1, 0xca, 0xa5,
+    0x6a, 0x01, 0x05, 0x10, 0x44, 0x00, 0xb1, 0xc0, 0x6e, 0xd6, 0xc9, 0xac,
+    0xd3, 0x0f, 0xa9, 0x70, 0x42, 0x00, 0xca, 0xc0, 0x6e, 0xe2, 0xc6, 0xca,
+    0xe2, 0x0f, 0xa0, 0x51, 0xc2, 0x04, 0x68, 0x0f, 0xa2, 0x89, 0xc6, 0xca,
+    0x7c, 0x0f, 0xca, 0x80, 0xc8, 0xb6, 0x88, 0x0f, 0xa5, 0x99, 0xca, 0x39,
+    0xfd, 0x0f, 0x98, 0xc8, 0xcd, 0x7c, 0x2e, 0x0f, 0x9e, 0x78, 0xc8, 0xbb,
+    0x80, 0x0f, 0xcb, 0x59, 0xc2, 0x0b, 0x28, 0x0f, 0xb7, 0xb1, 0x42, 0x01,
+    0x0e, 0xc0, 0x6e, 0xf2, 0x50, 0x5e, 0x92, 0xc0, 0x6e, 0xfd, 0x06, 0x40,
+    0x6f, 0x7f, 0xc8, 0xb8, 0xb0, 0x01, 0x36, 0x81, 0x07, 0xc0, 0x6f, 0x89,
+    0x42, 0x00, 0x6d, 0xc0, 0x6f, 0x96, 0x11, 0xc0, 0x6f, 0xa5, 0x12, 0xc0,
+    0x6f, 0xaf, 0x14, 0xc0, 0x6f, 0xbb, 0x4b, 0x8b, 0xa5, 0x40, 0x6f, 0xc7,
+    0xc6, 0xd0, 0x52, 0x01, 0x32, 0x89, 0xc6, 0xca, 0xf4, 0x01, 0x71, 0xf8,
+    0xc5, 0xcb, 0xd9, 0x01, 0x31, 0x21, 0xc5, 0xd8, 0xcd, 0x01, 0x08, 0x30,
+    0xc9, 0x0a, 0x09, 0x01, 0x31, 0x09, 0x50, 0x5d, 0x32, 0x40, 0x70, 0x3f,
+    0xc3, 0x01, 0xdb, 0x0f, 0xa7, 0xbb, 0x00, 0x70, 0x4b, 0xc4, 0x29, 0x77,
+    0x0f, 0x9e, 0xa8, 0xc5, 0x7a, 0x2e, 0x0f, 0xa6, 0x29, 0xc9, 0xad, 0xea,
+    0x0f, 0xc8, 0xc8, 0xc5, 0x10, 0x8c, 0x0f, 0xa1, 0x8a, 0x00, 0x70, 0x51,
+    0xc4, 0xe2, 0x08, 0x0f, 0xcb, 0x29, 0x0d, 0x40, 0x70, 0x57, 0x47, 0x1f,
+    0xfc, 0xc0, 0x70, 0x63, 0xc2, 0x00, 0x3f, 0x01, 0x30, 0x21, 0x12, 0xc0,
+    0x70, 0xc9, 0x0f, 0x40, 0x70, 0xe1, 0x42, 0x00, 0x50, 0xc0, 0x70, 0xeb,
+    0xce, 0x70, 0xe8, 0x0f, 0xa4, 0x89, 0xcb, 0x98, 0xb7, 0x0f, 0xb6, 0x58,
+    0xc8, 0xba, 0x20, 0x01, 0x30, 0x61, 0x16, 0xc0, 0x70, 0xf7, 0xca, 0x9d,
+    0xf4, 0x01, 0x19, 0x91, 0x4a, 0x45, 0x46, 0xc0, 0x71, 0x0f, 0x08, 0xc0,
+    0x71, 0x1b, 0xce, 0x6c, 0xce, 0x0f, 0x9f, 0x51, 0xd5, 0x33, 0x2b, 0x01,
+    0x53, 0x68, 0xcb, 0x99, 0x04, 0x01, 0x12, 0xc1, 0xc2, 0x00, 0x52, 0x0f,
+    0xd5, 0xc1, 0xd2, 0x4d, 0x35, 0x01, 0x72, 0x78, 0xc2, 0x00, 0x47, 0x00,
+    0x01, 0xd3, 0x00, 0x71, 0x2d, 0xcd, 0x76, 0xb2, 0x0f, 0xa5, 0x28, 0x0b,
+    0xc0, 0x71, 0x31, 0xc7, 0xc5, 0xa2, 0x0f, 0x9a, 0xd0, 0x1b, 0xc0, 0x71,
+    0x3b, 0x44, 0x1c, 0x62, 0x40, 0x71, 0x47, 0xc5, 0x10, 0x8c, 0x0f, 0xa1,
+    0x70, 0x46, 0x87, 0xaa, 0xc0, 0x71, 0x65, 0xc6, 0xd1, 0x90, 0x0f, 0xa6,
+    0x58, 0xc7, 0x6e, 0x17, 0x0f, 0xc9, 0x09, 0x42, 0x00, 0x42, 0xc0, 0x71,
+    0x71, 0x42, 0x00, 0x3d, 0xc0, 0x71, 0x7d, 0xc2, 0x03, 0x9f, 0x01, 0x30,
+    0x0a, 0x00, 0x71, 0x89, 0xd3, 0x47, 0x04, 0x0f, 0xac, 0x09, 0x42, 0x06,
+    0x51, 0xc0, 0x71, 0x8f, 0xcf, 0x6a, 0x8e, 0x0f, 0x9e, 0xd8, 0x42, 0x00,
+    0x2f, 0xc0, 0x71, 0x9b, 0x17, 0x40, 0x71, 0xa5, 0xc8, 0xb7, 0xb8, 0x0f,
+    0x98, 0x30, 0xc3, 0xe5, 0xb6, 0x0f, 0xb6, 0x19, 0xc3, 0x00, 0x72, 0x0f,
+    0x9b, 0x70, 0x45, 0x00, 0x8d, 0xc0, 0x71, 0xb7, 0x51, 0x53, 0xff, 0xc0,
+    0x72, 0x07, 0x4d, 0x7c, 0x14, 0x40, 0x72, 0x19, 0x0e, 0xc0, 0x72, 0x33,
+    0xe0, 0x04, 0xe9, 0x01, 0x3b, 0x09, 0x14, 0x40, 0x72, 0x3f, 0x01, 0xc0,
+    0x72, 0x4b, 0xc4, 0x28, 0xfe, 0x0f, 0xce, 0x09, 0xc3, 0x5f, 0xe4, 0x01,
+    0x5f, 0x00, 0x42, 0x03, 0xe1, 0xc0, 0x72, 0x57, 0xc5, 0x00, 0x8c, 0x00,
+    0x05, 0x10, 0xc5, 0x00, 0x8c, 0x01, 0x05, 0xa9, 0xc3, 0x00, 0xe8, 0x00,
+    0x05, 0xc0, 0x50, 0x59, 0x12, 0xc0, 0x72, 0x63, 0x4d, 0x77, 0x9c, 0x40,
+    0x72, 0x71, 0x47, 0x01, 0x92, 0xc0, 0x72, 0xb5, 0x47, 0x0a, 0x3c, 0xc0,
+    0x72, 0xc7, 0x49, 0x09, 0x39, 0xc0, 0x72, 0xd3, 0xce, 0x70, 0x86, 0x00,
+    0x24, 0x11, 0xc6, 0x4a, 0xa1, 0x05, 0x33, 0xf1, 0xc7, 0xbf, 0xe4, 0x05,
+    0x33, 0xf8, 0x14, 0xc0, 0x72, 0xdf, 0x05, 0xc0, 0x72, 0xe9, 0x15, 0xc0,
+    0x73, 0x03, 0x12, 0xc0, 0x73, 0x27, 0x04, 0xc0, 0x73, 0x33, 0x16, 0xc0,
+    0x73, 0x49, 0x46, 0xa0, 0xc9, 0xc0, 0x73, 0x61, 0x06, 0xc0, 0x73, 0x6d,
+    0x0e, 0xc0, 0x73, 0x7f, 0x0a, 0xc0, 0x73, 0x8b, 0x0f, 0xc0, 0x73, 0x9d,
+    0x19, 0xc0, 0x73, 0xa5, 0x08, 0xc0, 0x73, 0xaf, 0x0c, 0xc0, 0x73, 0xbb,
+    0x07, 0xc0, 0x73, 0xc7, 0x44, 0xab, 0x4e, 0xc0, 0x73, 0xd9, 0xc3, 0x1e,
+    0x6b, 0x01, 0x75, 0xc9, 0x09, 0x40, 0x73, 0xe9, 0x96, 0x01, 0x8e, 0x03,
+    0x00, 0x73, 0xf5, 0xc2, 0x64, 0x57, 0x01, 0x8e, 0x09, 0xc2, 0xcd, 0x33,
+    0x01, 0x8e, 0x11, 0xc3, 0xe4, 0xc0, 0x01, 0x8e, 0x19, 0x95, 0x01, 0x8e,
+    0x8b, 0x00, 0x73, 0xf9, 0x8a, 0x01, 0x8e, 0x83, 0x00, 0x74, 0x13, 0x90,
+    0x01, 0x8e, 0x79, 0x92, 0x01, 0x8e, 0x93, 0x00, 0x74, 0x2b, 0x86, 0x01,
+    0x8e, 0xa1, 0x93, 0x01, 0x8f, 0x18, 0x01, 0xc0, 0x74, 0x37, 0x46, 0x00,
+    0x71, 0xc0, 0x74, 0x86, 0x1e, 0xc0, 0x74, 0xcd, 0xd5, 0x37, 0xc3, 0x01,
+    0x51, 0xe8, 0x01, 0xc0, 0x74, 0xe9, 0xc8, 0xb7, 0x00, 0x0f, 0xab, 0x69,
+    0xc9, 0xb4, 0xc5, 0x0f, 0xd4, 0x80, 0x47, 0x01, 0x7d, 0x40, 0x75, 0x0d,
+    0xc4, 0x17, 0x31, 0x0f, 0x9a, 0xc9, 0xc7, 0xbf, 0xb3, 0x0f, 0x9a, 0xc0,
+    0xd0, 0x3c, 0x1a, 0x01, 0x49, 0x81, 0xd0, 0x5a, 0xa2, 0x01, 0x49, 0x58,
+    0xc2, 0x00, 0x3f, 0x0f, 0xb4, 0x00, 0xd9, 0x1f, 0x7e, 0x0f, 0xc9, 0x19,
+    0x07, 0xc0, 0x75, 0x25, 0xc9, 0xb0, 0x18, 0x0f, 0xcf, 0xd8, 0x01, 0xc0,
+    0x75, 0x31, 0x4e, 0x70, 0x24, 0x40, 0x75, 0x3d, 0xd3, 0x19, 0xb7, 0x01,
+    0x3b, 0x39, 0xd8, 0x22, 0xed, 0x01, 0x3b, 0x29, 0xc9, 0xb0, 0xd5, 0x01,
+    0x09, 0xd1, 0xdd, 0x10, 0x6b, 0x01, 0x5e, 0x69, 0xd7, 0x2a, 0x84, 0x01,
+    0x5e, 0x78, 0x48, 0x52, 0xb0, 0xc0, 0x75, 0x5b, 0x15, 0xc0, 0x75, 0x80,
+    0xca, 0x91, 0x75, 0x08, 0x0c, 0x89, 0x06, 0xc0, 0x75, 0x8a, 0xce, 0x6b,
+    0xa8, 0x08, 0x0c, 0xb9, 0xc7, 0xc7, 0xe0, 0x08, 0x0c, 0xd1, 0xce, 0x6b,
+    0xee, 0x08, 0x0c, 0xd8, 0xc3, 0x01, 0x94, 0x0f, 0x9f, 0xa8, 0x45, 0xdb,
+    0x6b, 0xc0, 0x75, 0x9c, 0x44, 0x0d, 0x04, 0xc0, 0x75, 0xa8, 0x90, 0x01,
+    0x36, 0x32, 0x00, 0x75, 0xdc, 0x91, 0x0f, 0xa7, 0xdb, 0x00, 0x75, 0xe2,
+    0xd1, 0x53, 0x66, 0x01, 0x1d, 0xb8, 0xc2, 0x00, 0x46, 0x01, 0x11, 0xb0,
+    0x44, 0x00, 0xb1, 0xc0, 0x75, 0xee, 0xc4, 0xe0, 0xe8, 0x0f, 0xcc, 0xe8,
+    0xc5, 0x10, 0x8c, 0x0f, 0xa1, 0x80, 0x44, 0x04, 0x38, 0xc0, 0x75, 0xfa,
+    0xcd, 0x77, 0x82, 0x0f, 0xa4, 0xf0, 0x42, 0x00, 0x56, 0xc0, 0x76, 0x04,
+    0xc5, 0xd3, 0x8c, 0x01, 0x08, 0xf8, 0x43, 0x1e, 0xdb, 0xc0, 0x76, 0x10,
+    0xcd, 0x59, 0xc5, 0x00, 0x00, 0xf1, 0xd1, 0x51, 0x57, 0x0f, 0xb4, 0xc9,
+    0xc4, 0xe0, 0x7c, 0x0f, 0xcf, 0xf0, 0xc6, 0x07, 0xf3, 0x01, 0x1e, 0x71,
+    0xc4, 0x00, 0x2f, 0x01, 0x5c, 0x81, 0xc5, 0x00, 0x64, 0x01, 0x5c, 0x88,
+    0xc5, 0xd5, 0x94, 0x0f, 0x9a, 0x71, 0xcd, 0x75, 0x94, 0x0f, 0xcf, 0x38,
+    0x5d, 0x12, 0x1e, 0xc0, 0x76, 0x1c, 0xcb, 0x8e, 0x9e, 0x00, 0x05, 0x70,
+    0xcc, 0x46, 0xd2, 0x05, 0x4a, 0xf9, 0x18, 0xc0, 0x76, 0x84, 0x4f, 0x2c,
+    0x5c, 0xc0, 0x76, 0x90, 0x47, 0x01, 0x92, 0x40, 0x76, 0x9f, 0x49, 0x54,
+    0x43, 0xc0, 0x76, 0xff, 0x47, 0x37, 0xb8, 0xc0, 0x77, 0x0b, 0x46, 0x04,
+    0x99, 0x40, 0x77, 0x29, 0x43, 0x01, 0x8f, 0xc0, 0x77, 0x47, 0x10, 0x40,
+    0x77, 0x71, 0xc9, 0xab, 0x23, 0x01, 0x5f, 0x99, 0xc6, 0xbb, 0xca, 0x01,
+    0x5f, 0xa1, 0xc8, 0xba, 0x80, 0x01, 0x5f, 0xa9, 0xc8, 0xbb, 0xc8, 0x01,
+    0x5f, 0xb1, 0xc8, 0xb6, 0x60, 0x01, 0x5f, 0xb9, 0xc9, 0xb3, 0xd2, 0x01,
+    0x5f, 0xc0, 0x8f, 0x0f, 0xd5, 0x89, 0x42, 0x00, 0x6d, 0xc0, 0x77, 0x7d,
+    0xc6, 0xd0, 0x9a, 0x0f, 0xaf, 0xd1, 0xc9, 0xae, 0x9e, 0x0f, 0xb0, 0xf8,
+    0xc2, 0x00, 0x6b, 0x0f, 0xa3, 0x4b, 0x00, 0x77, 0x89, 0xca, 0xa6, 0xe6,
+    0x0f, 0xb5, 0xd0, 0x01, 0xc0, 0x77, 0x95, 0xdb, 0x15, 0x47, 0x01, 0x3d,
+    0x98, 0xcc, 0x8c, 0x34, 0x01, 0x33, 0xf9, 0xca, 0xa1, 0x6e, 0x01, 0x31,
+    0xc0, 0x46, 0x1c, 0x27, 0xc0, 0x77, 0xe7, 0x46, 0x08, 0x9f, 0xc0, 0x77,
+    0xf3, 0x4a, 0x05, 0xca, 0xc0, 0x77, 0xff, 0x4b, 0x02, 0xf9, 0xc0, 0x78,
+    0x1d, 0x4a, 0x02, 0xaa, 0xc0, 0x78, 0x3b, 0x48, 0x00, 0x6f, 0x40, 0x78,
+    0x59, 0x06, 0xc0, 0x78, 0x77, 0xc7, 0xc1, 0xf8, 0x0f, 0x9b, 0xb9, 0xc9,
+    0xa3, 0x77, 0x0f, 0xb0, 0x48, 0x42, 0x00, 0x2c, 0xc0, 0x78, 0x81, 0xc2,
+    0x11, 0x99, 0x01, 0x18, 0xd0, 0x44, 0xcd, 0x10, 0xc0, 0x78, 0x8b, 0x44,
+    0x00, 0xb1, 0x40, 0x78, 0xa3, 0xc9, 0xb3, 0x39, 0x01, 0x35, 0x01, 0x49,
+    0xac, 0x9d, 0x40, 0x78, 0xaf, 0x42, 0x00, 0x38, 0xc0, 0x78, 0xcd, 0x42,
+    0x00, 0x62, 0xc0, 0x78, 0xdd, 0x44, 0x00, 0xb1, 0x40, 0x78, 0xe9, 0xd3,
+    0x42, 0x57, 0x0f, 0x98, 0xa1, 0xd4, 0x39, 0xfa, 0x0f, 0x98, 0x90, 0xda,
+    0x14, 0xc1, 0x01, 0x3d, 0xe1, 0xc4, 0x09, 0x92, 0x0f, 0xa4, 0x90, 0xda,
+    0x1c, 0x54, 0x01, 0x08, 0xc1, 0xca, 0x9b, 0xc4, 0x0f, 0x9e, 0x58, 0xc4,
+    0x07, 0xe9, 0x0f, 0xb1, 0x49, 0xc8, 0x1a, 0xe8, 0x0f, 0xb2, 0x00, 0xcb,
+    0x97, 0x2b, 0x01, 0x12, 0x01, 0xc3, 0x1f, 0x35, 0x0f, 0xa9, 0x39, 0xc6,
+    0xcd, 0x64, 0x0f, 0xc9, 0xe0, 0x44, 0x00, 0xb1, 0x40, 0x78, 0xfb, 0xc5,
+    0xdb, 0x61, 0x0f, 0xcd, 0x49, 0x16, 0xc0, 0x79, 0x0d, 0xc9, 0xb3, 0x4b,
+    0x01, 0x37, 0x98, 0xc9, 0x19, 0xba, 0x01, 0x3b, 0x31, 0xc3, 0x00, 0x2b,
+    0x01, 0x34, 0xc3, 0x00, 0x79, 0x1f, 0xc8, 0x33, 0xf5, 0x0f, 0xa5, 0xf0,
+    0xc9, 0xaf, 0x13, 0x01, 0x34, 0xe1, 0xca, 0x9d, 0xe0, 0x0f, 0xa5, 0x50,
+    0x14, 0xc0, 0x79, 0x25, 0xc5, 0x00, 0xac, 0x01, 0x37, 0x90, 0xc3, 0x57,
+    0x3e, 0x01, 0x15, 0x49, 0xc4, 0x36, 0x87, 0x01, 0x10, 0x01, 0x0d, 0xc0,
+    0x79, 0x35, 0xc6, 0xb7, 0x62, 0x00, 0x00, 0x61, 0xcb, 0x95, 0x73, 0x0f,
+    0xcb, 0x00, 0xc2, 0x2c, 0x84, 0x0f, 0x98, 0x08, 0xc6, 0xbb, 0x42, 0x0f,
+    0xa3, 0x18, 0x42, 0x00, 0x62, 0xc0, 0x79, 0x4a, 0xcb, 0x8e, 0xf6, 0x01,
+    0x09, 0xd9, 0xc4, 0x86, 0xf7, 0x0f, 0x9f, 0x68, 0xc7, 0x3f, 0xb7, 0x0f,
+    0xa7, 0x01, 0xc4, 0xd8, 0x2e, 0x0f, 0xad, 0xb8, 0x0e, 0xc0, 0x79, 0x6c,
+    0xc4, 0xe0, 0x24, 0x0f, 0xce, 0x30, 0xca, 0x92, 0x67, 0x0f, 0xcb, 0xb1,
+    0x46, 0xca, 0x40, 0x40, 0x79, 0x78, 0x43, 0x03, 0x2b, 0xc0, 0x79, 0x84,
+    0xc2, 0x04, 0x68, 0x01, 0x19, 0x13, 0x00, 0x79, 0x90, 0xc6, 0x21, 0x57,
+    0x0f, 0xa1, 0xc0, 0x46, 0x00, 0x44, 0xc0, 0x79, 0x96, 0x48, 0x5d, 0x00,
+    0x40, 0x79, 0xa2, 0x01, 0xc0, 0x79, 0xb4, 0x46, 0x47, 0x6b, 0x40, 0x79,
+    0xcc, 0xc8, 0xb7, 0x18, 0x01, 0x35, 0x89, 0xd1, 0x4f, 0x15, 0x01, 0x03,
+    0x08, 0x9b, 0x01, 0x37, 0xa1, 0xc8, 0xb5, 0x20, 0x0f, 0x9d, 0x08, 0xc8,
+    0x1c, 0xe8, 0x01, 0x32, 0x01, 0xd7, 0x28, 0x73, 0x00, 0x05, 0x50, 0xc9,
+    0xb3, 0x0c, 0x0f, 0xb1, 0x41, 0xc4, 0x15, 0x4b, 0x0f, 0xd5, 0xb0, 0x43,
+    0x13, 0xb9, 0xc0, 0x7a, 0x2c, 0x87, 0x0f, 0xa9, 0x2a, 0x00, 0x7a, 0x41,
+    0x8a, 0x0f, 0xa0, 0xfb, 0x00, 0x7a, 0x53, 0xcd, 0x7e, 0x91, 0x0f, 0xa2,
+    0x50, 0xcb, 0x05, 0x1e, 0x01, 0x02, 0xc9, 0xc4, 0x01, 0x65, 0x01, 0x71,
+    0x68, 0xc4, 0x0e, 0x60, 0x01, 0x00, 0x91, 0xc5, 0x40, 0x51, 0x01, 0x00,
+    0x38, 0x42, 0x00, 0x62, 0xc0, 0x7a, 0x65, 0x42, 0x03, 0xa9, 0x40, 0x7a,
+    0x77, 0xc5, 0x17, 0x30, 0x0f, 0xd5, 0x48, 0x46, 0x50, 0xc1, 0xc0, 0x7a,
+    0x83, 0xc6, 0x41, 0xf2, 0x01, 0x05, 0x29, 0xc6, 0xce, 0xc6, 0x0f, 0x98,
+    0x60, 0x47, 0x01, 0x92, 0xc0, 0x7a, 0x8f, 0x45, 0x2a, 0xc0, 0xc0, 0x7a,
+    0xe9, 0x4b, 0x6e, 0xbb, 0xc0, 0x7b, 0x01, 0x45, 0x00, 0x8d, 0x40, 0x7b,
+    0x48, 0x01, 0xc0, 0x7b, 0x5a, 0x11, 0x40, 0x7b, 0x66, 0xd8, 0x26, 0x05,
+    0x01, 0x17, 0x79, 0x44, 0x01, 0x36, 0x40, 0x7b, 0x7e, 0x42, 0x10, 0x85,
+    0xc0, 0x7b, 0x8a, 0x0b, 0xc0, 0x7b, 0x94, 0x9b, 0x01, 0x4f, 0xf8, 0xc3,
+    0x09, 0x8c, 0x0f, 0xcd, 0xf1, 0xc3, 0x37, 0xea, 0x0f, 0xcd, 0xf8, 0x0b,
+    0xc0, 0x7b, 0xa6, 0x49, 0xb3, 0x81, 0x40, 0x7b, 0xb2, 0x91, 0x0f, 0xb4,
+    0x39, 0x45, 0x05, 0x6a, 0x40, 0x7b, 0xd2, 0x4b, 0x94, 0x34, 0xc0, 0x7b,
+    0xee, 0xd7, 0x29, 0xcc, 0x0f, 0xaa, 0x71, 0xc8, 0x46, 0x05, 0x0f, 0xb5,
+    0xc8, 0xc4, 0x5b, 0xa4, 0x01, 0x31, 0xf9, 0x46, 0xcd, 0xe8, 0xc0, 0x7c,
+    0x00, 0xc6, 0x17, 0x4c, 0x0f, 0xce, 0xe0, 0x46, 0xd0, 0xca, 0xc0, 0x7c,
+    0x0c, 0xc9, 0xab, 0x47, 0x0f, 0x9a, 0xb0, 0x18, 0xc0, 0x7c, 0x21, 0xd4,
+    0x3b, 0x76, 0x05, 0x57, 0xa1, 0xd8, 0x24, 0xcd, 0x05, 0x57, 0x99, 0x03,
+    0xc0, 0x7c, 0x2d, 0x46, 0xcc, 0x0e, 0xc0, 0x7c, 0x3f, 0x0e, 0xc0, 0x7c,
+    0x4b, 0x46, 0x04, 0x99, 0x40, 0x7c, 0x57, 0xc2, 0x00, 0x47, 0x0f, 0x9a,
+    0x41, 0xc9, 0x89, 0x67, 0x0f, 0xd7, 0x00, 0x42, 0x00, 0x4b, 0xc0, 0x7c,
+    0x7b, 0xcd, 0x71, 0x2f, 0x0f, 0xc9, 0xb0, 0x42, 0x00, 0x50, 0xc0, 0x7c,
+    0x8b, 0xc2, 0x00, 0x42, 0x0f, 0xa0, 0x0b, 0x00, 0x7c, 0x9a, 0xc2, 0x00,
+    0x60, 0x0f, 0xa2, 0x20, 0x11, 0xc0, 0x7c, 0x9e, 0x47, 0xc3, 0x72, 0xc0,
+    0x7c, 0xb0, 0x42, 0x18, 0xf5, 0xc0, 0x7c, 0xff, 0xc3, 0x20, 0xe3, 0x0f,
+    0xa0, 0x92, 0x00, 0x7d, 0x09, 0x0b, 0xc0, 0x7d, 0x0f, 0x07, 0xc0, 0x7d,
+    0x19, 0xcb, 0x95, 0xe1, 0x01, 0x50, 0x50, 0x87, 0x0f, 0xaa, 0x61, 0xc3,
+    0x1e, 0x37, 0x0f, 0xcc, 0xf8, 0x01, 0x40, 0x7d, 0x25, 0x42, 0x00, 0x48,
+    0xc0, 0x7d, 0x31, 0xc8, 0xb7, 0xc8, 0x0f, 0xaf, 0x80, 0x4a, 0x4a, 0x20,
+    0xc0, 0x7d, 0x3d, 0xc7, 0xc2, 0x6f, 0x0f, 0xce, 0x48, 0xc4, 0x28, 0x74,
+    0x0e, 0x97, 0x4b, 0x00, 0x7d, 0x69, 0x07, 0xc0, 0x7d, 0x6f, 0x15, 0xc0,
+    0x7d, 0x7e, 0x08, 0xc0, 0x7d, 0x90, 0x16, 0xc0, 0x7d, 0x9d, 0xc3, 0x05,
+    0x16, 0x0e, 0x97, 0x09, 0xc4, 0x18, 0xa7, 0x0e, 0x97, 0x00, 0xce, 0x6e,
+    0x3a, 0x08, 0xf7, 0xc1, 0xca, 0xa6, 0x0a, 0x08, 0xf7, 0xb9, 0x4b, 0x6e,
+    0xbb, 0xc0, 0x7d, 0xab, 0xc5, 0xcb, 0xf6, 0x08, 0xf7, 0x91, 0x47, 0x01,
+    0x92, 0x40, 0x7d, 0xbb, 0x4b, 0x96, 0x91, 0xc0, 0x7e, 0x17, 0xcd, 0x80,
+    0x17, 0x0f, 0x8d, 0x69, 0xd8, 0x22, 0x5d, 0x00, 0x05, 0xd1, 0xc6, 0xc1,
+    0xd6, 0x01, 0x81, 0xe0, 0x45, 0x43, 0x64, 0xc0, 0x7e, 0x31, 0xcc, 0x84,
+    0xa8, 0x01, 0x35, 0x69, 0xd1, 0x56, 0x41, 0x0f, 0xca, 0x58, 0xca, 0x9d,
+    0x2c, 0x01, 0x39, 0x01, 0x42, 0x00, 0x62, 0xc0, 0x7e, 0x4d, 0x47, 0xad,
+    0x2f, 0x40, 0x7e, 0x5f, 0xd6, 0x31, 0x9a, 0x01, 0x37, 0x79, 0xc7, 0xc9,
+    0x3e, 0x0f, 0x9a, 0x08, 0xc7, 0x61, 0x18, 0x01, 0x05, 0xe1, 0x48, 0xbb,
+    0xf0, 0xc0, 0x7e, 0x87, 0x01, 0xc0, 0x7e, 0xa5, 0xce, 0x6c, 0xa4, 0x0f,
+    0xab, 0x81, 0x45, 0xd6, 0xb1, 0xc0, 0x7e, 0xbd, 0xc2, 0x14, 0x10, 0x0f,
+    0xcb, 0x69, 0xce, 0x6d, 0xd8, 0x0f, 0xcd, 0xe9, 0xc6, 0xca, 0xdc, 0x0f,
+    0xa2, 0xf0, 0x46, 0xcd, 0x70, 0xc0, 0x7e, 0xdb, 0x4a, 0xa3, 0xbc, 0x40,
+    0x7e, 0xe9, 0x87, 0x0f, 0xce, 0xc9, 0xc3, 0x2a, 0x4a, 0x0f, 0xcf, 0x91,
+    0xc7, 0xc6, 0x74, 0x0f, 0xd4, 0x20, 0x42, 0x01, 0x8f, 0xc0, 0x7f, 0x2f,
+    0xc5, 0xdd, 0xd2, 0x0f, 0x9a, 0x20, 0x0b, 0xc0, 0x7f, 0x39, 0x44, 0x8d,
+    0x6d, 0x40, 0x7f, 0x4e, 0xcc, 0x06, 0x09, 0x01, 0x13, 0x59, 0xc9, 0x02,
+    0xa0, 0x01, 0x13, 0x50, 0xcb, 0x8c, 0xe6, 0x0b, 0x53, 0x79, 0xc4, 0x19,
+    0xf1, 0x0b, 0x53, 0x71, 0x45, 0x04, 0x9a, 0x40, 0x7f, 0x5a, 0x16, 0xc0,
+    0x7f, 0x7e, 0x14, 0xc0, 0x7f, 0x8e, 0x42, 0x00, 0xce, 0xc0, 0x7f, 0x96,
+    0xc2, 0x00, 0x89, 0x0b, 0x52, 0xdb, 0x00, 0x7f, 0x9e, 0x0d, 0xc0, 0x7f,
+    0xa2, 0x87, 0x0b, 0x52, 0xc3, 0x00, 0x7f, 0xb2, 0xc2, 0x00, 0x71, 0x0b,
+    0x52, 0xb9, 0xc3, 0x03, 0x90, 0x0b, 0x52, 0xa1, 0x91, 0x0b, 0x52, 0x93,
+    0x00, 0x7f, 0xb6, 0x12, 0xc0, 0x7f, 0xbe, 0x10, 0xc0, 0x7f, 0xc8, 0x0f,
+    0xc0, 0x7f, 0xd4, 0xc3, 0x23, 0x1b, 0x0b, 0x52, 0x59, 0xc2, 0x0e, 0x60,
+    0x0b, 0x52, 0x2b, 0x00, 0x7f, 0xe0, 0x83, 0x0b, 0x52, 0x31, 0xc2, 0x00,
+    0xa0, 0x0b, 0x52, 0x21, 0xc2, 0x31, 0xda, 0x0b, 0x52, 0x10, 0x44, 0x00,
+    0x8e, 0xc0, 0x7f, 0xe4, 0x46, 0x12, 0x2e, 0xc0, 0x80, 0x1c, 0x4a, 0x9e,
+    0x44, 0x40, 0x80, 0x38, 0x46, 0x01, 0x93, 0xc0, 0x80, 0x5c, 0x4f, 0x69,
+    0xda, 0x40, 0x80, 0xc6, 0xd4, 0x3a, 0x36, 0x05, 0x53, 0x81, 0xd2, 0x4c,
+    0xb7, 0x05, 0x4f, 0x30, 0x4f, 0x68, 0x36, 0xc0, 0x80, 0xd8, 0x54, 0x3e,
+    0x1e, 0x40, 0x80, 0xfc, 0xc7, 0xc4, 0xb4, 0x00, 0x81, 0x59, 0x03, 0xc0,
+    0x81, 0x08, 0x8b, 0x00, 0x81, 0x6b, 0x00, 0x81, 0x13, 0x97, 0x00, 0x81,
+    0x7b, 0x00, 0x81, 0x17, 0x87, 0x00, 0x81, 0x8b, 0x00, 0x81, 0x1b, 0x44,
+    0xb9, 0x50, 0xc0, 0x81, 0x21, 0x48, 0xaa, 0xd2, 0xc0, 0x81, 0x2b, 0x15,
+    0xc0, 0x81, 0x39, 0x52, 0x27, 0x1a, 0xc0, 0x81, 0x45, 0xcc, 0x87, 0x90,
+    0x00, 0x83, 0x89, 0x46, 0xd3, 0x7c, 0x40, 0x81, 0x51, 0x0f, 0xc0, 0x81,
+    0x61, 0xce, 0x71, 0x66, 0x00, 0x84, 0x10, 0xc4, 0x18, 0xa7, 0x00, 0x82,
+    0x01, 0xc3, 0x05, 0x16, 0x00, 0x82, 0x09, 0x16, 0xc0, 0x81, 0x6d, 0x08,
+    0xc0, 0x81, 0x79, 0x15, 0xc0, 0x81, 0x85, 0xc5, 0x0a, 0xfd, 0x00, 0x82,
+    0x41, 0xc4, 0x28, 0x74, 0x00, 0x82, 0x48, 0x05, 0xc0, 0x81, 0x91, 0xcc,
+    0x83, 0x58, 0x01, 0x08, 0x73, 0x00, 0x81, 0x9d, 0x1b, 0x40, 0x81, 0xa3,
+    0xc2, 0x00, 0x5d, 0x01, 0x32, 0x3b, 0x00, 0x81, 0xaf, 0x15, 0xc0, 0x81,
+    0xb5, 0xc4, 0x01, 0x3c, 0x0f, 0xd5, 0x00, 0xc9, 0xb4, 0x47, 0x0f, 0xcd,
+    0x79, 0xc7, 0xc9, 0x30, 0x01, 0x18, 0x29, 0x12, 0xc0, 0x81, 0xc4, 0xcc,
+    0x88, 0xa4, 0x0f, 0xb6, 0x39, 0xc7, 0xbf, 0xd6, 0x01, 0x5e, 0xc0, 0x10,
+    0xc0, 0x81, 0xd3, 0xc2, 0x00, 0xf1, 0x01, 0x01, 0x91, 0x42, 0x02, 0x63,
+    0x40, 0x81, 0xe0, 0xca, 0xa4, 0x98, 0x01, 0x1c, 0xb9, 0xc5, 0xbe, 0x3b,
+    0x01, 0x13, 0xd3, 0x00, 0x81, 0xec, 0x15, 0xc0, 0x81, 0xf0, 0x46, 0xca,
+    0xe8, 0xc0, 0x81, 0xfc, 0xc4, 0xde, 0xac, 0x0f, 0xcb, 0x40, 0x42, 0x11,
+    0x99, 0xc0, 0x82, 0x0e, 0xca, 0x0e, 0xa2, 0x01, 0x39, 0x79, 0x07, 0xc0,
+    0x82, 0x1a, 0xc3, 0x13, 0x88, 0x0f, 0xd4, 0x28, 0xc8, 0xb7, 0x58, 0x0f,
+    0xb7, 0xd8, 0xc3, 0x57, 0x3e, 0x01, 0x32, 0x99, 0xc3, 0x2d, 0x20, 0x0f,
+    0xa9, 0x58, 0xcd, 0x78, 0xd4, 0x01, 0x56, 0xd0, 0xc8, 0xb7, 0xf8, 0x0f,
+    0xa5, 0x49, 0x8e, 0x0f, 0xa4, 0x51, 0xc9, 0x8f, 0x50, 0x00, 0x05, 0xb0,
+    0x01, 0x40, 0x82, 0x26, 0xcc, 0x86, 0x58, 0x0f, 0xb6, 0x11, 0x49, 0xac,
+    0x1f, 0xc0, 0x82, 0x32, 0x07, 0x40, 0x82, 0x3e, 0x87, 0x0f, 0xae, 0x7b,
+    0x00, 0x82, 0x4a, 0xc3, 0x76, 0x91, 0x0f, 0xb6, 0xa0, 0xcc, 0x22, 0xbd,
+    0x08, 0xd7, 0xab, 0x00, 0x82, 0x56, 0x0e, 0xc0, 0x82, 0x5a, 0xce, 0x71,
+    0xe4, 0x08, 0xd7, 0x7b, 0x00, 0x82, 0x69, 0x47, 0xc2, 0xe6, 0xc0, 0x82,
+    0x6d, 0xcb, 0x57, 0x62, 0x08, 0xd7, 0x32, 0x00, 0x82, 0x7f, 0xc3, 0x00,
+    0xa5, 0x01, 0x35, 0xa1, 0x0f, 0x40, 0x82, 0x83, 0x16, 0xc0, 0x82, 0x93,
+    0x4b, 0x90, 0xf0, 0xc0, 0x82, 0xab, 0x03, 0xc0, 0x82, 0xcf, 0xc3, 0x2a,
+    0x40, 0x0f, 0xcc, 0xe0, 0x05, 0xc0, 0x82, 0xe1, 0x45, 0x00, 0x8d, 0xc0,
+    0x82, 0xed, 0x47, 0x37, 0xb8, 0xc0, 0x83, 0x25, 0x46, 0x04, 0x99, 0xc0,
+    0x83, 0x35, 0x49, 0xaa, 0x0c, 0xc0, 0x83, 0x59, 0x47, 0xc5, 0x4e, 0x40,
+    0x83, 0x6b, 0xc7, 0xc6, 0x6d, 0x0f, 0xa1, 0xe1, 0xc5, 0xd4, 0xd6, 0x0f,
+    0xca, 0xf0, 0x03, 0xc0, 0x83, 0x83, 0xc8, 0x5b, 0x8a, 0x0f, 0x9b, 0x91,
+    0xc9, 0xb1, 0x6e, 0x0f, 0xd5, 0xa0, 0x45, 0x01, 0x50, 0xc0, 0x83, 0x8f,
+    0xc8, 0xb9, 0xe0, 0x0f, 0x9a, 0xb9, 0xc7, 0x43, 0x47, 0x00, 0x05, 0x19,
+    0xcb, 0x91, 0xc1, 0x0f, 0xd6, 0xb9, 0xc2, 0x11, 0x99, 0x0f, 0xa2, 0xe8,
+    0x15, 0xc0, 0x83, 0x9b, 0x42, 0x00, 0x47, 0x40, 0x83, 0xa7, 0xcf, 0x5d,
+    0xf3, 0x01, 0x18, 0xb1, 0x16, 0xc0, 0x83, 0xb3, 0xc5, 0xd6, 0x1b, 0x01,
+    0x5f, 0x38, 0x4d, 0x7f, 0x13, 0xc0, 0x83, 0xbf, 0xc4, 0x13, 0x4c, 0x0f,
+    0x9b, 0xf8, 0xc3, 0x63, 0x50, 0x0f, 0xb4, 0x9b, 0x00, 0x83, 0xcb, 0xc7,
+    0xc2, 0xbc, 0x0f, 0xa3, 0x70, 0xca, 0x84, 0x7a, 0x01, 0x3e, 0x13, 0x00,
+    0x83, 0xd1, 0x15, 0xc0, 0x83, 0xd7, 0xd1, 0x56, 0x63, 0x01, 0x33, 0xf1,
+    0x01, 0xc0, 0x83, 0xe9, 0xcc, 0x8a, 0xfc, 0x0f, 0x9d, 0x69, 0xc9, 0x90,
+    0x00, 0x00, 0x01, 0x28, 0xc3, 0xb3, 0xd7, 0x01, 0x38, 0x79, 0xc6, 0x17,
+    0x0c, 0x01, 0x37, 0x21, 0xd6, 0x31, 0x2c, 0x0f, 0xac, 0x31, 0xc9, 0xae,
+    0x20, 0x0f, 0xb0, 0xa1, 0xc4, 0xe0, 0xf4, 0x0f, 0xa1, 0x38, 0x05, 0xc0,
+    0x83, 0xfb, 0x94, 0x0f, 0x9a, 0x81, 0xc4, 0xe2, 0x70, 0x0f, 0xca, 0xe0,
+    0xc6, 0xa3, 0x84, 0x01, 0x05, 0x89, 0xc8, 0xbb, 0xe0, 0x01, 0x05, 0x38,
+    0xcb, 0x97, 0x0a, 0x01, 0x00, 0x41, 0xcf, 0x68, 0xcc, 0x01, 0x72, 0x70,
+    0xc9, 0xb3, 0x54, 0x0f, 0xa4, 0xe1, 0xc2, 0x00, 0x42, 0x0f, 0xa2, 0xd8,
+    0x16, 0xc0, 0x84, 0x0b, 0xc3, 0x05, 0x16, 0x08, 0x5d, 0x4b, 0x00, 0x84,
+    0x1b, 0xc4, 0x04, 0x9f, 0x08, 0x5d, 0x60, 0xc3, 0x01, 0xa5, 0x08, 0x5c,
+    0xe1, 0xc5, 0x0d, 0x22, 0x08, 0x5c, 0xd8, 0xc3, 0x6e, 0xe0, 0x08, 0x5c,
+    0x89, 0x15, 0xc0, 0x84, 0x21, 0xc2, 0x00, 0x78, 0x08, 0x5c, 0x71, 0xc3,
+    0x20, 0xb0, 0x08, 0x5c, 0x61, 0xc8, 0xb5, 0x08, 0x08, 0x5c, 0x59, 0xc6,
+    0xd0, 0xf4, 0x08, 0x5c, 0x51, 0xc4, 0xe0, 0x58, 0x08, 0x5c, 0x49, 0xc4,
+    0x4e, 0x09, 0x08, 0x5c, 0x41, 0xc2, 0x00, 0x61, 0x08, 0x5c, 0x23, 0x00,
+    0x84, 0x2b, 0xc5, 0x4e, 0x03, 0x08, 0x5c, 0x31, 0xcd, 0x76, 0xe6, 0x08,
+    0x5c, 0x29, 0xc6, 0x46, 0x53, 0x08, 0x5c, 0x19, 0xc5, 0x9b, 0xd8, 0x08,
+    0x5c, 0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x5c, 0x09, 0xc5, 0x9f, 0x89, 0x08,
+    0x5c, 0x00, 0xd2, 0x4d, 0x8f, 0x00, 0xb9, 0xb1, 0xd2, 0x48, 0xd9, 0x00,
+    0xb9, 0xa8, 0x48, 0xbb, 0x28, 0xc0, 0x84, 0x31, 0xc3, 0x23, 0xe0, 0x01,
+    0x5e, 0xd8, 0x46, 0xd2, 0x6e, 0xc0, 0x84, 0x43, 0x50, 0x57, 0x72, 0x40,
+    0x84, 0x59, 0xc7, 0xc3, 0xdb, 0x0f, 0xa8, 0xf9, 0xc5, 0x58, 0x4d, 0x01,
+    0x19, 0x42, 0x00, 0x84, 0xad, 0x01, 0xc0, 0x84, 0xb3, 0x4a, 0x0d, 0xbc,
+    0x40, 0x84, 0xd1, 0xcb, 0x8f, 0xb1, 0x08, 0x85, 0xeb, 0x00, 0x84, 0xe9,
+    0x4b, 0x6e, 0xbb, 0xc0, 0x84, 0xef, 0x06, 0xc0, 0x85, 0x0f, 0x15, 0xc0,
+    0x85, 0x1b, 0xd0, 0x5b, 0xd2, 0x08, 0x85, 0xe1, 0xd1, 0x4f, 0x8c, 0x08,
+    0x85, 0xd9, 0x47, 0x01, 0x92, 0x40, 0x85, 0x27, 0x45, 0x00, 0x8d, 0xc0,
+    0x85, 0x8e, 0x45, 0x2a, 0xc0, 0xc0, 0x85, 0x9a, 0x46, 0x35, 0x43, 0xc0,
+    0x85, 0xa9, 0x47, 0x01, 0x92, 0xc0, 0x85, 0xbb, 0x46, 0x04, 0x99, 0x40,
+    0x86, 0x21, 0x45, 0xc6, 0x6b, 0xc0, 0x86, 0x45, 0x09, 0x40, 0x86, 0x63,
+    0x46, 0x04, 0x99, 0xc0, 0x86, 0x6f, 0x45, 0x00, 0x8d, 0xc0, 0x86, 0x93,
+    0x4b, 0x6e, 0xbb, 0xc0, 0x86, 0xa5, 0x47, 0x01, 0x92, 0x40, 0x86, 0xbf,
+    0x15, 0xc0, 0x87, 0x26, 0xd1, 0x4f, 0x8c, 0x08, 0x91, 0xe9, 0x06, 0xc0,
+    0x87, 0x32, 0xce, 0x74, 0x3e, 0x08, 0x91, 0xd1, 0x4b, 0x6e, 0xbb, 0xc0,
+    0x87, 0x3e, 0x47, 0x01, 0x92, 0x40, 0x87, 0x55, 0x15, 0xc0, 0x87, 0xb8,
+    0x46, 0x04, 0x99, 0xc0, 0x87, 0xc4, 0xd4, 0x3b, 0xc6, 0x00, 0xbe, 0xd9,
+    0x46, 0x35, 0x43, 0xc0, 0x87, 0xe8, 0x52, 0x49, 0xe7, 0xc0, 0x87, 0xf4,
+    0x47, 0x01, 0x92, 0x40, 0x88, 0x0a, 0x4c, 0x10, 0x43, 0xc0, 0x88, 0x54,
+    0xd1, 0x54, 0x43, 0x08, 0x52, 0x41, 0x47, 0x37, 0xb8, 0xc0, 0x88, 0x6c,
+    0x46, 0x04, 0x99, 0xc0, 0x88, 0x76, 0x18, 0xc0, 0x88, 0x86, 0x45, 0x00,
+    0x8d, 0xc0, 0x88, 0x92, 0x47, 0x01, 0x92, 0x40, 0x88, 0xb0, 0xc5, 0x01,
+    0x64, 0x0f, 0xa4, 0x59, 0x44, 0x00, 0xb1, 0x40, 0x89, 0x06, 0xc4, 0x07,
+    0xe9, 0x0f, 0xb1, 0xa9, 0xc6, 0x07, 0xf3, 0x0f, 0xa5, 0x58, 0x48, 0x81,
+    0x1c, 0xc0, 0x89, 0x15, 0x43, 0x04, 0x9c, 0x40, 0x89, 0x2e, 0x51, 0x4f,
+    0xbf, 0xc0, 0x89, 0x5e, 0x53, 0x46, 0xb8, 0x40, 0x89, 0x70, 0x03, 0xc0,
+    0x89, 0x7c, 0xdb, 0x15, 0x11, 0x01, 0x1c, 0x11, 0xcb, 0x8c, 0x6d, 0x0f,
+    0xcb, 0xc0, 0xcb, 0x90, 0xcf, 0x01, 0x35, 0x71, 0x49, 0xad, 0x48, 0xc0,
+    0x89, 0x88, 0x0b, 0x40, 0x89, 0xba, 0x46, 0xce, 0x18, 0xc0, 0x89, 0xcc,
+    0xce, 0x72, 0x2a, 0x0f, 0xb7, 0x90, 0xd7, 0x2a, 0x28, 0x01, 0x1c, 0x99,
+    0xc3, 0x00, 0xbc, 0x0f, 0x9d, 0x78, 0x0f, 0xc0, 0x89, 0xe4, 0xc6, 0x20,
+    0xc6, 0x00, 0x05, 0x40, 0x12, 0xc0, 0x89, 0xf0, 0xca, 0xa1, 0x0a, 0x0f,
+    0xc9, 0x21, 0xcc, 0x89, 0xac, 0x0f, 0xa1, 0x50, 0xdc, 0x14, 0x4f, 0x01,
+    0x3c, 0xd9, 0xc9, 0x94, 0x0a, 0x01, 0x05, 0x79, 0xc3, 0x1a, 0x6b, 0x0f,
+    0xa0, 0x4a, 0x00, 0x89, 0xfc, 0x44, 0x00, 0x71, 0xc0, 0x8a, 0x02, 0x01,
+    0xc0, 0x8a, 0x0e, 0x4a, 0x01, 0x4b, 0x40, 0x8a, 0x29, 0x4a, 0x00, 0x4a,
+    0xc0, 0x8a, 0x3b, 0x48, 0x03, 0xc1, 0x40, 0x8a, 0x47, 0x43, 0x00, 0xdb,
+    0xc0, 0x8a, 0x53, 0xc5, 0xdc, 0x79, 0x0f, 0x9b, 0x48, 0x44, 0x02, 0x21,
+    0xc0, 0x8a, 0x61, 0x01, 0x40, 0x8a, 0x87, 0x43, 0x07, 0x46, 0xc0, 0x8a,
+    0x9f, 0xc5, 0x10, 0x8c, 0x0f, 0xa1, 0xb0, 0x4b, 0x95, 0x1b, 0xc0, 0x8a,
+    0xb7, 0xc7, 0xbd, 0xd0, 0x01, 0x14, 0x0b, 0x00, 0x8a, 0xc6, 0x42, 0x04,
+    0x82, 0xc0, 0x8a, 0xcc, 0xc5, 0xdd, 0x5a, 0x01, 0x15, 0x71, 0xc6, 0x06,
+    0xb2, 0x01, 0x11, 0x22, 0x00, 0x8a, 0xdb, 0x46, 0x00, 0x91, 0x40, 0x8a,
+    0xe1, 0xc8, 0x00, 0x89, 0x00, 0x01, 0x21, 0xc4, 0x6a, 0x6e, 0x0f, 0xa1,
+    0x60, 0xcc, 0x87, 0x30, 0x01, 0x30, 0x59, 0x45, 0xda, 0x80, 0xc0, 0x8a,
+    0xf0, 0x42, 0x00, 0x2c, 0x40, 0x8a, 0xfc, 0x0b, 0xc0, 0x8b, 0x09, 0xd6,
+    0x2e, 0xae, 0x0f, 0xae, 0xd8, 0x49, 0x06, 0xbd, 0xc0, 0x8b, 0x15, 0xd1,
+    0x54, 0x76, 0x01, 0x1e, 0x53, 0x00, 0x8b, 0x21, 0xd3, 0x40, 0xb5, 0x01,
+    0x1e, 0x4a, 0x00, 0x8b, 0x27, 0xcb, 0x8d, 0x8b, 0x01, 0x12, 0xe1, 0xc3,
+    0x25, 0x8c, 0x00, 0x03, 0xf9, 0xcb, 0x91, 0xa0, 0x0f, 0xb4, 0xd0, 0xca,
+    0xa7, 0x7c, 0x01, 0x08, 0x49, 0xc7, 0xc5, 0x55, 0x01, 0x08, 0x19, 0xc4,
+    0x00, 0x8d, 0x00, 0x05, 0x80, 0x48, 0xae, 0x69, 0xc0, 0x8b, 0x2d, 0x4c,
+    0x77, 0x35, 0x40, 0x8b, 0x61, 0xdd, 0x11, 0x8d, 0x0d, 0xe4, 0xf9, 0xcb,
+    0x99, 0x51, 0x0d, 0xe4, 0xf1, 0xd5, 0x32, 0x1a, 0x0d, 0xe4, 0xe9, 0xd1,
+    0x54, 0xa9, 0x0d, 0xe4, 0xe1, 0x46, 0xcd, 0x94, 0xc0, 0x8b, 0x77, 0x47,
+    0x01, 0x92, 0x40, 0x8b, 0x93, 0x43, 0x01, 0xc9, 0xc0, 0x8c, 0x30, 0x01,
+    0x40, 0x8c, 0x42, 0xc4, 0x04, 0x45, 0x01, 0x2c, 0x99, 0xc9, 0xad, 0x09,
+    0x0f, 0xab, 0xb0, 0x01, 0x40, 0x8c, 0x4e, 0xc3, 0x39, 0x93, 0x0f, 0xa4,
+    0x19, 0xc2, 0x14, 0x10, 0x0f, 0x9b, 0x08, 0x16, 0xc0, 0x8c, 0x5a, 0xc3,
+    0xe6, 0x07, 0x01, 0x5e, 0xe0, 0x44, 0x01, 0xdc, 0xc0, 0x8c, 0x66, 0xc2,
+    0x00, 0x2c, 0x01, 0x35, 0x90, 0xc6, 0x6f, 0x68, 0x0f, 0xa7, 0x81, 0x42,
+    0x02, 0x68, 0xc0, 0x8c, 0x72, 0x01, 0xc0, 0x8c, 0xaa, 0x45, 0x00, 0xdf,
+    0x40, 0x8c, 0xc2, 0x44, 0x0c, 0xf7, 0xc0, 0x8c, 0xce, 0x4d, 0x7b, 0x85,
+    0x40, 0x8c, 0xe6, 0xc9, 0x2a, 0x36, 0x01, 0x5e, 0x48, 0xc4, 0x9f, 0xd0,
+    0x01, 0x1c, 0xc1, 0xc4, 0x00, 0xdf, 0x00, 0x04, 0x28, 0x03, 0xc0, 0x8c,
+    0xec, 0x51, 0x51, 0x68, 0xc0, 0x8c, 0xf8, 0x4e, 0x6c, 0x34, 0x40, 0x8d,
+    0x04, 0x48, 0xbf, 0x18, 0x40, 0x8d, 0x10, 0xc2, 0x00, 0x89, 0x01, 0x10,
+    0x39, 0x47, 0xc8, 0xea, 0x40, 0x8d, 0x28, 0xc7, 0x7a, 0xd5, 0x01, 0x05,
+    0x31, 0xc8, 0xbb, 0x60, 0x0f, 0xa4, 0x28, 0xcc, 0x5c, 0x56, 0x01, 0x03,
+    0x71, 0xc4, 0xb4, 0xd0, 0x0f, 0x9e, 0xf0, 0x1e, 0xc0, 0x8d, 0x3a, 0xc7,
+    0xc4, 0xbb, 0x01, 0x56, 0xe8, 0x42, 0x00, 0x60, 0xc0, 0x8d, 0x46, 0xcf,
+    0x4a, 0x44, 0x01, 0x15, 0x93, 0x00, 0x8d, 0x50, 0xcd, 0x7f, 0x2d, 0x01,
+    0x05, 0xd8, 0x45, 0x84, 0x57, 0xc0, 0x8d, 0x56, 0x01, 0xc0, 0x8d, 0x66,
+    0x87, 0x0f, 0xae, 0x42, 0x00, 0x8d, 0x9f, 0xd9, 0x1e, 0x9d, 0x0f, 0xa8,
+    0xf1, 0xc5, 0x52, 0x1d, 0x01, 0x36, 0xa3, 0x00, 0x8d, 0xae, 0x12, 0xc0,
+    0x8d, 0xb4, 0xcd, 0x47, 0x0b, 0x0f, 0xa7, 0xa9, 0x04, 0xc0, 0x8d, 0xc0,
+    0xce, 0x74, 0xbc, 0x0f, 0xb5, 0x68, 0xd0, 0x5c, 0x52, 0x01, 0x03, 0x79,
+    0xc8, 0xba, 0x98, 0x08, 0x0c, 0x70, 0xcc, 0x80, 0x64, 0x0f, 0x0a, 0x71,
+    0x46, 0x01, 0x93, 0x40, 0x8d, 0xcc, 0xc4, 0x28, 0x74, 0x0f, 0x0a, 0x49,
+    0xc5, 0x0a, 0xfd, 0x0f, 0x0a, 0x41, 0x15, 0xc0, 0x8e, 0x4e, 0x08, 0xc0,
+    0x8e, 0x5a, 0x16, 0xc0, 0x8e, 0x66, 0xc3, 0x05, 0x16, 0x0f, 0x0a, 0x09,
+    0xc4, 0x18, 0xa7, 0x0f, 0x0a, 0x00, 0xd2, 0x48, 0x25, 0x0f, 0x09, 0xe9,
+    0x44, 0x00, 0x8e, 0x40, 0x8e, 0x72, 0x86, 0x0f, 0x09, 0xb1, 0x89, 0x0f,
+    0x09, 0xa9, 0x95, 0x0f, 0x09, 0xa1, 0x98, 0x0f, 0x09, 0x99, 0x8c, 0x0f,
+    0x09, 0x91, 0x8f, 0x0f, 0x09, 0x89, 0x84, 0x0f, 0x09, 0x80, 0x44, 0x03,
+    0xb3, 0xc0, 0x8e, 0x7e, 0xc8, 0xaa, 0x8b, 0x01, 0x08, 0xb0, 0x4f, 0x6b,
+    0x60, 0x40, 0x8e, 0x94, 0xc2, 0x00, 0x4b, 0x01, 0x16, 0x09, 0xc3, 0x00,
+    0x6b, 0x01, 0x16, 0x00, 0xc8, 0x65, 0xe5, 0x01, 0x10, 0x89, 0x46, 0x1f,
+    0xa2, 0x40, 0x8e, 0xa0, 0xc8, 0x27, 0x6e, 0x01, 0x10, 0x81, 0x47, 0x1d,
+    0x5f, 0x40, 0x8e, 0xac, 0xca, 0x9b, 0x1a, 0x00, 0x3f, 0xf1, 0xc9, 0xad,
+    0x24, 0x00, 0x3f, 0xe9, 0x45, 0x04, 0x9a, 0x40, 0x8e, 0xbe, 0xc9, 0xab,
+    0xd7, 0x00, 0x3f, 0xd1, 0xd2, 0x4b, 0xdf, 0x00, 0x3f, 0xa9, 0x46, 0x01,
+    0x93, 0x40, 0x8e, 0xe2, 0xc2, 0x00, 0xb6, 0x00, 0x3f, 0xc1, 0x47, 0x1f,
+    0xfc, 0x40, 0x8f, 0x62, 0xca, 0x9b, 0x88, 0x00, 0x3f, 0xb9, 0xc9, 0xa8,
+    0x4a, 0x00, 0x3f, 0xb0, 0xc7, 0xc8, 0xc0, 0x0f, 0xd3, 0x69, 0xc7, 0xc4,
+    0x6e, 0x0f, 0xd3, 0x39, 0xc8, 0xb7, 0x88, 0x0f, 0xd3, 0x41, 0xc8, 0xb8,
+    0xd8, 0x0f, 0xd3, 0x49, 0xc5, 0xa2, 0x77, 0x0f, 0xd3, 0x51, 0x05, 0x40,
+    0x8f, 0x7a, 0xc5, 0xa2, 0x77, 0x0f, 0xd3, 0x19, 0xc7, 0xc4, 0x6e, 0x0f,
+    0xd3, 0x01, 0xc8, 0xb7, 0x88, 0x0f, 0xd3, 0x09, 0xc8, 0xb8, 0xd8, 0x0f,
+    0xd3, 0x11, 0x05, 0xc0, 0x8f, 0x86, 0xc7, 0xc8, 0xc0, 0x0f, 0xd3, 0x30,
+    0x4a, 0xa7, 0x40, 0xc0, 0x8f, 0x92, 0x5a, 0x1b, 0x84, 0x40, 0x8f, 0xaa,
+    0xcc, 0x88, 0x68, 0x01, 0x1c, 0x19, 0x43, 0x17, 0xfb, 0x40, 0x8f, 0xc0,
+    0xc4, 0x0e, 0x60, 0x01, 0x00, 0xa1, 0xc5, 0x40, 0x51, 0x01, 0x00, 0x19,
+    0xc4, 0x06, 0x5b, 0x01, 0x00, 0x08, 0xc2, 0x00, 0x60, 0x01, 0x32, 0x0b,
+    0x00, 0x8f, 0xdc, 0x01, 0x40, 0x8f, 0xe2, 0x07, 0xc0, 0x8f, 0xee, 0x04,
+    0xc0, 0x8f, 0xf8, 0x11, 0xc0, 0x90, 0x04, 0x0b, 0xc0, 0x90, 0x0e, 0x0a,
+    0xc0, 0x90, 0x18, 0x18, 0xc0, 0x90, 0x24, 0x03, 0xc0, 0x90, 0x2e, 0x42,
+    0xe6, 0x10, 0xc0, 0x90, 0x38, 0x43, 0xe5, 0xb9, 0xc0, 0x90, 0x40, 0x43,
+    0xe5, 0xec, 0xc0, 0x90, 0x63, 0x42, 0xcf, 0x79, 0xc0, 0x90, 0x8c, 0x42,
+    0xe2, 0xe7, 0xc0, 0x90, 0x98, 0x42, 0xe2, 0xf3, 0xc0, 0x90, 0xac, 0x42,
+    0xe6, 0x46, 0xc0, 0x90, 0xbc, 0x42, 0xe6, 0x42, 0xc0, 0x90, 0xd0, 0x43,
+    0xe5, 0x8c, 0xc0, 0x90, 0xdc, 0x42, 0xe6, 0x48, 0xc0, 0x90, 0xf8, 0x10,
+    0xc0, 0x91, 0x00, 0x42, 0xe6, 0x4c, 0xc0, 0x91, 0x10, 0x43, 0xe5, 0x7d,
+    0xc0, 0x91, 0x24, 0x43, 0xe5, 0x71, 0xc0, 0x91, 0x4a, 0x42, 0xe6, 0x18,
+    0xc0, 0x91, 0x6a, 0x42, 0xe4, 0xc4, 0xc0, 0x91, 0x82, 0x42, 0xcf, 0x55,
+    0xc0, 0x91, 0x9a, 0x42, 0xe6, 0x12, 0x40, 0x91, 0xb6, 0x14, 0xc0, 0x91,
+    0xc2, 0x59, 0x10, 0x17, 0x40, 0x91, 0xce, 0xc3, 0x00, 0xc9, 0x01, 0x11,
+    0xc9, 0x49, 0x0e, 0xf0, 0x40, 0x91, 0xf2, 0x48, 0x13, 0x20, 0xc0, 0x91,
+    0xfe, 0x07, 0x40, 0x92, 0x52, 0x0f, 0xc0, 0x92, 0x5e, 0xc3, 0x0d, 0xc9,
+    0x00, 0x9b, 0x28, 0xcc, 0x85, 0x44, 0x00, 0x9b, 0x31, 0xd2, 0x44, 0x92,
+    0x00, 0x9b, 0x40, 0xc3, 0x05, 0x16, 0x00, 0x9b, 0x49, 0x16, 0xc0, 0x92,
+    0x6a, 0x08, 0xc0, 0x92, 0x76, 0x15, 0xc0, 0x92, 0x82, 0xc5, 0x0a, 0xfd,
+    0x00, 0x9b, 0x81, 0xc4, 0x28, 0x74, 0x00, 0x9b, 0x88, 0x16, 0xc0, 0x92,
+    0x8e, 0x08, 0xc0, 0x92, 0xa3, 0x15, 0xc0, 0x92, 0xaf, 0xc6, 0xcf, 0x44,
+    0x00, 0x9b, 0xc9, 0xc6, 0x2a, 0x48, 0x00, 0x9b, 0xd1, 0xc7, 0x0c, 0xe7,
+    0x00, 0x9b, 0xd8, 0xc5, 0xd5, 0x4e, 0x00, 0x9c, 0x81, 0x06, 0xc0, 0x92,
+    0xbb, 0xc6, 0x86, 0x22, 0x00, 0x9c, 0x91, 0xcc, 0x86, 0x1c, 0x00, 0x9c,
+    0x99, 0x0d, 0xc0, 0x92, 0xca, 0xc6, 0xcd, 0x0a, 0x00, 0x9c, 0xb1, 0xc5,
+    0xd3, 0x77, 0x00, 0x9c, 0xb8, 0xc7, 0x82, 0x85, 0x01, 0x10, 0x43, 0x00,
+    0x92, 0xd6, 0x45, 0xd4, 0xf9, 0xc0, 0x92, 0xda, 0xc5, 0xb8, 0xdb, 0x0f,
+    0xa0, 0xc1, 0xc5, 0xd9, 0x86, 0x0f, 0xb6, 0xb8, 0xd2, 0x4d, 0xfb, 0x08,
+    0x7f, 0xb1, 0x46, 0x01, 0x93, 0x40, 0x92, 0xe4, 0x83, 0x08, 0x28, 0x01,
+    0xc2, 0x01, 0x24, 0x08, 0x28, 0x09, 0x05, 0xc0, 0x93, 0x47, 0x06, 0xc0,
+    0x93, 0x51, 0x10, 0xc0, 0x93, 0x5b, 0x87, 0x08, 0x28, 0x43, 0x00, 0x93,
+    0x6f, 0xc2, 0x15, 0x48, 0x08, 0x28, 0x49, 0x09, 0xc0, 0x93, 0x73, 0xc2,
+    0x00, 0x61, 0x08, 0x28, 0x61, 0x8b, 0x08, 0x28, 0x69, 0xc2, 0x19, 0x48,
+    0x08, 0x28, 0x71, 0x0d, 0xc0, 0x93, 0x81, 0x0e, 0xc0, 0x93, 0x8b, 0xc2,
+    0x00, 0xf1, 0x08, 0x28, 0x91, 0x91, 0x08, 0x28, 0xb1, 0xc2, 0x00, 0x78,
+    0x08, 0x28, 0xb9, 0xc2, 0x90, 0x0c, 0x08, 0x28, 0xc1, 0x14, 0xc0, 0x93,
+    0x95, 0x15, 0xc0, 0x93, 0x9f, 0x16, 0xc0, 0x93, 0xa9, 0x97, 0x08, 0x28,
+    0xf9, 0xc2, 0x00, 0x98, 0x08, 0x29, 0x01, 0xc2, 0x38, 0xf3, 0x08, 0x29,
+    0x09, 0x9b, 0x08, 0x29, 0x11, 0x1c, 0x40, 0x93, 0xb3, 0x42, 0x00, 0xbe,
+    0xc0, 0x93, 0xbd, 0x12, 0xc0, 0x93, 0xc3, 0xcf, 0x17, 0x39, 0x01, 0x39,
+    0x98, 0x46, 0x00, 0x91, 0x40, 0x93, 0xcf, 0x43, 0x02, 0xd5, 0xc0, 0x93,
+    0xdb, 0xda, 0x1c, 0x06, 0x0f, 0xa8, 0xd0, 0xc4, 0x0e, 0x60, 0x01, 0x00,
+    0x99, 0xc5, 0x40, 0x51, 0x01, 0x00, 0x11, 0xc4, 0x06, 0x5b, 0x01, 0x00,
+    0x00, 0xc4, 0x00, 0x2f, 0x01, 0x19, 0x59, 0xc5, 0x00, 0x64, 0x01, 0x19,
+    0x30, 0x46, 0x06, 0x64, 0xc0, 0x93, 0xfd, 0x46, 0x00, 0xbb, 0x40, 0x94,
+    0x0f, 0xc3, 0x05, 0x16, 0x01, 0x5f, 0x81, 0xc3, 0x01, 0xa1, 0x01, 0x5f,
+    0x88, 0x01, 0xc0, 0x94, 0x21, 0x42, 0x00, 0x5b, 0x40, 0x94, 0x2d, 0xca,
+    0x9a, 0x0c, 0x01, 0x12, 0xd1, 0x47, 0x34, 0x33, 0x40, 0x94, 0x42, 0x95,
+    0x01, 0x12, 0xc9, 0xc8, 0x19, 0xf6, 0x01, 0x09, 0x70, 0xc5, 0x00, 0x8c,
+    0x01, 0x05, 0x61, 0xce, 0x70, 0x94, 0x01, 0x05, 0x01, 0x45, 0xd4, 0x86,
+    0x40, 0x94, 0x4e, 0xc6, 0xd1, 0x00, 0x0f, 0xcd, 0x71, 0xc3, 0x0d, 0xf5,
+    0x0f, 0x9d, 0xc0, 0x46, 0x04, 0x99, 0xc0, 0x94, 0x5a, 0xc2, 0x04, 0x0d,
+    0x08, 0xec, 0xc1, 0x18, 0xc0, 0x94, 0x7e, 0x45, 0x00, 0x8d, 0xc0, 0x94,
+    0x8a, 0x47, 0x01, 0x92, 0x40, 0x94, 0x96, 0xc8, 0x8d, 0x6d, 0x01, 0x05,
+    0x91, 0xc5, 0xd6, 0xca, 0x0f, 0xa4, 0x10, 0x45, 0x00, 0x8d, 0xc0, 0x95,
+    0x03, 0x47, 0x01, 0x92, 0xc0, 0x95, 0x27, 0x4b, 0x6e, 0xbb, 0xc0, 0x95,
+    0x9c, 0x46, 0x04, 0x99, 0xc0, 0x95, 0xba, 0xc5, 0xd6, 0x07, 0x00, 0x53,
+    0x81, 0x03, 0xc0, 0x95, 0xde, 0xc3, 0x02, 0x52, 0x00, 0x53, 0x91, 0xc3,
+    0x07, 0x45, 0x00, 0x53, 0x99, 0xc8, 0xb9, 0x10, 0x00, 0x53, 0xa0, 0x45,
+    0x00, 0x8d, 0xc0, 0x95, 0xea, 0x47, 0x01, 0x92, 0xc0, 0x96, 0x0c, 0x46,
+    0x35, 0x43, 0xc0, 0x96, 0x77, 0xc2, 0x04, 0x0d, 0x00, 0x56, 0x81, 0x46,
+    0x04, 0x99, 0xc0, 0x96, 0x83, 0xd1, 0x4f, 0x8c, 0x00, 0x57, 0x81, 0xca,
+    0x7c, 0xb3, 0x00, 0x57, 0x88, 0x96, 0x0f, 0xa0, 0x81, 0xc5, 0xdc, 0x2e,
+    0x0f, 0xca, 0x28, 0xc4, 0xe0, 0xc0, 0x08, 0x19, 0x99, 0x03, 0xc0, 0x96,
+    0xa7, 0xc8, 0xb6, 0x98, 0x08, 0x19, 0xa9, 0x0b, 0xc0, 0x96, 0xb3, 0x0a,
+    0xc0, 0x96, 0xbf, 0x16, 0xc0, 0x96, 0xcb, 0xc3, 0x9b, 0x54, 0x08, 0x19,
+    0xc9, 0xc5, 0xdb, 0x25, 0x08, 0x19, 0xd1, 0xc5, 0xdc, 0x1a, 0x08, 0x19,
+    0xd9, 0xc5, 0x8b, 0x2c, 0x08, 0x19, 0xe1, 0x10, 0xc0, 0x96, 0xd7, 0xc3,
+    0xaf, 0x49, 0x08, 0x19, 0xf1, 0xc4, 0xde, 0x9d, 0x08, 0x19, 0xf9, 0xc8,
+    0xb6, 0xe8, 0x08, 0x1a, 0x01, 0xc5, 0xd3, 0x91, 0x08, 0x1a, 0x11, 0xc5,
+    0xdb, 0xb6, 0x08, 0x1a, 0x19, 0xc5, 0xd4, 0x04, 0x08, 0x1a, 0x29, 0xc5,
+    0xdd, 0x0f, 0x08, 0x1a, 0x31, 0xc5, 0xd4, 0x45, 0x08, 0x1a, 0x49, 0xc7,
+    0xc1, 0x81, 0x08, 0x19, 0x89, 0xc4, 0xe1, 0x74, 0x08, 0x19, 0x90, 0x07,
+    0xc0, 0x96, 0xe3, 0x4a, 0x06, 0x0c, 0x40, 0x96, 0xef, 0x45, 0xdc, 0xec,
+    0xc0, 0x97, 0x16, 0xcb, 0x98, 0xc2, 0x0f, 0x9c, 0x99, 0xc3, 0x31, 0x40,
+    0x0f, 0x9a, 0x39, 0xc9, 0x20, 0x56, 0x00, 0x03, 0x00, 0xca, 0xa2, 0x40,
+    0x0f, 0xa4, 0xb9, 0x43, 0x10, 0xf4, 0x40, 0x97, 0x34, 0xcb, 0x93, 0x79,
+    0x0f, 0xb1, 0x61, 0x46, 0x8c, 0xb1, 0x40, 0x97, 0x40, 0x45, 0x00, 0x91,
+    0x40, 0x97, 0x4f, 0xc3, 0x00, 0xaf, 0x01, 0x32, 0x51, 0xc6, 0xac, 0xa9,
+    0x0f, 0xa4, 0x70, 0x46, 0x47, 0x1a, 0xc0, 0x97, 0x5b, 0x46, 0x91, 0x13,
+    0x40, 0x97, 0x67, 0x8e, 0x0f, 0xa3, 0x3b, 0x00, 0x97, 0x85, 0xc9, 0xab,
+    0x6b, 0x0f, 0xcc, 0x90, 0xc9, 0xaf, 0xac, 0x0f, 0x98, 0xf9, 0xd1, 0x56,
+    0x0e, 0x0f, 0x98, 0x81, 0xc3, 0x46, 0x35, 0x0f, 0xcf, 0x20, 0xca, 0xa3,
+    0x08, 0x0f, 0xca, 0xd9, 0x48, 0x57, 0x53, 0x40, 0x97, 0x8b, 0xc4, 0xde,
+    0xd8, 0x0f, 0xcd, 0x39, 0x42, 0x00, 0x62, 0x40, 0x97, 0x97, 0xc8, 0x29,
+    0x5c, 0x01, 0x15, 0xb1, 0x43, 0x31, 0x98, 0x40, 0x97, 0xa3, 0xd0, 0x1e,
+    0xb6, 0x07, 0xe9, 0xf1, 0xd1, 0x1a, 0x32, 0x07, 0xe9, 0xf8, 0x47, 0x37,
+    0xb8, 0xc0, 0x97, 0xcb, 0x4d, 0x54, 0x43, 0xc0, 0x97, 0xf2, 0xc8, 0xb6,
+    0xb8, 0x0f, 0x69, 0x71, 0x51, 0x52, 0x01, 0x40, 0x97, 0xfe, 0xc4, 0xde,
+    0xb4, 0x0f, 0xb4, 0xb1, 0xc3, 0x23, 0xad, 0x0f, 0xb4, 0x69, 0xca, 0x9b,
+    0x74, 0x0f, 0xb4, 0xa1, 0xca, 0x9d, 0x72, 0x0f, 0xb4, 0xc1, 0xcb, 0x93,
+    0xc6, 0x0f, 0xb7, 0x88, 0x01, 0xc0, 0x98, 0x16, 0xcf, 0x67, 0x19, 0x0f,
+    0xd3, 0x88, 0xe0, 0x01, 0x69, 0x0f, 0xa8, 0xd8, 0x10, 0xc0, 0x98, 0x22,
+    0xd5, 0x33, 0x7f, 0x00, 0x04, 0xe8, 0xc6, 0xd1, 0xd2, 0x01, 0x19, 0x29,
+    0xc8, 0xbc, 0x60, 0x0f, 0xa5, 0xfa, 0x00, 0x98, 0x2a, 0x01, 0xc0, 0x98,
+    0x30, 0x43, 0x00, 0x2c, 0x40, 0x98, 0x66, 0x12, 0xc0, 0x98, 0x78, 0xc4,
+    0x14, 0x16, 0x00, 0xe3, 0xe9, 0xc5, 0xd4, 0x6d, 0x00, 0xe3, 0xd9, 0x42,
+    0x14, 0x12, 0xc0, 0x98, 0x84, 0xd0, 0x56, 0x97, 0x00, 0xe3, 0xc9, 0x47,
+    0x01, 0x92, 0xc0, 0x98, 0x90, 0x46, 0x04, 0x99, 0x40, 0x98, 0xa8, 0x46,
+    0x0c, 0xcf, 0xc0, 0x98, 0xcc, 0xc8, 0xbb, 0xb0, 0x0f, 0xa7, 0x20, 0x06,
+    0xc0, 0x98, 0xe4, 0x05, 0xc0, 0x98, 0xf0, 0xcf, 0x68, 0xdb, 0x01, 0x22,
+    0x39, 0x04, 0xc0, 0x98, 0xfc, 0xcd, 0x79, 0x63, 0x01, 0x22, 0x19, 0xc4,
+    0x4b, 0x61, 0x01, 0x22, 0x11, 0xc4, 0x06, 0x45, 0x01, 0x22, 0x00, 0xc4,
+    0xe2, 0x74, 0x0f, 0xa0, 0xc9, 0xcb, 0x98, 0x5f, 0x0f, 0xb6, 0x88, 0x4e,
+    0x74, 0xca, 0xc0, 0x99, 0x0e, 0xc6, 0x58, 0x02, 0x01, 0x72, 0xe8, 0xc3,
+    0x00, 0xe0, 0x01, 0x01, 0xf1, 0xc2, 0x04, 0xf8, 0x0f, 0xae, 0xba, 0x00,
+    0x99, 0x1a, 0xd5, 0x37, 0x1b, 0x00, 0xb4, 0xe1, 0xcc, 0x37, 0x24, 0x00,
+    0xb4, 0xd9, 0x47, 0x01, 0x92, 0xc0, 0x99, 0x20, 0xca, 0xa3, 0x30, 0x00,
+    0xb4, 0x00, 0x47, 0x01, 0x92, 0xc0, 0x99, 0x7a, 0x46, 0x04, 0x99, 0x40,
+    0x99, 0xfd, 0x4f, 0x09, 0x39, 0xc0, 0x9a, 0x21, 0x4d, 0x28, 0xa7, 0x40,
+    0x9a, 0x88, 0x12, 0xc0, 0x9a, 0xef, 0xc5, 0xda, 0x76, 0x0e, 0x7e, 0x11,
+    0x06, 0xc0, 0x9b, 0x00, 0x11, 0xc0, 0x9b, 0x16, 0x0d, 0xc0, 0x9b, 0x25,
+    0x15, 0xc0, 0x9b, 0x43, 0xc6, 0xd2, 0x3e, 0x0e, 0x7d, 0x3b, 0x00, 0x9b,
+    0x56, 0x1c, 0xc0, 0x9b, 0x5a, 0xc4, 0xe1, 0x30, 0x0e, 0x7c, 0x19, 0x14,
+    0xc0, 0x9b, 0x64, 0x42, 0x11, 0x99, 0xc0, 0x9b, 0x70, 0x49, 0xb3, 0xae,
+    0xc0, 0x9b, 0x7c, 0x4a, 0x9c, 0x0a, 0x40, 0x9b, 0x9a, 0xc3, 0x24, 0xef,
+    0x0e, 0x7a, 0x31, 0xc5, 0x7e, 0xc7, 0x0e, 0x7a, 0x29, 0xce, 0x70, 0x40,
+    0x0e, 0x7a, 0x21, 0x46, 0xd1, 0x4e, 0x40, 0x9b, 0xb0, 0xdb, 0x18, 0x8c,
+    0x0e, 0x7a, 0x09, 0x45, 0x01, 0x69, 0xc0, 0x9b, 0xb8, 0xd7, 0x29, 0xfa,
+    0x0e, 0x79, 0xf1, 0x51, 0x52, 0x89, 0x40, 0x9c, 0x0a, 0xc8, 0xbe, 0x68,
+    0x08, 0xd2, 0x39, 0x44, 0x00, 0x8e, 0x40, 0x9c, 0x1c, 0x46, 0x36, 0x37,
+    0xc0, 0x9c, 0x2e, 0x46, 0x27, 0xa6, 0x40, 0x9c, 0x3a, 0xd6, 0x2c, 0xe0,
+    0x08, 0xd2, 0x29, 0xc9, 0x17, 0x63, 0x08, 0xd1, 0xf8, 0xca, 0xa4, 0x84,
+    0x08, 0xd2, 0x21, 0xcb, 0x99, 0x25, 0x08, 0xd2, 0x19, 0xc4, 0x02, 0xea,
+    0x08, 0xd2, 0x11, 0xc5, 0x33, 0x0b, 0x08, 0xd2, 0x08, 0x0d, 0xc0, 0x9c,
+    0x46, 0xc2, 0x00, 0xce, 0x08, 0xd1, 0x89, 0x15, 0xc0, 0x9c, 0x56, 0xc2,
+    0x02, 0x63, 0x08, 0xd1, 0x69, 0xc2, 0x00, 0x89, 0x08, 0xd1, 0x61, 0xc2,
+    0x00, 0x3b, 0x08, 0xd1, 0x59, 0xc2, 0x1a, 0x18, 0x08, 0xd1, 0x51, 0xc2,
+    0x1e, 0x12, 0x08, 0xd1, 0x49, 0x1c, 0xc0, 0x9c, 0x66, 0x06, 0xc0, 0x9c,
+    0x70, 0x16, 0xc0, 0x9c, 0x82, 0xc2, 0x00, 0xb6, 0x08, 0xd1, 0x11, 0x04,
+    0xc0, 0x9c, 0x94, 0x12, 0xc0, 0x9c, 0x9e, 0x10, 0xc0, 0x9c, 0xa8, 0xc2,
+    0x21, 0x7d, 0x08, 0xd0, 0x91, 0x05, 0xc0, 0x9c, 0xbe, 0x09, 0xc0, 0x9c,
+    0xc8, 0x83, 0x08, 0xd0, 0x00, 0xcb, 0x35, 0x6c, 0x08, 0xd0, 0x51, 0x45,
+    0x00, 0x8d, 0x40, 0x9c, 0xd2, 0x46, 0xcc, 0x1a, 0xc0, 0x9c, 0xf2, 0xc3,
+    0x3d, 0xe2, 0x01, 0x4c, 0x08, 0x45, 0x01, 0x79, 0xc0, 0x9c, 0xfc, 0xd5,
+    0x37, 0xed, 0x01, 0x51, 0xf1, 0xd4, 0x3e, 0xe6, 0x01, 0x53, 0x28, 0xcf,
+    0x61, 0xd3, 0x01, 0x4c, 0x49, 0xcd, 0x7f, 0x20, 0x01, 0x4c, 0x38, 0xc6,
+    0x58, 0xbc, 0x01, 0x00, 0x69, 0x42, 0x00, 0x10, 0xc0, 0x9d, 0x08, 0xc5,
+    0x40, 0x51, 0x01, 0x00, 0x58, 0xcb, 0x94, 0x8c, 0x01, 0x37, 0xd9, 0xd3,
+    0x3f, 0x85, 0x0f, 0xa9, 0x81, 0xc6, 0xcb, 0x00, 0x0f, 0xa3, 0xd1, 0xc4,
+    0xc1, 0x9e, 0x0f, 0xa3, 0xc9, 0xcb, 0x99, 0x30, 0x0f, 0x9f, 0x19, 0xc5,
+    0xac, 0xe0, 0x0f, 0x9c, 0x71, 0xc6, 0xcd, 0x7c, 0x0f, 0x9f, 0x79, 0xda,
+    0x19, 0xe4, 0x01, 0x80, 0x20, 0x42, 0x04, 0xf2, 0xc0, 0x9d, 0x14, 0x42,
+    0x00, 0x2f, 0xc0, 0x9d, 0x20, 0x46, 0x04, 0x99, 0xc0, 0x9d, 0x2c, 0xd3,
+    0x46, 0x0d, 0x05, 0x4e, 0x69, 0xcf, 0x62, 0xb4, 0x05, 0x4e, 0x11, 0x4f,
+    0x2c, 0x5c, 0xc0, 0x9d, 0x50, 0x4b, 0x6e, 0xbb, 0xc0, 0x9d, 0x62, 0x45,
+    0x00, 0x8d, 0x40, 0x9d, 0x84, 0x44, 0x06, 0x60, 0xc0, 0x9d, 0x9f, 0x45,
+    0x41, 0xfd, 0x40, 0x9d, 0xab, 0xd0, 0x0e, 0xed, 0x01, 0x02, 0x41, 0xc4,
+    0x01, 0x65, 0x00, 0x01, 0xf8, 0x49, 0x13, 0x1f, 0xc0, 0x9d, 0xb7, 0x48,
+    0x8e, 0x49, 0x40, 0x9e, 0x30, 0x47, 0x01, 0x92, 0xc0, 0x9e, 0x82, 0xd0,
+    0x58, 0x02, 0x08, 0x75, 0x69, 0x4a, 0x57, 0x0d, 0x40, 0x9f, 0x07, 0xa4,
+    0x07, 0xf0, 0x73, 0x00, 0x9f, 0x13, 0xa0, 0x07, 0xf0, 0x53, 0x00, 0x9f,
+    0x3b, 0x9f, 0x07, 0xf0, 0x4b, 0x00, 0x9f, 0x63, 0xa8, 0x70, 0x08, 0x13,
+    0x00, 0x9f, 0x8b, 0xa7, 0x70, 0x08, 0x0b, 0x00, 0x9f, 0xb3, 0xa6, 0x70,
+    0x08, 0x03, 0x00, 0x9f, 0xdb, 0xa5, 0x07, 0xf0, 0x7b, 0x00, 0xa0, 0x03,
+    0xa3, 0x07, 0xf0, 0x6b, 0x00, 0xa0, 0x2b, 0xa2, 0x07, 0xf0, 0x63, 0x00,
+    0xa0, 0x53, 0xa1, 0x07, 0xf0, 0x5a, 0x00, 0xa0, 0x7b, 0xa4, 0x70, 0x08,
+    0x43, 0x00, 0xa0, 0xa3, 0xa3, 0x70, 0x08, 0x3b, 0x00, 0xa0, 0xbf, 0xa2,
+    0x70, 0x08, 0x33, 0x00, 0xa0, 0xe7, 0xa1, 0x70, 0x08, 0x2b, 0x00, 0xa1,
+    0x0f, 0xa0, 0x70, 0x08, 0x23, 0x00, 0xa1, 0x37, 0x9f, 0x70, 0x08, 0x1b,
+    0x00, 0xa1, 0x5f, 0xa8, 0x70, 0x08, 0x61, 0xa7, 0x70, 0x08, 0x59, 0xa6,
+    0x70, 0x08, 0x51, 0xa5, 0x70, 0x08, 0x48, 0xa8, 0x70, 0x0a, 0x91, 0xa7,
+    0x70, 0x0a, 0x89, 0xa6, 0x70, 0x0a, 0x81, 0xa5, 0x70, 0x0a, 0x79, 0xa4,
+    0x70, 0x0a, 0x71, 0xa3, 0x70, 0x0a, 0x69, 0xa2, 0x70, 0x0a, 0x61, 0xa1,
+    0x70, 0x0a, 0x59, 0xa0, 0x70, 0x0a, 0x51, 0x9f, 0x70, 0x0a, 0x48, 0xa8,
+    0x70, 0x0a, 0x41, 0xa7, 0x70, 0x0a, 0x39, 0xa6, 0x70, 0x0a, 0x31, 0xa5,
+    0x70, 0x0a, 0x29, 0xa4, 0x70, 0x0a, 0x21, 0xa3, 0x70, 0x0a, 0x19, 0xa2,
+    0x70, 0x0a, 0x11, 0xa1, 0x70, 0x0a, 0x09, 0xa0, 0x70, 0x0a, 0x01, 0x9f,
+    0x70, 0x09, 0xf8, 0xa8, 0x70, 0x09, 0xf1, 0xa7, 0x70, 0x09, 0xe9, 0xa6,
+    0x70, 0x09, 0xe1, 0xa5, 0x70, 0x09, 0xd9, 0xa4, 0x70, 0x09, 0xd1, 0xa3,
+    0x70, 0x09, 0xc9, 0xa2, 0x70, 0x09, 0xc1, 0xa1, 0x70, 0x09, 0xb9, 0xa0,
+    0x70, 0x09, 0xb1, 0x9f, 0x70, 0x09, 0xa8, 0xa8, 0x70, 0x09, 0xa1, 0xa7,
+    0x70, 0x09, 0x99, 0xa6, 0x70, 0x09, 0x91, 0xa5, 0x70, 0x09, 0x89, 0xa4,
+    0x70, 0x09, 0x81, 0xa3, 0x70, 0x09, 0x79, 0xa2, 0x70, 0x09, 0x71, 0xa1,
+    0x70, 0x09, 0x69, 0xa0, 0x70, 0x09, 0x61, 0x9f, 0x70, 0x09, 0x58, 0xa8,
+    0x70, 0x09, 0x51, 0xa7, 0x70, 0x09, 0x49, 0xa6, 0x70, 0x09, 0x41, 0xa5,
+    0x70, 0x09, 0x39, 0xa4, 0x70, 0x09, 0x31, 0xa3, 0x70, 0x09, 0x29, 0xa2,
+    0x70, 0x09, 0x21, 0xa1, 0x70, 0x09, 0x19, 0xa0, 0x70, 0x09, 0x11, 0x9f,
+    0x70, 0x09, 0x08, 0xa8, 0x70, 0x09, 0x01, 0xa7, 0x70, 0x08, 0xf9, 0xa6,
+    0x70, 0x08, 0xf1, 0xa5, 0x70, 0x08, 0xe9, 0xa4, 0x70, 0x08, 0xe1, 0xa3,
+    0x70, 0x08, 0xd9, 0xa2, 0x70, 0x08, 0xd1, 0xa1, 0x70, 0x08, 0xc9, 0xa0,
+    0x70, 0x08, 0xc1, 0x9f, 0x70, 0x08, 0xb8, 0xa8, 0x70, 0x08, 0xb1, 0xa7,
+    0x70, 0x08, 0xa9, 0xa6, 0x70, 0x08, 0xa1, 0xa5, 0x70, 0x08, 0x99, 0xa4,
+    0x70, 0x08, 0x91, 0xa3, 0x70, 0x08, 0x89, 0xa2, 0x70, 0x08, 0x81, 0xa1,
+    0x70, 0x08, 0x79, 0xa0, 0x70, 0x08, 0x71, 0x9f, 0x70, 0x08, 0x68, 0x47,
+    0x13, 0x21, 0xc0, 0xa1, 0x87, 0x45, 0x12, 0x2f, 0x40, 0xa1, 0xf6, 0xc4,
+    0x18, 0xa7, 0x05, 0x31, 0x01, 0xc3, 0x05, 0x16, 0x05, 0x31, 0x09, 0x16,
+    0xc0, 0xa2, 0x18, 0x08, 0xc0, 0xa2, 0x24, 0x15, 0xc0, 0xa2, 0x30, 0xc5,
+    0x0a, 0xfd, 0x05, 0x31, 0x41, 0xc4, 0x28, 0x74, 0x05, 0x31, 0x48, 0x51,
+    0x51, 0x24, 0xc0, 0xa2, 0x3c, 0x44, 0x02, 0xca, 0xc0, 0xa2, 0x54, 0xd5,
+    0x33, 0xfd, 0x01, 0x35, 0x41, 0xc4, 0x00, 0xdf, 0x00, 0x03, 0xe3, 0x00,
+    0xa2, 0x6c, 0xc8, 0x26, 0x15, 0x01, 0x17, 0x71, 0xc9, 0x3c, 0xcf, 0x01,
+    0x02, 0xf1, 0xcb, 0x94, 0x76, 0x01, 0x4c, 0xd1, 0x16, 0xc0, 0xa2, 0x70,
+    0xc8, 0xba, 0x10, 0x01, 0x71, 0xe9, 0x4c, 0x88, 0xf8, 0xc0, 0xa2, 0x82,
+    0xda, 0x1a, 0x4c, 0x01, 0x81, 0xd8, 0x46, 0x10, 0xe4, 0xc0, 0xa2, 0x94,
+    0xd0, 0x5f, 0x82, 0x0f, 0xbd, 0x29, 0x45, 0xdc, 0x10, 0x40, 0xa2, 0xb6,
+    0xdc, 0x13, 0xfb, 0x00, 0xe7, 0xd1, 0x03, 0xc0, 0xa2, 0xc2, 0xcb, 0x98,
+    0x33, 0x00, 0xe7, 0xb1, 0xcb, 0x92, 0xf5, 0x00, 0xe7, 0xa9, 0x14, 0xc0,
+    0xa2, 0xd4, 0xcd, 0x2e, 0xf9, 0x00, 0xe7, 0x79, 0xd6, 0x2e, 0xf0, 0x00,
+    0xe7, 0x71, 0xc6, 0xcf, 0x0e, 0x00, 0xe7, 0x69, 0x48, 0x5d, 0x1a, 0xc0,
+    0xa2, 0xe6, 0xda, 0x1a, 0x18, 0x00, 0xe6, 0xa1, 0xc9, 0xb1, 0xad, 0x00,
+    0xe6, 0x98, 0x42, 0x00, 0xd8, 0xc0, 0xa2, 0xfe, 0x42, 0x00, 0x4c, 0xc0,
+    0xa3, 0x0a, 0x47, 0xc3, 0xbf, 0xc0, 0xa3, 0x16, 0xe0, 0x03, 0x49, 0x00,
+    0xe7, 0x09, 0x16, 0xc0, 0xa3, 0x22, 0x42, 0x02, 0x4d, 0xc0, 0xa3, 0x34,
+    0x4b, 0x1a, 0x18, 0xc0, 0xa3, 0x40, 0xc7, 0xc2, 0x7d, 0x00, 0xe6, 0x91,
+    0xc5, 0xdb, 0x84, 0x00, 0xe6, 0x88, 0xc4, 0xe1, 0x23, 0x0b, 0x7f, 0x89,
+    0xc2, 0x03, 0xc6, 0x0b, 0x7f, 0x80, 0xc6, 0xa4, 0x4c, 0x0f, 0xa7, 0xc9,
+    0xc4, 0xe1, 0x88, 0x0f, 0x9d, 0x70, 0x83, 0x08, 0x2b, 0x81, 0x04, 0xc0,
+    0xa3, 0x55, 0x05, 0xc0, 0xa3, 0x5f, 0x06, 0xc0, 0xa3, 0x69, 0x87, 0x08,
+    0x2b, 0xc3, 0x00, 0xa3, 0x73, 0xc2, 0x15, 0x48, 0x08, 0x2b, 0xc9, 0xc2,
+    0x00, 0xeb, 0x08, 0x2b, 0xd1, 0x0a, 0xc0, 0xa3, 0x77, 0x8b, 0x08, 0x2b,
+    0xf3, 0x00, 0xa3, 0x81, 0xc2, 0x19, 0x48, 0x08, 0x2c, 0x01, 0x0e, 0xc0,
+    0xa3, 0x87, 0xc2, 0x00, 0xf1, 0x08, 0x2c, 0x21, 0x10, 0xc0, 0xa3, 0x91,
+    0x91, 0x08, 0x2c, 0x39, 0xc2, 0x00, 0x78, 0x08, 0x2c, 0x41, 0xc2, 0x0f,
+    0xba, 0x08, 0x2c, 0x49, 0x15, 0xc0, 0xa3, 0x9b, 0x16, 0xc0, 0xa3, 0xa5,
+    0x97, 0x08, 0x2c, 0x81, 0x9b, 0x08, 0x2c, 0xa1, 0xc2, 0x0a, 0x44, 0x08,
+    0x2c, 0xa9, 0xc2, 0x02, 0x4d, 0x08, 0x2c, 0x09, 0xc2, 0x03, 0xe1, 0x08,
+    0x2c, 0x51, 0xc2, 0x00, 0x98, 0x08, 0x2c, 0x89, 0xc2, 0x38, 0xf3, 0x08,
+    0x2c, 0x90, 0x83, 0x08, 0x2c, 0xb9, 0x04, 0xc0, 0xa3, 0xaf, 0x05, 0xc0,
+    0xa3, 0xb9, 0x06, 0xc0, 0xa3, 0xc3, 0x87, 0x08, 0x2c, 0xfb, 0x00, 0xa3,
+    0xcd, 0xc2, 0x15, 0x48, 0x08, 0x2d, 0x01, 0xc2, 0x00, 0xeb, 0x08, 0x2d,
+    0x09, 0x0a, 0xc0, 0xa3, 0xd1, 0x8b, 0x08, 0x2d, 0x2b, 0x00, 0xa3, 0xdb,
+    0xc2, 0x19, 0x48, 0x08, 0x2d, 0x39, 0xc2, 0x02, 0x4d, 0x08, 0x2d, 0x41,
+    0x0e, 0xc0, 0xa3, 0xe1, 0xc2, 0x00, 0xf1, 0x08, 0x2d, 0x59, 0x10, 0xc0,
+    0xa3, 0xeb, 0x91, 0x08, 0x2d, 0x71, 0xc2, 0x00, 0x78, 0x08, 0x2d, 0x79,
+    0xc2, 0x0f, 0xba, 0x08, 0x2d, 0x81, 0xc2, 0x03, 0xe1, 0x08, 0x2d, 0x89,
+    0x15, 0xc0, 0xa3, 0xf5, 0x16, 0xc0, 0xa3, 0xff, 0x97, 0x08, 0x2d, 0xb9,
+    0xc2, 0x00, 0x98, 0x08, 0x2d, 0xc1, 0xc2, 0x38, 0xf3, 0x08, 0x2d, 0xc9,
+    0x9b, 0x08, 0x2d, 0xd9, 0xc2, 0x0a, 0x44, 0x08, 0x2d, 0xe0, 0x44, 0x0c,
+    0xf7, 0xc0, 0xa4, 0x09, 0xca, 0x9e, 0x58, 0x01, 0x0a, 0xc0, 0x45, 0x03,
+    0xe0, 0xc0, 0xa4, 0x15, 0x43, 0x01, 0xa2, 0x40, 0xa4, 0x27, 0xc6, 0x0a,
+    0xfd, 0x01, 0x0a, 0xd9, 0x15, 0xc0, 0xa4, 0x33, 0xc5, 0x9e, 0x5c, 0x01,
+    0x0a, 0xa9, 0x16, 0xc0, 0xa4, 0x3f, 0xc5, 0xda, 0xf3, 0x01, 0x0a, 0x89,
+    0xc7, 0x06, 0x7b, 0x00, 0x05, 0xe1, 0xc4, 0x04, 0x30, 0x00, 0x05, 0xe8,
+    0x42, 0x04, 0xf6, 0xc0, 0xa4, 0x4b, 0x0e, 0xc0, 0xa4, 0x57, 0x05, 0xc0,
+    0xa4, 0x67, 0x14, 0xc0, 0xa4, 0x71, 0x42, 0x00, 0xe5, 0xc0, 0xa4, 0x7d,
+    0x07, 0xc0, 0xa4, 0x89, 0x15, 0xc0, 0xa4, 0x95, 0x06, 0xc0, 0xa4, 0xa7,
+    0xc9, 0x11, 0xa1, 0x70, 0x01, 0x71, 0xcc, 0x8a, 0x54, 0x70, 0x01, 0x69,
+    0x12, 0xc0, 0xa4, 0xb3, 0x03, 0xc0, 0xa4, 0xbf, 0xc5, 0x20, 0x41, 0x70,
+    0x03, 0xf1, 0xcd, 0x31, 0xc6, 0x70, 0x03, 0xe1, 0xcb, 0x8f, 0xb1, 0x70,
+    0x01, 0x18, 0x4b, 0x6e, 0xbb, 0xc0, 0xa4, 0xd1, 0x47, 0x01, 0x92, 0x40,
+    0xa4, 0xd9, 0x47, 0x01, 0x92, 0xc0, 0xa5, 0x2b, 0x45, 0x00, 0x8d, 0xc0,
+    0xa5, 0x8c, 0x4b, 0x6e, 0xbb, 0x40, 0xa5, 0x98, 0x43, 0x06, 0x4d, 0xc0,
+    0xa5, 0xa0, 0x43, 0x77, 0xc7, 0xc0, 0xa5, 0xac, 0xc5, 0xd6, 0x3e, 0x0f,
+    0x9a, 0x50, 0xd7, 0x26, 0xec, 0x08, 0xff, 0xf9, 0x15, 0xc0, 0xa5, 0xb8,
+    0xd2, 0x4e, 0x79, 0x08, 0xff, 0x71, 0x16, 0xc0, 0xa5, 0xd0, 0x03, 0xc0,
+    0xa5, 0xdc, 0x05, 0xc0, 0xa5, 0xee, 0x0e, 0xc0, 0xa5, 0xfa, 0x06, 0xc0,
+    0xa6, 0x06, 0xd4, 0x3a, 0xae, 0x08, 0xff, 0x21, 0x49, 0x54, 0x43, 0xc0,
+    0xa6, 0x1e, 0x4b, 0x6e, 0xbb, 0xc0, 0xa6, 0x30, 0xc2, 0x04, 0x0d, 0x00,
+    0x5e, 0x81, 0x47, 0x37, 0xb8, 0xc0, 0xa6, 0x50, 0xca, 0x9f, 0x20, 0x00,
+    0x5f, 0xa1, 0xc9, 0xb3, 0x78, 0x00, 0x5f, 0xa9, 0xca, 0x7c, 0xb3, 0x00,
+    0x5f, 0xc8, 0x46, 0x04, 0x99, 0xc0, 0xa6, 0x62, 0xd1, 0x4f, 0x8c, 0x08,
+    0xb5, 0xc9, 0x47, 0x01, 0x92, 0xc0, 0xa6, 0x86, 0x45, 0x00, 0x8d, 0xc0,
+    0xa6, 0xed, 0x4b, 0x6e, 0xbb, 0x40, 0xa6, 0xff, 0x45, 0x00, 0x8d, 0xc0,
+    0xa7, 0x19, 0x4b, 0x91, 0x5e, 0xc0, 0xa7, 0x4c, 0x4b, 0x90, 0x82, 0xc0,
+    0xa7, 0x70, 0x42, 0x00, 0xaa, 0xc0, 0xa7, 0x94, 0x4b, 0x6e, 0xbb, 0xc0,
+    0xa7, 0xa0, 0x47, 0x01, 0x92, 0x40, 0xa7, 0xca, 0x16, 0xc0, 0xa8, 0x18,
+    0x83, 0x00, 0xcb, 0x1b, 0x00, 0xa8, 0x2c, 0x87, 0x00, 0xcb, 0x5b, 0x00,
+    0xa8, 0x36, 0x97, 0x00, 0xcb, 0x3b, 0x00, 0xa8, 0x3e, 0x91, 0x00, 0xcb,
+    0x4b, 0x00, 0xa8, 0x42, 0x8b, 0x00, 0xcb, 0x21, 0x10, 0xc0, 0xa8, 0x46,
+    0x0d, 0xc0, 0xa8, 0x50, 0xc2, 0x0f, 0xba, 0x00, 0xca, 0xf9, 0xc2, 0x00,
+    0xce, 0x00, 0xca, 0xf1, 0xc2, 0x02, 0x63, 0x00, 0xca, 0xe9, 0xc2, 0x04,
+    0x70, 0x00, 0xca, 0xe1, 0xc2, 0x00, 0xb6, 0x00, 0xca, 0xd9, 0x12, 0xc0,
+    0xa8, 0x5a, 0xc2, 0x00, 0x89, 0x00, 0xca, 0xc1, 0xc2, 0x1a, 0x18, 0x00,
+    0xca, 0xa9, 0xc2, 0x0d, 0x01, 0x00, 0xca, 0xa1, 0xc2, 0x66, 0x73, 0x00,
+    0xca, 0x88, 0x47, 0x12, 0x2d, 0xc0, 0xa8, 0x64, 0x49, 0xb4, 0x98, 0xc0,
+    0xa8, 0x7c, 0x46, 0x35, 0x43, 0xc0, 0xa8, 0x94, 0x45, 0xdb, 0xc5, 0xc0,
+    0xa8, 0xae, 0x47, 0x01, 0x92, 0x40, 0xa8, 0xba, 0xc2, 0x18, 0xf5, 0x0f,
+    0xcc, 0x19, 0xcd, 0x7a, 0xcf, 0x01, 0x05, 0xd0, 0x46, 0x06, 0x64, 0xc0,
+    0xa8, 0xc6, 0xd1, 0x57, 0x2f, 0x01, 0x36, 0x49, 0x42, 0x00, 0x10, 0xc0,
+    0xa8, 0xd2, 0x06, 0xc0, 0xa8, 0xde, 0x15, 0xc0, 0xa8, 0xea, 0x03, 0xc0,
+    0xa9, 0x02, 0x05, 0xc0, 0xa9, 0x0e, 0xd7, 0x28, 0xa1, 0x01, 0x09, 0x49,
+    0xcc, 0x84, 0xe4, 0x0f, 0xac, 0x78, 0xd2, 0x23, 0xcb, 0x0f, 0xbe, 0x11,
+    0x06, 0xc0, 0xa9, 0x1a, 0x0e, 0xc0, 0xa9, 0x26, 0x14, 0xc0, 0xa9, 0x32,
+    0xcc, 0x85, 0xe0, 0x0f, 0xad, 0x89, 0xd3, 0x46, 0x92, 0x0f, 0xad, 0x39,
+    0xce, 0x74, 0x4c, 0x0f, 0xaf, 0x59, 0xd8, 0x21, 0x25, 0x01, 0x53, 0xb0,
+    0x42, 0x00, 0x6d, 0xc0, 0xa9, 0x3e, 0xcc, 0x7a, 0x41, 0x01, 0x00, 0x21,
+    0xc7, 0xb7, 0xe1, 0x01, 0x71, 0xd8, 0x01, 0xc0, 0xa9, 0x56, 0xc9, 0xa3,
+    0x77, 0x0f, 0xc8, 0xa0, 0xcf, 0x69, 0xad, 0x01, 0x36, 0x41, 0xc5, 0xde,
+    0x27, 0x01, 0x30, 0x40, 0xc9, 0xb0, 0x60, 0x0f, 0xa2, 0x71, 0xc7, 0xc6,
+    0xac, 0x0f, 0xa2, 0x68, 0xc4, 0x5b, 0x23, 0x01, 0x11, 0xa1, 0x01, 0x40,
+    0xa9, 0x60, 0xc5, 0x9e, 0xad, 0x0f, 0x99, 0x09, 0xc7, 0xc0, 0xfc, 0x01,
+    0x4f, 0x38, 0x47, 0x01, 0x92, 0xc0, 0xa9, 0x6c, 0x03, 0xc0, 0xa9, 0xd6,
+    0xc7, 0xc6, 0x9e, 0x00, 0x3d, 0x41, 0x07, 0xc0, 0xa9, 0xe2, 0xc7, 0xbf,
+    0xf9, 0x00, 0x3d, 0x51, 0x11, 0xc0, 0xa9, 0xf4, 0xc5, 0xdd, 0xb9, 0x00,
+    0x3d, 0x80, 0x05, 0xc0, 0xaa, 0x06, 0x46, 0x04, 0x99, 0x40, 0xaa, 0x12,
+    0x43, 0x04, 0x32, 0xc0, 0xaa, 0x36, 0x96, 0x0f, 0x9d, 0x48, 0x05, 0xc0,
+    0xaa, 0x54, 0xcc, 0x8a, 0x30, 0x01, 0x71, 0x18, 0x05, 0xc0, 0xaa, 0x60,
+    0xcc, 0x8a, 0x30, 0x01, 0x71, 0x10, 0xd3, 0x04, 0x56, 0x01, 0x49, 0xd3,
+    0x00, 0xaa, 0x6c, 0xda, 0x19, 0x2e, 0x01, 0x49, 0xe0, 0xd0, 0x5e, 0x52,
+    0x0f, 0x15, 0x71, 0x47, 0x01, 0x92, 0x40, 0xaa, 0x72, 0x42, 0xe6, 0x34,
+    0xc0, 0xaa, 0xeb, 0x25, 0xc0, 0xaa, 0xf7, 0x24, 0xc0, 0xab, 0x09, 0x26,
+    0x40, 0xab, 0x15, 0xc5, 0xab, 0xc9, 0x0f, 0xd5, 0x28, 0xc4, 0x63, 0x4f,
+    0x0f, 0xb4, 0x58, 0xc5, 0xda, 0xad, 0x0f, 0xad, 0x91, 0xc3, 0x04, 0x73,
+    0x0f, 0xb4, 0xe0, 0xd3, 0x3f, 0x72, 0x01, 0x56, 0xd9, 0xc5, 0xd4, 0x31,
+    0x01, 0x5e, 0xb8, 0x42, 0x00, 0x2f, 0xc0, 0xab, 0x21, 0x45, 0x04, 0x51,
+    0x40, 0xab, 0x2d, 0xc5, 0x67, 0x41, 0x01, 0x31, 0xb9, 0xc8, 0x2f, 0x82,
+    0x01, 0x31, 0xb1, 0x19, 0xc0, 0xab, 0x3f, 0xc7, 0x6c, 0xc7, 0x01, 0x31,
+    0x99, 0xc4, 0x87, 0xbc, 0x01, 0x31, 0x91, 0xc4, 0x2a, 0x69, 0x01, 0x31,
+    0x89, 0xc6, 0x71, 0x28, 0x01, 0x31, 0x80, 0x4d, 0x16, 0x5b, 0xc0, 0xab,
+    0x4b, 0xc5, 0x20, 0x41, 0x01, 0x12, 0x59, 0xc8, 0x1e, 0x5a, 0x01, 0x11,
+    0x69, 0x12, 0xc0, 0xab, 0x63, 0x54, 0x3a, 0xc2, 0xc0, 0xab, 0x6f, 0xce,
+    0x70, 0x78, 0x01, 0x57, 0xb1, 0x47, 0xc4, 0x05, 0xc0, 0xab, 0x7b, 0xd7,
+    0x2a, 0x11, 0x01, 0x57, 0xd9, 0xc6, 0xd2, 0xc2, 0x01, 0x72, 0x58, 0xd0,
+    0x5c, 0xb2, 0x01, 0x5e, 0xf8, 0xc2, 0x3c, 0x70, 0x0f, 0x9e, 0x31, 0x45,
+    0x05, 0x6a, 0x40, 0xab, 0x87, 0xc5, 0xdd, 0x2d, 0x0f, 0xb4, 0x70, 0x11,
+    0xc0, 0xab, 0x93, 0xc6, 0xcd, 0x52, 0x0e, 0x9a, 0x81, 0xc5, 0x0a, 0x8d,
+    0x0e, 0x99, 0xb1, 0x43, 0x11, 0xa2, 0x40, 0xab, 0x9f, 0x03, 0xc0, 0xab,
+    0xab, 0xc5, 0xd6, 0x2a, 0x0e, 0x99, 0x28, 0x0b, 0xc0, 0xab, 0xb7, 0xc8,
+    0x37, 0x6f, 0x0e, 0x9a, 0x41, 0x07, 0xc0, 0xab, 0xc7, 0xc4, 0xe2, 0xf0,
+    0x0e, 0x9a, 0x19, 0xc5, 0xd9, 0x59, 0x0e, 0x99, 0x00, 0xcb, 0x8f, 0xe8,
+    0x0e, 0x9a, 0x99, 0xc9, 0xa9, 0x34, 0x0e, 0x98, 0x68, 0x11, 0xc0, 0xab,
+    0xd9, 0x43, 0x0c, 0x04, 0xc0, 0xab, 0xe3, 0xc5, 0xbe, 0x1b, 0x0e, 0x99,
+    0x09, 0xc5, 0x07, 0x84, 0x0e, 0x98, 0x30, 0xca, 0x9b, 0xba, 0x0e, 0x9a,
+    0x89, 0xcb, 0x98, 0xee, 0x0e, 0x9a, 0x09, 0xc6, 0xcc, 0xc8, 0x0e, 0x98,
+    0xc9, 0xc5, 0x39, 0x31, 0x0e, 0x98, 0x60, 0xc7, 0xc9, 0x99, 0x0e, 0x9a,
+    0x69, 0xcb, 0x4d, 0xea, 0x0e, 0x98, 0xb0, 0x16, 0xc0, 0xab, 0xed, 0xc8,
+    0xbe, 0x28, 0x0e, 0x9a, 0x59, 0xc6, 0x87, 0xa9, 0x0e, 0x9a, 0x28, 0xc9,
+    0xa9, 0x07, 0x0e, 0x9a, 0x51, 0xcc, 0x8b, 0xbc, 0x0e, 0x9a, 0x11, 0xc7,
+    0x31, 0x20, 0x0e, 0x99, 0xd1, 0x10, 0xc0, 0xab, 0xf7, 0xc3, 0x2d, 0x2d,
+    0x0e, 0x98, 0xe0, 0xc3, 0x13, 0x4f, 0x0e, 0x9a, 0x31, 0xc6, 0xd1, 0x8a,
+    0x0e, 0x98, 0x90, 0xc3, 0x1a, 0x78, 0x0e, 0x9a, 0x21, 0xc5, 0x75, 0xbb,
+    0x0e, 0x98, 0xb8, 0xc6, 0xd0, 0xd6, 0x0e, 0x9a, 0x01, 0xc6, 0x13, 0xaf,
+    0x0e, 0x99, 0xc9, 0xc4, 0x79, 0x7f, 0x0e, 0x98, 0x40, 0xc8, 0x50, 0x8b,
+    0x0e, 0x99, 0x43, 0x00, 0xac, 0x09, 0xca, 0x9e, 0x4e, 0x0e, 0x99, 0xf1,
+    0xc8, 0xba, 0x40, 0x0e, 0x99, 0x91, 0xcc, 0x81, 0xc0, 0x0e, 0x99, 0x78,
+    0xc5, 0xdb, 0x07, 0x0e, 0x99, 0xa9, 0x07, 0x40, 0xac, 0x0f, 0x03, 0xc0,
+    0xac, 0x1f, 0xc5, 0xd8, 0xf0, 0x0e, 0x99, 0x51, 0xca, 0xa6, 0x32, 0x0e,
+    0x98, 0x98, 0xc6, 0xcc, 0x8c, 0x0e, 0x99, 0x39, 0xcc, 0x84, 0xc0, 0x0e,
+    0x98, 0x50, 0xce, 0x6e, 0x8e, 0x0e, 0x99, 0x19, 0xcc, 0x86, 0x4c, 0x0e,
+    0x98, 0x71, 0xc6, 0x68, 0x74, 0x0e, 0x98, 0x48, 0x45, 0x09, 0x6b, 0xc0,
+    0xac, 0x2b, 0xcd, 0x7a, 0x26, 0x0f, 0xa6, 0x30, 0x46, 0x35, 0x15, 0xc0,
+    0xac, 0x37, 0xc5, 0xbf, 0x13, 0x0f, 0xa9, 0x69, 0xc6, 0x2c, 0xbf, 0x0f,
+    0xa7, 0xd0, 0x45, 0x00, 0x8d, 0xc0, 0xac, 0x4f, 0x42, 0x00, 0x2f, 0xc0,
+    0xac, 0x6f, 0x4b, 0x6e, 0xbb, 0xc0, 0xac, 0x7b, 0xce, 0x74, 0x92, 0x00,
+    0x62, 0xb1, 0x46, 0x04, 0x99, 0xc0, 0xac, 0xa1, 0x4f, 0x62, 0x3c, 0x40,
+    0xac, 0xc5, 0xc5, 0x10, 0x8c, 0x0f, 0xa1, 0x78, 0xd0, 0x59, 0x82, 0x01,
+    0x4e, 0xa9, 0xcf, 0x66, 0x47, 0x01, 0x4e, 0xa0, 0xc8, 0x16, 0x68, 0x01,
+    0x11, 0xe3, 0x00, 0xac, 0xd5, 0x45, 0x00, 0x92, 0x40, 0xac, 0xd9, 0x46,
+    0x04, 0x99, 0xc0, 0xac, 0xe5, 0xc2, 0x04, 0x0d, 0x08, 0xa6, 0x39, 0x03,
+    0xc0, 0xad, 0x09, 0xc5, 0xdc, 0xd8, 0x08, 0xa6, 0x29, 0x45, 0x00, 0x8d,
+    0xc0, 0xad, 0x15, 0x4b, 0x6e, 0xbb, 0xc0, 0xad, 0x2b, 0x47, 0x01, 0x92,
+    0x40, 0xad, 0x51, 0xc2, 0x00, 0x3f, 0x01, 0x02, 0x51, 0xca, 0x9d, 0x22,
+    0x01, 0x72, 0x90, 0xe0, 0x05, 0x09, 0x08, 0x59, 0xd0, 0x1b, 0xc0, 0xad,
+    0xb8, 0x44, 0x00, 0x8e, 0xc0, 0xad, 0xc4, 0x49, 0x5e, 0x22, 0x40, 0xad,
+    0xf0, 0x09, 0xc0, 0xad, 0xfc, 0x42, 0x00, 0xaf, 0xc0, 0xae, 0x08, 0x05,
+    0xc0, 0xae, 0x14, 0xd5, 0x36, 0xf1, 0x00, 0x78, 0x39, 0x15, 0xc0, 0xae,
+    0x26, 0x04, 0xc0, 0xae, 0x32, 0xd5, 0x33, 0x01, 0x00, 0x78, 0x61, 0x10,
+    0xc0, 0xae, 0x3c, 0x16, 0xc0, 0xae, 0x48, 0x14, 0xc0, 0xae, 0x52, 0x4c,
+    0x80, 0xc4, 0xc0, 0xae, 0x5e, 0xc7, 0xc4, 0xc9, 0x00, 0x7c, 0x21, 0xc6,
+    0xca, 0xb8, 0x00, 0x7c, 0x29, 0xd6, 0x2c, 0x72, 0x00, 0x7e, 0x89, 0xd3,
+    0x41, 0x3a, 0x00, 0x7e, 0xc8, 0x4d, 0x7f, 0x54, 0xc0, 0xae, 0x6a, 0x46,
+    0x01, 0x93, 0x40, 0xae, 0x76, 0x15, 0xc0, 0xae, 0xd6, 0xc9, 0xaa, 0x27,
+    0x00, 0x78, 0xc0, 0xc4, 0x18, 0xa7, 0x00, 0x79, 0x01, 0xc3, 0x05, 0x16,
+    0x00, 0x79, 0x09, 0x16, 0xc0, 0xae, 0xe2, 0x08, 0xc0, 0xae, 0xee, 0x15,
+    0xc0, 0xae, 0xfa, 0xc5, 0x0a, 0xfd, 0x00, 0x79, 0x41, 0xc4, 0x28, 0x74,
+    0x00, 0x79, 0x49, 0x45, 0x04, 0x30, 0x40, 0xaf, 0x06, 0xc2, 0x12, 0x99,
+    0x00, 0x7b, 0x89, 0x8b, 0x00, 0x7b, 0x93, 0x00, 0xaf, 0x2a, 0x97, 0x00,
+    0x7b, 0xa3, 0x00, 0xaf, 0x2e, 0x48, 0xaa, 0xd2, 0xc0, 0xaf, 0x32, 0x87,
+    0x00, 0x7b, 0xd3, 0x00, 0xaf, 0x40, 0x91, 0x00, 0x7b, 0xe3, 0x00, 0xaf,
+    0x44, 0xca, 0xa0, 0xec, 0x00, 0x7c, 0x02, 0x00, 0xaf, 0x48, 0xcd, 0x7b,
+    0x37, 0x00, 0x7d, 0xf8, 0xca, 0x9e, 0x9e, 0x00, 0x7e, 0x01, 0xca, 0xa5,
+    0xc4, 0x00, 0x7e, 0x09, 0xc9, 0xb0, 0x33, 0x00, 0x7e, 0x11, 0xca, 0x9f,
+    0x02, 0x00, 0x7e, 0x18, 0x1b, 0xc0, 0xaf, 0x4c, 0x51, 0x55, 0x31, 0xc0,
+    0xaf, 0x66, 0x16, 0xc0, 0xaf, 0x6e, 0x03, 0x40, 0xaf, 0x7a, 0xe0, 0x01,
+    0xa9, 0x01, 0x6b, 0x78, 0x43, 0x01, 0xa5, 0xc0, 0xaf, 0x86, 0xdc, 0x12,
+    0xff, 0x01, 0x02, 0x89, 0xcc, 0x85, 0xe0, 0x0f, 0xad, 0x81, 0xc6, 0x77,
+    0x89, 0x0f, 0xa4, 0xa9, 0x48, 0x1a, 0x09, 0xc0, 0xaf, 0x90, 0xce, 0x75,
+    0x10, 0x01, 0x4e, 0x49, 0xce, 0x74, 0x4c, 0x0f, 0xaf, 0x51, 0x55, 0x36,
+    0x5e, 0xc0, 0xaf, 0x9c, 0xd8, 0x21, 0x25, 0x01, 0x53, 0xa9, 0xd1, 0x42,
+    0x92, 0x0f, 0xa3, 0x61, 0xd3, 0x42, 0x90, 0x0f, 0xa3, 0x68, 0xc4, 0x28,
+    0x74, 0x0f, 0xdf, 0xc9, 0xc4, 0x18, 0xa7, 0x0f, 0xdf, 0x81, 0xc3, 0x05,
+    0x16, 0x0f, 0xdf, 0x89, 0x16, 0xc0, 0xaf, 0xa8, 0x08, 0xc0, 0xaf, 0xb4,
+    0x15, 0xc0, 0xaf, 0xc0, 0xc5, 0x0a, 0xfd, 0x0f, 0xdf, 0xc0, 0xe0, 0x0b,
+    0xe9, 0x01, 0x51, 0x90, 0xc2, 0x00, 0x4b, 0x01, 0x18, 0xa1, 0xc8, 0x0a,
+    0x0a, 0x00, 0x05, 0x38, 0xe0, 0x07, 0xe9, 0x0f, 0xc9, 0x60, 0xcb, 0x72,
+    0x2d, 0x0f, 0xb4, 0x11, 0xc8, 0xb7, 0x08, 0x0f, 0x9a, 0xe0, 0xc3, 0x00,
+    0x46, 0x0f, 0xb4, 0x49, 0xcd, 0x7b, 0x03, 0x0f, 0xaf, 0xe8, 0x01, 0xc0,
+    0xaf, 0xcc, 0x45, 0x2f, 0xa5, 0x40, 0xaf, 0xe2, 0xc6, 0xcf, 0xce, 0x01,
+    0x34, 0xd1, 0xcb, 0x98, 0x96, 0x01, 0x34, 0xa8, 0x44, 0x00, 0x65, 0xc0,
+    0xaf, 0xfe, 0xc6, 0xd0, 0x88, 0x0f, 0x9a, 0x98, 0xd2, 0x48, 0xa3, 0x01,
+    0x13, 0x19, 0xcd, 0x7c, 0x48, 0x00, 0x04, 0xe0, 0x45, 0x00, 0x92, 0xc0,
+    0xb0, 0x0a, 0x48, 0xb8, 0xa0, 0x40, 0xb0, 0x16, 0xc7, 0xc5, 0xd3, 0x0f,
+    0xce, 0x11, 0xc3, 0x04, 0x7c, 0x01, 0x30, 0x98, 0x06, 0xc0, 0xb0, 0x22,
+    0x45, 0x00, 0x8d, 0xc0, 0xb0, 0x34, 0x4b, 0x6e, 0xbb, 0xc0, 0xb0, 0x46,
+    0xd4, 0x3b, 0x3a, 0x05, 0x45, 0xa1, 0x47, 0x01, 0x92, 0x40, 0xb0, 0x6c,
+    0xd4, 0x11, 0x79, 0x0f, 0xb3, 0xd1, 0x46, 0x10, 0xe4, 0x40, 0xb0, 0xd7,
+    0xc8, 0xb6, 0xa8, 0x0f, 0xa7, 0x08, 0x03, 0xc0, 0xb0, 0xe3, 0x15, 0xc0,
+    0xb0, 0xf9, 0xc4, 0xde, 0x9c, 0x00, 0x41, 0xd9, 0x1c, 0xc0, 0xb1, 0x05,
+    0xc5, 0x79, 0x2a, 0x00, 0x41, 0xc9, 0xcd, 0x79, 0x22, 0x00, 0x41, 0xb9,
+    0xc3, 0xd9, 0x07, 0x00, 0x41, 0x99, 0xc7, 0xc3, 0xf0, 0x00, 0x41, 0x80,
+    0x44, 0x01, 0x6a, 0xc0, 0xb1, 0x11, 0x4f, 0x0f, 0x61, 0x40, 0xb1, 0x32,
+    0x15, 0xc0, 0xb1, 0x42, 0x91, 0x00, 0x41, 0x5b, 0x00, 0xb1, 0x4e, 0x8b,
+    0x00, 0x41, 0x51, 0x45, 0x2b, 0x80, 0xc0, 0xb1, 0x57, 0x97, 0x00, 0x41,
+    0x39, 0x83, 0x00, 0x41, 0x1b, 0x00, 0xb1, 0x6a, 0x87, 0x00, 0x40, 0xe8,
+    0x16, 0xc0, 0xb1, 0x6e, 0x15, 0xc0, 0xb1, 0x80, 0xc4, 0x4c, 0x23, 0x00,
+    0x40, 0x99, 0xc3, 0xe5, 0x9b, 0x00, 0x40, 0x91, 0xc2, 0x01, 0x3a, 0x00,
+    0x40, 0x81, 0x0b, 0xc0, 0xb1, 0x8c, 0xc3, 0x20, 0xb0, 0x00, 0x40, 0x69,
+    0xc3, 0x88, 0x52, 0x00, 0x40, 0x61, 0xc5, 0xdc, 0x24, 0x00, 0x40, 0x59,
+    0xc4, 0xe0, 0x20, 0x00, 0x40, 0x51, 0xc3, 0x6f, 0x4f, 0x00, 0x40, 0x49,
+    0xc3, 0x0a, 0x44, 0x00, 0x40, 0x31, 0x04, 0xc0, 0xb1, 0x98, 0xc5, 0x4c,
+    0x1c, 0x00, 0x40, 0x19, 0xc5, 0xdc, 0xab, 0x00, 0x40, 0x11, 0xc4, 0xd8,
+    0x6f, 0x00, 0x40, 0x00, 0xcf, 0x43, 0x06, 0x01, 0x31, 0x00, 0x8a, 0x0f,
+    0xcd, 0x29, 0xc8, 0x3f, 0xb6, 0x0f, 0x9d, 0x80, 0x87, 0x01, 0x19, 0x99,
+    0x4a, 0x9a, 0x98, 0x40, 0xb1, 0xa4, 0x44, 0x00, 0xb1, 0xc0, 0xb1, 0xb0,
+    0xc6, 0xc4, 0x4c, 0x0f, 0xb1, 0x50, 0xcc, 0x85, 0xf8, 0x0f, 0xb2, 0x11,
+    0xcd, 0x75, 0x46, 0x0f, 0xb2, 0x08, 0x4c, 0x21, 0xcd, 0xc0, 0xb1, 0xc2,
+    0x53, 0x3f, 0xbe, 0x40, 0xb1, 0xd4, 0x8d, 0x0f, 0xcc, 0x41, 0x44, 0x46,
+    0x15, 0x40, 0xb1, 0xe0, 0xc6, 0x00, 0x7c, 0x01, 0x3a, 0x69, 0xc4, 0x0d,
+    0xf4, 0x01, 0x39, 0x81, 0xcb, 0x8c, 0xfc, 0x01, 0x38, 0xf0, 0xc6, 0xca,
+    0x94, 0x0f, 0x9b, 0x39, 0x4b, 0x8b, 0xa5, 0x40, 0xb2, 0x10, 0x4c, 0x88,
+    0x74, 0xc0, 0xb2, 0x90, 0xc4, 0x28, 0xfe, 0x0f, 0x9b, 0x81, 0x01, 0xc0,
+    0xb2, 0xa8, 0x95, 0x0f, 0xd3, 0x98, 0xc4, 0xe1, 0x2c, 0x0f, 0xb6, 0x69,
+    0xc7, 0xc8, 0x2d, 0x0f, 0xb6, 0x90, 0xc3, 0x08, 0x05, 0x00, 0x00, 0x71,
+    0xc2, 0x00, 0xaf, 0x00, 0x00, 0x78, 0xc2, 0x00, 0x47, 0x0f, 0xcc, 0x11,
+    0xc2, 0x10, 0x85, 0x01, 0x32, 0x78, 0x46, 0x00, 0xb5, 0xc0, 0xb2, 0xd0,
+    0x48, 0x09, 0x39, 0xc0, 0xb2, 0xe0, 0xd4, 0x1b, 0xd8, 0x0f, 0xb3, 0x80,
+    0xc2, 0x00, 0x79, 0x0f, 0xad, 0xa9, 0xc7, 0xc5, 0x1d, 0x0f, 0xd4, 0xd8,
+    0xcd, 0x78, 0x5f, 0x01, 0x36, 0x20, 0x45, 0x17, 0xe0, 0xc0, 0xb3, 0x04,
+    0x45, 0x1d, 0xe4, 0x40, 0xb3, 0x34, 0xd0, 0x0d, 0xac, 0x0f, 0xb3, 0x58,
+    0xcd, 0x78, 0xa0, 0x01, 0x4f, 0xb0, 0xa1, 0x08, 0xd5, 0x11, 0xa0, 0x08,
+    0xd5, 0x08, 0x45, 0x00, 0x6a, 0x40, 0xb3, 0x64, 0xc5, 0xd4, 0x54, 0x08,
+    0xd4, 0xe9, 0xcb, 0x99, 0x25, 0x08, 0xd4, 0xe1, 0xc4, 0x02, 0xea, 0x08,
+    0xd4, 0xd9, 0xc5, 0x33, 0x0b, 0x08, 0xd4, 0xd0, 0xc8, 0xbe, 0x68, 0x08,
+    0xd4, 0xc9, 0x44, 0x00, 0x8e, 0x40, 0xb3, 0x70, 0xc2, 0x1e, 0x12, 0x08,
+    0xd4, 0xa9, 0x95, 0x08, 0xd4, 0xa3, 0x00, 0xb3, 0x88, 0x8e, 0x08, 0xd4,
+    0x91, 0x94, 0x08, 0xd4, 0x89, 0x8f, 0x08, 0xd4, 0x81, 0x84, 0x08, 0xd4,
+    0x79, 0x90, 0x08, 0xd4, 0x73, 0x00, 0xb3, 0x8c, 0x86, 0x08, 0xd4, 0x69,
+    0x8d, 0x08, 0xd4, 0x59, 0x89, 0x08, 0xd4, 0x50, 0x15, 0xc0, 0xb3, 0x90,
+    0xc2, 0x00, 0x89, 0x08, 0xd4, 0x39, 0xc2, 0x00, 0x3b, 0x08, 0xd4, 0x30,
+    0x0d, 0xc0, 0xb3, 0x9a, 0xc2, 0x00, 0xce, 0x08, 0xd4, 0x11, 0x15, 0xc0,
+    0xb3, 0xaa, 0xc2, 0x02, 0x63, 0x08, 0xd3, 0xf1, 0xc2, 0x00, 0x89, 0x08,
+    0xd3, 0xe9, 0xc2, 0x00, 0x3b, 0x08, 0xd3, 0xe1, 0xc2, 0x1a, 0x18, 0x08,
+    0xd3, 0xd9, 0xc2, 0x1e, 0x12, 0x08, 0xd3, 0xd1, 0x1c, 0xc0, 0xb3, 0xba,
+    0x06, 0xc0, 0xb3, 0xc4, 0x16, 0xc0, 0xb3, 0xd8, 0xc2, 0x00, 0xb6, 0x08,
+    0xd3, 0xa1, 0x04, 0xc0, 0xb3, 0xea, 0x12, 0xc0, 0xb3, 0xf4, 0x10, 0xc0,
+    0xb3, 0xfe, 0x0c, 0xc0, 0xb4, 0x14, 0x05, 0xc0, 0xb4, 0x1e, 0x09, 0xc0,
+    0xb4, 0x28, 0x83, 0x08, 0xd2, 0x80, 0xcb, 0x35, 0x6c, 0x08, 0xd2, 0xd9,
+    0x45, 0x00, 0x8d, 0x40, 0xb4, 0x32, 0xd1, 0x33, 0xec, 0x0f, 0xad, 0x61,
+    0xc9, 0xb0, 0x0f, 0x0f, 0x9b, 0x31, 0xc6, 0x58, 0x02, 0x00, 0x05, 0x68,
+    0xc4, 0x28, 0x74, 0x08, 0x87, 0xc9, 0xc5, 0x0a, 0xfd, 0x08, 0x87, 0xc1,
+    0x15, 0xc0, 0xb4, 0x52, 0x08, 0xc0, 0xb4, 0x5e, 0x16, 0xc0, 0xb4, 0x6a,
+    0xc3, 0x05, 0x16, 0x08, 0x87, 0x89, 0xc4, 0x18, 0xa7, 0x08, 0x87, 0x80,
+    0x42, 0x00, 0xb6, 0xc0, 0xb4, 0x76, 0x07, 0xc0, 0xb4, 0x7e, 0xc2, 0x31,
+    0xdb, 0x08, 0x87, 0x31, 0xc2, 0x73, 0x14, 0x08, 0x87, 0x29, 0xc2, 0x12,
+    0x9d, 0x08, 0x87, 0x21, 0xc2, 0x01, 0x9a, 0x08, 0x87, 0x11, 0x10, 0xc0,
+    0xb4, 0x88, 0xc3, 0xe5, 0x62, 0x08, 0x87, 0x01, 0xc3, 0x3c, 0x78, 0x08,
+    0x86, 0xf9, 0xc3, 0x14, 0x15, 0x08, 0x86, 0xf1, 0xc3, 0x12, 0xef, 0x08,
+    0x86, 0xe9, 0xc3, 0x40, 0x1a, 0x08, 0x86, 0xe1, 0xc3, 0x65, 0xf4, 0x08,
+    0x86, 0xd9, 0xc3, 0xc3, 0x3d, 0x08, 0x86, 0xd1, 0xc3, 0x12, 0xe8, 0x08,
+    0x86, 0xc1, 0xc3, 0x93, 0xae, 0x08, 0x86, 0xa9, 0xc3, 0x6d, 0x81, 0x08,
+    0x86, 0xa1, 0xc3, 0xe4, 0xba, 0x08, 0x86, 0x99, 0xc3, 0x42, 0x8c, 0x08,
+    0x86, 0x91, 0xc3, 0x01, 0x99, 0x08, 0x86, 0x89, 0xc3, 0xce, 0xe2, 0x08,
+    0x86, 0x80, 0xd4, 0x3f, 0x0e, 0x08, 0x7a, 0xc9, 0x44, 0x01, 0xa1, 0xc0,
+    0xb4, 0x9a, 0xcf, 0x3f, 0x13, 0x08, 0x7a, 0xb8, 0xc3, 0x05, 0x16, 0x08,
+    0x7a, 0x8b, 0x00, 0xb4, 0xa9, 0x16, 0x40, 0xb4, 0xaf, 0xcc, 0x01, 0x1d,
+    0x08, 0x7a, 0x81, 0xca, 0xa0, 0x42, 0x08, 0x7a, 0x79, 0xcf, 0x67, 0x55,
+    0x08, 0x7a, 0x71, 0x45, 0x11, 0x65, 0xc0, 0xb4, 0xbb, 0x46, 0x0e, 0xb8,
+    0xc0, 0xb4, 0xc7, 0x49, 0x03, 0x1b, 0xc0, 0xb4, 0xd3, 0x44, 0x05, 0x1a,
+    0x40, 0xb4, 0xdf, 0x0e, 0xc0, 0xb4, 0xeb, 0xc4, 0xe1, 0x44, 0x08, 0x7a,
+    0x19, 0xc3, 0x6e, 0xe0, 0x08, 0x7a, 0x11, 0x15, 0xc0, 0xb4, 0xf7, 0xc9,
+    0x5a, 0xd2, 0x08, 0x7a, 0x01, 0xc2, 0x00, 0x78, 0x08, 0x79, 0xf1, 0x03,
+    0xc0, 0xb5, 0x01, 0xc3, 0x20, 0xb0, 0x08, 0x79, 0xd9, 0xc3, 0x03, 0xb0,
+    0x08, 0x79, 0xd1, 0xc4, 0xe0, 0x58, 0x08, 0x79, 0xc1, 0xc4, 0x4e, 0x09,
+    0x08, 0x79, 0xb9, 0xc2, 0x00, 0x61, 0x08, 0x79, 0x9b, 0x00, 0xb5, 0x0d,
+    0xc5, 0x4e, 0x03, 0x08, 0x79, 0xa9, 0xc3, 0x76, 0xe6, 0x08, 0x79, 0xa1,
+    0xc5, 0x9b, 0xd8, 0x08, 0x79, 0x91, 0xc4, 0xe0, 0x9c, 0x08, 0x79, 0x88,
+    0x01, 0xc0, 0xb5, 0x13, 0x42, 0x00, 0x6d, 0x40, 0xb5, 0x6f, 0xcd, 0x79,
+    0x08, 0x0f, 0xaa, 0x29, 0x15, 0xc0, 0xb5, 0xc7, 0x06, 0xc0, 0xb5, 0xee,
+    0x10, 0xc0, 0xb5, 0xf8, 0xce, 0x74, 0xd8, 0x01, 0x20, 0xf9, 0xd0, 0x59,
+    0xc2, 0x01, 0x20, 0xf1, 0xcf, 0x62, 0x1e, 0x01, 0x20, 0xe9, 0x08, 0xc0,
+    0xb6, 0x02, 0x07, 0xc0, 0xb6, 0x0e, 0x42, 0x03, 0xc6, 0xc0, 0xb6, 0x18,
+    0xd3, 0x45, 0xc1, 0x01, 0x20, 0x59, 0xc9, 0x1b, 0x36, 0x01, 0x20, 0x51,
+    0xd5, 0x37, 0x06, 0x01, 0x20, 0x49, 0x04, 0xc0, 0xb6, 0x24, 0xcb, 0x4b,
+    0x20, 0x01, 0x20, 0x31, 0xd2, 0x4d, 0x47, 0x01, 0x5c, 0xb8, 0x47, 0x01,
+    0x92, 0xc0, 0xb6, 0x30, 0x47, 0xc3, 0x9c, 0xc0, 0xb6, 0xa2, 0x47, 0xc7,
+    0x1c, 0xc0, 0xb6, 0xb4, 0xd1, 0x4d, 0x59, 0x00, 0x38, 0x79, 0x0a, 0xc0,
+    0xb6, 0xc6, 0x42, 0x00, 0xaa, 0xc0, 0xb6, 0xd8, 0x42, 0x02, 0x0b, 0xc0,
+    0xb6, 0xe4, 0x07, 0xc0, 0xb6, 0xf0, 0x4d, 0x7b, 0x44, 0xc0, 0xb6, 0xfc,
+    0x14, 0xc0, 0xb7, 0x08, 0xcc, 0x8a, 0xb4, 0x00, 0x3a, 0x01, 0xc9, 0xaf,
+    0xc7, 0x00, 0x3a, 0x09, 0x16, 0xc0, 0xb7, 0x1a, 0x4d, 0x7e, 0x29, 0xc0,
+    0xb7, 0x26, 0xc5, 0x22, 0xe0, 0x00, 0x3a, 0x49, 0xc7, 0xc0, 0x93, 0x00,
+    0x3a, 0x50, 0x83, 0x05, 0x40, 0x01, 0x8b, 0x05, 0x40, 0x09, 0x97, 0x05,
+    0x40, 0x19, 0x87, 0x05, 0x40, 0x21, 0x91, 0x05, 0x40, 0x29, 0x0d, 0xc0,
+    0xb7, 0x32, 0x09, 0xc0, 0xb7, 0x3c, 0x05, 0xc0, 0xb7, 0x46, 0x16, 0xc0,
+    0xb7, 0x50, 0x06, 0xc0, 0xb7, 0x5e, 0xc2, 0x00, 0x4a, 0x05, 0x41, 0x11,
+    0x0c, 0xc0, 0xb7, 0x6c, 0xc2, 0x00, 0x10, 0x05, 0x40, 0xc1, 0x12, 0xc0,
+    0xb7, 0x76, 0x04, 0xc0, 0xb7, 0x80, 0xc2, 0x08, 0x04, 0x05, 0x40, 0xe9,
+    0x14, 0xc0, 0xb7, 0x8a, 0xc2, 0x00, 0x29, 0x05, 0x40, 0xf9, 0xc2, 0x02,
+    0x1d, 0x05, 0x41, 0x08, 0xc8, 0xb7, 0x20, 0x05, 0x40, 0x11, 0xc7, 0x5a,
+    0x2b, 0x05, 0x40, 0x31, 0x03, 0x40, 0xb7, 0x94, 0x83, 0x05, 0x41, 0x19,
+    0x8b, 0x05, 0x41, 0x21, 0x97, 0x05, 0x41, 0x29, 0x87, 0x05, 0x41, 0x31,
+    0xc2, 0x05, 0x37, 0x05, 0x41, 0x38, 0xa0, 0x05, 0x41, 0x41, 0xa1, 0x05,
+    0x41, 0x49, 0xa2, 0x05, 0x41, 0x51, 0xa3, 0x05, 0x41, 0x58, 0xca, 0x9c,
+    0x6e, 0x0f, 0xa5, 0x61, 0xc5, 0xd6, 0x9d, 0x0f, 0xb5, 0x20, 0xd6, 0x2d,
+    0x64, 0x0f, 0xaf, 0x19, 0xc2, 0x00, 0x2c, 0x0f, 0xa8, 0x43, 0x00, 0xb7,
+    0xa0, 0xcf, 0x67, 0x0a, 0x0f, 0xb2, 0x50, 0x87, 0x01, 0x3a, 0x3b, 0x00,
+    0xb7, 0xa6, 0xc9, 0x77, 0x85, 0x0f, 0xa4, 0xb0, 0xc2, 0x00, 0x6f, 0x01,
+    0x4d, 0x09, 0xc4, 0x00, 0x2f, 0x01, 0x4d, 0x00, 0xcc, 0x87, 0x9c, 0x0f,
+    0xae, 0x99, 0xc8, 0xb5, 0xf0, 0x0f, 0xae, 0x91, 0xc5, 0x06, 0xf3, 0x0f,
+    0xa0, 0xd0, 0xc4, 0xe2, 0xcc, 0x0f, 0xab, 0xc0, 0x90, 0x0f, 0xca, 0x21,
+    0xcb, 0x8e, 0xb4, 0x0f, 0xcf, 0xa8, 0x14, 0xc0, 0xb7, 0xaa, 0x08, 0xc0,
+    0xb7, 0xb6, 0xcb, 0x1a, 0x38, 0x0e, 0xd4, 0x59, 0x05, 0xc0, 0xb7, 0xd0,
+    0x15, 0xc0, 0xb7, 0xda, 0x0e, 0xc0, 0xb7, 0xf8, 0x42, 0x00, 0x6f, 0xc0,
+    0xb8, 0x02, 0x16, 0xc0, 0xb8, 0x08, 0xdb, 0x15, 0xe9, 0x0e, 0xd3, 0x79,
+    0x07, 0xc0, 0xb8, 0x16, 0x0a, 0xc0, 0xb8, 0x28, 0x10, 0xc0, 0xb8, 0x35,
+    0x42, 0x08, 0x04, 0xc0, 0xb8, 0x41, 0x42, 0x00, 0x3a, 0xc0, 0xb8, 0x4d,
+    0x44, 0x8c, 0x36, 0xc0, 0xb8, 0x59, 0x06, 0xc0, 0xb8, 0x65, 0x46, 0xca,
+    0x82, 0x40, 0xb8, 0x71, 0xe0, 0x07, 0x09, 0x01, 0x39, 0xf1, 0x47, 0x08,
+    0xec, 0x40, 0xb8, 0x83, 0x4b, 0x6e, 0xbb, 0xc0, 0xb8, 0x95, 0x47, 0x01,
+    0x92, 0xc0, 0xb8, 0xb8, 0x15, 0xc0, 0xb9, 0x1f, 0xd0, 0x5c, 0x12, 0x08,
+    0xae, 0x49, 0x50, 0x5a, 0x52, 0xc0, 0xb9, 0x29, 0x06, 0x40, 0xb9, 0x35,
+    0x46, 0x06, 0x64, 0xc0, 0xb9, 0x41, 0x46, 0x00, 0xbb, 0x40, 0xb9, 0x59,
+    0x01, 0xc0, 0xb9, 0x71, 0x47, 0xc0, 0xcb, 0x40, 0xb9, 0x8d, 0x48, 0x76,
+    0xd9, 0xc0, 0xb9, 0x95, 0x45, 0x00, 0x8d, 0xc0, 0xb9, 0xa1, 0x0e, 0xc0,
+    0xb9, 0xb1, 0x4b, 0x6e, 0xbb, 0xc0, 0xb9, 0xbd, 0xd6, 0x31, 0x84, 0x00,
+    0x6f, 0xa0, 0xc9, 0x02, 0xa0, 0x01, 0x54, 0xe9, 0xcc, 0x06, 0x09, 0x01,
+    0x54, 0xf0, 0xdb, 0x18, 0xf8, 0x01, 0x54, 0xf9, 0xde, 0x0f, 0x9c, 0x01,
+    0x55, 0x00, 0x43, 0x00, 0x3f, 0xc0, 0xb9, 0xd3, 0x46, 0x02, 0x11, 0x40,
+    0xb9, 0xf4, 0xcc, 0x88, 0x5c, 0x01, 0x36, 0x29, 0xc9, 0xaf, 0x0a, 0x0f,
+    0x98, 0xf0, 0x52, 0x4e, 0x0d, 0xc0, 0xba, 0x2c, 0x47, 0x01, 0x92, 0xc0,
+    0xba, 0x54, 0xc8, 0x7e, 0x14, 0x00, 0xdd, 0xd1, 0x46, 0x04, 0x99, 0xc0,
+    0xba, 0xde, 0x51, 0x55, 0x42, 0xc0, 0xbb, 0x02, 0x45, 0x00, 0x8d, 0xc0,
+    0xbb, 0x14, 0x4d, 0x77, 0xa9, 0x40, 0xbb, 0x20, 0xcf, 0x6a, 0xac, 0x0f,
+    0x98, 0x20, 0xd5, 0x34, 0x27, 0x01, 0x17, 0x49, 0xce, 0x6b, 0x9a, 0x01,
+    0x15, 0x89, 0x46, 0x24, 0x62, 0xc0, 0xbb, 0x2a, 0x46, 0x00, 0xd2, 0x40,
+    0xbb, 0x36, 0xc2, 0x02, 0xd5, 0x01, 0x14, 0x13, 0x00, 0xbb, 0x4e, 0x46,
+    0x00, 0xd2, 0xc0, 0xbb, 0x52, 0x45, 0x00, 0x92, 0x40, 0xbb, 0x5e, 0xd1,
+    0x1a, 0x32, 0x01, 0x04, 0x71, 0xd0, 0x1e, 0xb6, 0x01, 0x04, 0x69, 0x07,
+    0xc0, 0xbb, 0x70, 0xc5, 0x19, 0x43, 0x01, 0x04, 0x59, 0xc9, 0x64, 0xb2,
+    0x01, 0x04, 0x51, 0xc4, 0x28, 0x74, 0x01, 0x04, 0x49, 0x15, 0xc0, 0xbb,
+    0x7c, 0x08, 0xc0, 0xbb, 0x88, 0x16, 0xc0, 0xbb, 0x94, 0xc3, 0x05, 0x16,
+    0x01, 0x04, 0x09, 0xc4, 0x18, 0xa7, 0x01, 0x04, 0x00, 0x87, 0x01, 0x19,
+    0x19, 0x44, 0x00, 0xb1, 0x40, 0xbb, 0xa0, 0x01, 0xc0, 0xbb, 0xac, 0xc7,
+    0xc6, 0x58, 0x01, 0x55, 0x52, 0x00, 0xbc, 0x0e, 0xd7, 0x2a, 0x9b, 0x0f,
+    0xc5, 0x81, 0x57, 0x2a, 0xc9, 0xc0, 0xbc, 0x14, 0x58, 0x24, 0x6d, 0x40,
+    0xbc, 0x20, 0x0e, 0xc0, 0xbc, 0x32, 0x42, 0x00, 0xb6, 0xc0, 0xbc, 0x42,
+    0x06, 0xc0, 0xbc, 0x54, 0x14, 0xc0, 0xbc, 0x6a, 0xc5, 0x4b, 0xa4, 0x00,
+    0x32, 0x83, 0x00, 0xbc, 0x80, 0x08, 0xc0, 0xbc, 0x8d, 0x15, 0xc0, 0xbc,
+    0xa8, 0x45, 0x00, 0x77, 0xc0, 0xbc, 0xd3, 0x16, 0xc0, 0xbc, 0xe5, 0x05,
+    0xc0, 0xbd, 0x01, 0x42, 0x00, 0xce, 0xc0, 0xbd, 0x0d, 0x12, 0xc0, 0xbd,
+    0x19, 0x18, 0xc0, 0xbd, 0x2f, 0xd2, 0x49, 0xc3, 0x00, 0x44, 0x39, 0x07,
+    0xc0, 0xbd, 0x3b, 0xd0, 0x5f, 0xd2, 0x00, 0x32, 0xf9, 0xc8, 0xba, 0x38,
+    0x00, 0x32, 0xc9, 0xce, 0x74, 0x30, 0x00, 0x32, 0xb9, 0xcd, 0x30, 0xea,
+    0x00, 0x30, 0xf9, 0x47, 0x37, 0xb8, 0x40, 0xbd, 0x47, 0x46, 0x04, 0x99,
+    0xc0, 0xbd, 0x53, 0x44, 0x06, 0x52, 0xc0, 0xbd, 0x77, 0xcb, 0x91, 0x3d,
+    0x00, 0x30, 0x39, 0xc9, 0xac, 0x4c, 0x00, 0x30, 0x30, 0x48, 0x1b, 0xd9,
+    0xc0, 0xbd, 0x83, 0x46, 0x01, 0x93, 0x40, 0xbd, 0x95, 0xd0, 0x4d, 0x5a,
+    0x00, 0x2a, 0xf9, 0xc9, 0x2e, 0xd1, 0x00, 0x2a, 0xd0, 0xc4, 0x04, 0x0d,
+    0x00, 0x2a, 0xe9, 0x4e, 0x09, 0x3a, 0x40, 0xbe, 0x0e, 0xcf, 0x0e, 0xee,
+    0x00, 0x2a, 0xe1, 0xcc, 0x85, 0x5c, 0x00, 0x2a, 0xd8, 0x4e, 0x09, 0x3a,
+    0xc0, 0xbe, 0x87, 0xd1, 0x2c, 0x05, 0x0f, 0x4a, 0x40, 0xc4, 0x66, 0x74,
+    0x0f, 0x49, 0x11, 0x06, 0xc0, 0xbf, 0x07, 0xc4, 0x7a, 0xcb, 0x0f, 0x49,
+    0x21, 0xc4, 0xe4, 0x54, 0x0f, 0x49, 0x29, 0x04, 0xc0, 0xbf, 0x13, 0x15,
+    0xc0, 0xbf, 0x1d, 0xc2, 0x00, 0x78, 0x0f, 0x49, 0x41, 0xc2, 0x00, 0x3b,
+    0x0f, 0x49, 0x51, 0x87, 0x0f, 0x49, 0x59, 0xc2, 0x04, 0x70, 0x0f, 0x49,
+    0x61, 0x8b, 0x0f, 0x49, 0x69, 0x91, 0x0f, 0x49, 0x71, 0x1b, 0xc0, 0xbf,
+    0x29, 0xc3, 0x76, 0xe6, 0x0f, 0x49, 0x89, 0x10, 0xc0, 0xbf, 0x33, 0x0d,
+    0xc0, 0xbf, 0x45, 0x97, 0x0f, 0x49, 0xa9, 0xc4, 0xe0, 0x18, 0x0f, 0x49,
+    0xb1, 0xc3, 0x11, 0x99, 0x0f, 0x49, 0xb9, 0xc2, 0x00, 0xce, 0x0f, 0x49,
+    0xc1, 0xc4, 0xd3, 0x82, 0x0f, 0x49, 0xc9, 0x09, 0xc0, 0xbf, 0x57, 0xc2,
+    0x00, 0x16, 0x0f, 0x49, 0xe1, 0xc2, 0x02, 0x63, 0x0f, 0x49, 0xf1, 0xc3,
+    0xa7, 0xcc, 0x0f, 0x4a, 0x08, 0xc8, 0x01, 0x61, 0x0f, 0x4a, 0x31, 0xd4,
+    0x3a, 0x4a, 0x0f, 0x4a, 0x48, 0xc4, 0x34, 0xda, 0x0f, 0x4a, 0x51, 0xd0,
+    0x50, 0x37, 0x0f, 0x4a, 0x58, 0xc4, 0x18, 0xa7, 0x0f, 0x4a, 0x81, 0xc3,
+    0x05, 0x16, 0x0f, 0x4a, 0x89, 0x16, 0xc0, 0xbf, 0x61, 0x08, 0xc0, 0xbf,
+    0x6d, 0x15, 0xc0, 0xbf, 0x79, 0xc5, 0x0a, 0xfd, 0x0f, 0x4a, 0xc1, 0xc4,
+    0x28, 0x74, 0x0f, 0x4a, 0xc8, 0xd0, 0x0e, 0xed, 0x0f, 0x4a, 0xf1, 0xcd,
+    0x30, 0xea, 0x0f, 0x4a, 0xf8, 0x47, 0xc1, 0xb9, 0xc0, 0xbf, 0x85, 0xc4,
+    0xe3, 0x04, 0x0f, 0xba, 0x13, 0x00, 0xbf, 0x91, 0xcb, 0x8c, 0xc5, 0x0f,
+    0xb8, 0x79, 0xca, 0xa3, 0x1c, 0x0f, 0xb9, 0xf1, 0xc4, 0x1b, 0x94, 0x0f,
+    0xba, 0xc8, 0x14, 0xc0, 0xbf, 0x95, 0xc7, 0xca, 0x25, 0x0f, 0xb8, 0x99,
+    0x46, 0x48, 0xec, 0xc0, 0xbf, 0xa4, 0x03, 0x40, 0xbf, 0xb0, 0x42, 0x02,
+    0x1c, 0xc0, 0xbf, 0xc2, 0xc8, 0xbd, 0x08, 0x0f, 0xbb, 0x80, 0x11, 0xc0,
+    0xbf, 0xd1, 0xd2, 0x47, 0x83, 0x0f, 0xb8, 0x71, 0xca, 0xa4, 0xde, 0x0f,
+    0xba, 0xf9, 0x17, 0x40, 0xbf, 0xe0, 0xc5, 0xd5, 0x80, 0x0f, 0xb9, 0xfb,
+    0x00, 0xbf, 0xec, 0x42, 0x00, 0xaf, 0xc0, 0xbf, 0xf2, 0xc4, 0xde, 0xc8,
+    0x0f, 0xba, 0x69, 0xc6, 0x7a, 0x88, 0x0f, 0xba, 0x88, 0x07, 0xc0, 0xbf,
+    0xfe, 0xc8, 0xb6, 0xf0, 0x0f, 0xb8, 0xc2, 0x00, 0xc0, 0x16, 0x0b, 0xc0,
+    0xc0, 0x1c, 0xc8, 0xb6, 0xa0, 0x0f, 0xb9, 0x40, 0x17, 0xc0, 0xc0, 0x2e,
+    0x42, 0x00, 0x52, 0xc0, 0xc0, 0x3a, 0xc5, 0xda, 0xee, 0x0f, 0xb8, 0xd9,
+    0xc5, 0xab, 0x7e, 0x0f, 0xba, 0x39, 0xce, 0x6b, 0xe0, 0x0f, 0xba, 0x79,
+    0x16, 0xc0, 0xc0, 0x47, 0xc3, 0xc2, 0x7a, 0x0f, 0xba, 0xa0, 0xcb, 0x8e,
+    0xca, 0x0f, 0xb9, 0x59, 0x43, 0x00, 0xe5, 0xc0, 0xc0, 0x56, 0xc2, 0x00,
+    0x7d, 0x0f, 0xb8, 0x09, 0x0e, 0xc0, 0xc0, 0x60, 0xc6, 0xcd, 0x04, 0x0f,
+    0xb9, 0xd1, 0xca, 0xa2, 0x18, 0x0f, 0xb9, 0xe9, 0xc4, 0x6d, 0x22, 0x0f,
+    0xba, 0xb9, 0xc6, 0xd2, 0xce, 0x0f, 0xba, 0xd8, 0xc7, 0xc3, 0x56, 0x0f,
+    0xb9, 0x51, 0xc8, 0xb6, 0xd8, 0x0f, 0xba, 0x98, 0xc3, 0x07, 0x86, 0x0f,
+    0xb8, 0xa9, 0xc3, 0x00, 0x66, 0x0f, 0xbb, 0x78, 0xd0, 0x5b, 0xa2, 0x0f,
+    0xb8, 0x83, 0x00, 0xc0, 0x75, 0xc8, 0xbc, 0x00, 0x0f, 0xb9, 0xc1, 0xc4,
+    0x90, 0xc5, 0x0f, 0xbb, 0x88, 0xc3, 0x01, 0x95, 0x0f, 0xb8, 0x21, 0x9a,
+    0x0f, 0xba, 0x50, 0xc9, 0xb2, 0x34, 0x0f, 0xb8, 0x01, 0xc7, 0xc0, 0xa1,
+    0x0f, 0xba, 0x08, 0xc3, 0x1e, 0x6b, 0x0f, 0xb8, 0xd1, 0xc2, 0x04, 0x41,
+    0x0f, 0xba, 0x48, 0xc4, 0x8e, 0xd1, 0x0f, 0xb8, 0xe3, 0x00, 0xc0, 0x79,
+    0xcb, 0x94, 0x81, 0x0f, 0xb9, 0x08, 0x11, 0xc0, 0xc0, 0x7f, 0x44, 0x04,
+    0x31, 0x40, 0xc0, 0x8b, 0xd7, 0x0a, 0x12, 0x01, 0x53, 0x78, 0xd3, 0x3f,
+    0xab, 0x0f, 0x9f, 0x39, 0xc5, 0x47, 0x0c, 0x0f, 0xb4, 0xb8, 0x1f, 0xc0,
+    0xc0, 0x97, 0x20, 0xc0, 0xc0, 0xbf, 0x21, 0xc0, 0xc0, 0xe7, 0x22, 0xc0,
+    0xc1, 0x0f, 0x23, 0xc0, 0xc1, 0x37, 0x24, 0x40, 0xc1, 0x5f, 0xd3, 0x46,
+    0xde, 0x01, 0x3f, 0x91, 0x05, 0xc0, 0xc1, 0x71, 0xd1, 0x00, 0x77, 0x01,
+    0x0d, 0xd1, 0x16, 0xc0, 0xc1, 0x7d, 0x48, 0x05, 0xca, 0xc0, 0xc1, 0x89,
+    0xcb, 0x82, 0xc8, 0x01, 0x50, 0x88, 0x46, 0x00, 0x91, 0x40, 0xc1, 0x8f,
+    0xda, 0x1b, 0x1c, 0x01, 0x37, 0x11, 0xc3, 0x9b, 0x17, 0x01, 0x5e, 0xc8,
+    0x8d, 0x00, 0x01, 0x53, 0x00, 0xc1, 0x9b, 0x8f, 0x01, 0x02, 0x10, 0xc2,
+    0x00, 0x89, 0x08, 0xba, 0x31, 0x83, 0x08, 0xb8, 0x70, 0xc2, 0x03, 0x83,
+    0x08, 0xba, 0x29, 0xc2, 0x1a, 0x18, 0x08, 0xb8, 0x81, 0x83, 0x08, 0xb8,
+    0x19, 0xc2, 0x00, 0xeb, 0x08, 0xb8, 0x10, 0x06, 0xc0, 0xc1, 0xa1, 0xc2,
+    0x00, 0xce, 0x08, 0xb8, 0xa1, 0x83, 0x08, 0xb8, 0x98, 0x16, 0xc0, 0xc1,
+    0xab, 0xc2, 0x00, 0xce, 0x08, 0xb8, 0x61, 0x83, 0x08, 0xb8, 0x20, 0x83,
+    0x08, 0xba, 0x01, 0xc2, 0x00, 0xce, 0x08, 0xb8, 0x58, 0x49, 0x0d, 0x49,
+    0x40, 0xc1, 0xb5, 0xc2, 0x00, 0xce, 0x08, 0xb8, 0xc9, 0x83, 0x08, 0xb8,
+    0x50, 0xc2, 0x00, 0xce, 0x08, 0xb8, 0xc1, 0x83, 0x08, 0xb8, 0x40, 0xc2,
+    0x00, 0xce, 0x08, 0xb8, 0xb9, 0x83, 0x08, 0xb8, 0xa8, 0xc2, 0x00, 0xce,
+    0x08, 0xb8, 0x39, 0x83, 0x08, 0xb8, 0x30, 0xc2, 0x00, 0xce, 0x08, 0xb8,
+    0x09, 0x83, 0x08, 0xb8, 0x00, 0xc5, 0xdd, 0xaf, 0x08, 0xb9, 0xf1, 0x15,
+    0xc0, 0xc1, 0xc7, 0xc6, 0xd3, 0x0a, 0x08, 0xb9, 0x58, 0xc4, 0x17, 0xf7,
+    0x08, 0xb9, 0xb9, 0xc2, 0x24, 0x36, 0x08, 0xb9, 0xb0, 0xc3, 0x0c, 0xf7,
+    0x08, 0xb9, 0xa9, 0xc3, 0x04, 0xa0, 0x08, 0xb9, 0xa0, 0xc4, 0x03, 0xe0,
+    0x08, 0xb9, 0x99, 0xc2, 0x01, 0xa2, 0x08, 0xb9, 0x90, 0x8f, 0x08, 0xb9,
+    0x51, 0x8b, 0x08, 0xb9, 0x49, 0x99, 0x08, 0xb9, 0x39, 0x83, 0x08, 0xb9,
+    0x08, 0x97, 0x08, 0xb9, 0x28, 0x8b, 0x08, 0xb9, 0x18, 0xca, 0x9a, 0xca,
+    0x08, 0xb8, 0xf9, 0x83, 0x08, 0xb8, 0xe8, 0xc2, 0x01, 0xe7, 0x01, 0x1c,
+    0xab, 0x00, 0xc1, 0xd3, 0x44, 0x47, 0xd4, 0x40, 0xc1, 0xd7, 0xc9, 0x50,
+    0x4f, 0x01, 0x1b, 0xb0, 0xc9, 0x50, 0x4f, 0x01, 0x1b, 0xc8, 0xc3, 0x01,
+    0x5d, 0x01, 0x1b, 0x9b, 0x00, 0xc1, 0xe3, 0xc5, 0xd7, 0xd8, 0x01, 0x19,
+    0xb0, 0xc2, 0x00, 0x4a, 0x01, 0x1b, 0xa1, 0xce, 0x73, 0xc0, 0x01, 0x1a,
+    0x30, 0x01, 0xc0, 0xc1, 0xe9, 0xca, 0x73, 0xc4, 0x01, 0x1a, 0x78, 0x43,
+    0x04, 0x67, 0xc0, 0xc1, 0xfb, 0x42, 0x01, 0x25, 0xc0, 0xc2, 0x05, 0xcf,
+    0x63, 0xb3, 0x01, 0x1a, 0xd0, 0xd1, 0x50, 0x47, 0x01, 0x1b, 0x71, 0x16,
+    0xc0, 0xc2, 0x0f, 0xc8, 0x7f, 0xb4, 0x01, 0x19, 0xf9, 0xca, 0xa2, 0x22,
+    0x01, 0x19, 0xb8, 0xc8, 0xba, 0xc0, 0x01, 0x1b, 0x51, 0x46, 0x00, 0x7d,
+    0x40, 0xc2, 0x1b, 0xcb, 0x98, 0x80, 0x01, 0x1b, 0x39, 0xca, 0x73, 0xc4,
+    0x01, 0x1a, 0x28, 0xc9, 0x20, 0xc3, 0x01, 0x1b, 0x21, 0xc8, 0x50, 0x50,
+    0x01, 0x1a, 0xd8, 0x49, 0x0b, 0x0b, 0xc0, 0xc2, 0x39, 0xcf, 0x67, 0x46,
+    0x01, 0x12, 0x80, 0x0a, 0xc0, 0xc2, 0x45, 0x15, 0xc0, 0xc2, 0x4f, 0xc2,
+    0x00, 0x98, 0x08, 0x59, 0x61, 0x1b, 0xc0, 0xc2, 0x5d, 0xc2, 0x00, 0xf1,
+    0x08, 0x59, 0x41, 0x10, 0xc0, 0xc2, 0x67, 0x06, 0xc0, 0xc2, 0x7b, 0x16,
+    0xc0, 0xc2, 0x85, 0xc2, 0x19, 0x48, 0x08, 0x58, 0xc1, 0xc2, 0x01, 0x0e,
+    0x08, 0x58, 0xb9, 0x09, 0xc0, 0xc2, 0x95, 0x1a, 0xc0, 0xc2, 0xa5, 0xc2,
+    0x00, 0x3e, 0x08, 0x58, 0x81, 0x97, 0x08, 0x58, 0x73, 0x00, 0xc2, 0xb5,
+    0x8b, 0x08, 0x58, 0x63, 0x00, 0xc2, 0xb9, 0x91, 0x08, 0x58, 0x53, 0x00,
+    0xc2, 0xbd, 0x87, 0x08, 0x58, 0x43, 0x00, 0xc2, 0xc1, 0x83, 0x08, 0x58,
+    0x03, 0x00, 0xc2, 0xc5, 0xc2, 0x00, 0x78, 0x08, 0x58, 0xf1, 0xc2, 0x15,
+    0x48, 0x08, 0x58, 0xf9, 0x04, 0xc0, 0xc2, 0xdb, 0xc2, 0x03, 0xe1, 0x08,
+    0x59, 0x69, 0xc2, 0x00, 0x2f, 0x08, 0x59, 0x71, 0x1c, 0x40, 0xc2, 0xe5,
+    0xc3, 0x05, 0x16, 0x08, 0x08, 0x3b, 0x00, 0xc2, 0xef, 0x16, 0xc0, 0xc2,
+    0xf3, 0x08, 0xc0, 0xc3, 0x04, 0x15, 0xc0, 0xc3, 0x0c, 0xc5, 0x0a, 0xfd,
+    0x08, 0x08, 0x73, 0x00, 0xc3, 0x1e, 0xc4, 0x28, 0x74, 0x08, 0x08, 0x7a,
+    0x00, 0xc3, 0x29, 0x46, 0x0d, 0xe6, 0xc0, 0xc3, 0x36, 0x4e, 0x73, 0x26,
+    0x40, 0xc3, 0x4c, 0xce, 0x71, 0xc8, 0x08, 0x09, 0xf1, 0xcd, 0x7a, 0xf6,
+    0x08, 0x09, 0xf8, 0x0e, 0xc0, 0xc3, 0x58, 0x46, 0x10, 0xe4, 0xc0, 0xc3,
+    0x64, 0x42, 0x00, 0xd8, 0xc0, 0xc3, 0x9d, 0x49, 0x06, 0xbd, 0xc0, 0xc3,
+    0xa9, 0x43, 0x10, 0xf4, 0xc0, 0xc3, 0xc1, 0x46, 0x01, 0x78, 0x40, 0xc3,
+    0xd9, 0xc6, 0x09, 0x2b, 0x0f, 0xbc, 0x81, 0xc6, 0x00, 0x7c, 0x0f, 0xbc,
+    0x30, 0xc6, 0x13, 0x38, 0x0f, 0xbd, 0x59, 0xd2, 0x4c, 0xa5, 0x0f, 0xbd,
+    0xb8, 0xd6, 0x06, 0xea, 0x01, 0x1f, 0x09, 0xcd, 0x00, 0x34, 0x01, 0x1e,
+    0xf9, 0xcb, 0x1a, 0x38, 0x01, 0x1e, 0xe9, 0xce, 0x22, 0x37, 0x01, 0x1d,
+    0xab, 0x00, 0xc3, 0xf1, 0x45, 0x04, 0x30, 0xc0, 0xc3, 0xf7, 0x46, 0x01,
+    0x78, 0xc0, 0xc4, 0x0f, 0x45, 0x00, 0x2f, 0xc0, 0xc4, 0x19, 0xd7, 0x16,
+    0x08, 0x01, 0x49, 0xd8, 0x46, 0x00, 0x91, 0x40, 0xc4, 0x23, 0x01, 0xc0,
+    0xc4, 0x2f, 0xc3, 0x00, 0xb1, 0x0f, 0x9d, 0x98, 0xc4, 0x01, 0x65, 0x0f,
+    0xa8, 0xb3, 0x00, 0xc4, 0x3b, 0x95, 0x0f, 0xa6, 0xd0, 0x84, 0x01, 0x88,
+    0x2b, 0x00, 0xc4, 0x41, 0x92, 0x01, 0x88, 0x31, 0x8f, 0x01, 0x88, 0x39,
+    0x88, 0x01, 0x88, 0x41, 0x86, 0x01, 0x88, 0x49, 0x96, 0x01, 0x88, 0x51,
+    0x90, 0x01, 0x88, 0x5b, 0x00, 0xc4, 0x45, 0x8e, 0x01, 0x88, 0x63, 0x00,
+    0xc4, 0x50, 0x89, 0x01, 0x88, 0x6b, 0x00, 0xc4, 0x54, 0x8d, 0x01, 0x88,
+    0x73, 0x00, 0xc4, 0x64, 0x8a, 0x01, 0x88, 0x79, 0x8c, 0x01, 0x88, 0x83,
+    0x00, 0xc4, 0x68, 0x93, 0x01, 0x88, 0x89, 0x9a, 0x01, 0x88, 0x91, 0x9c,
+    0x01, 0x88, 0xbb, 0x00, 0xc4, 0x6c, 0x85, 0x01, 0x88, 0xc3, 0x00, 0xc4,
+    0x78, 0x95, 0x01, 0x88, 0xcb, 0x00, 0xc4, 0x7c, 0x94, 0x01, 0x88, 0xb1,
+    0x83, 0x01, 0x88, 0xd3, 0x00, 0xc4, 0x80, 0x91, 0x01, 0x88, 0xdb, 0x00,
+    0xc4, 0x9d, 0x87, 0x01, 0x88, 0xe3, 0x00, 0xc4, 0xb7, 0x8b, 0x01, 0x89,
+    0x3b, 0x00, 0xc4, 0xce, 0x97, 0x01, 0x89, 0x43, 0x00, 0xc4, 0xe7, 0x98,
+    0x01, 0x89, 0x50, 0x92, 0x01, 0x8d, 0xa1, 0x96, 0x01, 0x8d, 0xa9, 0x8d,
+    0x01, 0x8d, 0xb1, 0x8a, 0x01, 0x8d, 0xb9, 0x89, 0x01, 0x8d, 0xd8, 0xa0,
+    0x0f, 0xd8, 0x03, 0x00, 0xc4, 0xed, 0xa2, 0x0f, 0xd8, 0x1b, 0x00, 0xc5,
+    0x0d, 0xa1, 0x0f, 0xd8, 0x0b, 0x00, 0xc5, 0x1f, 0xa4, 0x0f, 0xd8, 0x7b,
+    0x00, 0xc5, 0x38, 0xa3, 0x0f, 0xd8, 0x3b, 0x00, 0xc5, 0x3c, 0xa5, 0x0f,
+    0xd8, 0xf0, 0x01, 0xc0, 0xc5, 0x47, 0x1e, 0x40, 0xc5, 0x91, 0xc4, 0xcf,
+    0xbf, 0x0f, 0xa6, 0xc1, 0xc5, 0x19, 0xbe, 0x0f, 0xa4, 0xc8, 0x4a, 0xa0,
+    0x4c, 0x40, 0xc5, 0x9d, 0xc8, 0xbc, 0x20, 0x0f, 0xd3, 0x81, 0xc8, 0xba,
+    0xc8, 0x0f, 0xcf, 0xb1, 0x11, 0x40, 0xc5, 0xb5, 0x42, 0x04, 0xf2, 0xc0,
+    0xc5, 0xc4, 0x4f, 0x26, 0xc6, 0xc0, 0xc5, 0xd1, 0x46, 0xcd, 0x58, 0xc0,
+    0xc5, 0xe7, 0xc5, 0xd3, 0xb9, 0x00, 0xda, 0xe1, 0x46, 0x04, 0x99, 0xc0,
+    0xc5, 0xf3, 0x47, 0x01, 0x92, 0xc0, 0xc6, 0x17, 0xc9, 0xac, 0x31, 0x00,
+    0xda, 0x21, 0x4b, 0x6e, 0xbb, 0xc0, 0xc6, 0xbb, 0x45, 0x00, 0x8d, 0x40,
+    0xc6, 0xec, 0xcd, 0x7e, 0x02, 0x0f, 0x9e, 0x00, 0xc9, 0x11, 0xa1, 0x0b,
+    0x57, 0xa9, 0x4a, 0x57, 0x0d, 0xc0, 0xc7, 0x0a, 0x47, 0x01, 0x92, 0x40,
+    0xc7, 0x1c, 0xc6, 0x07, 0xf3, 0x0f, 0xb5, 0xe1, 0xc5, 0xd8, 0xff, 0x0f,
+    0xa3, 0xe1, 0xc6, 0x4f, 0x29, 0x0f, 0x9b, 0xe1, 0xc5, 0x56, 0xc4, 0x0f,
+    0xa1, 0x20, 0x12, 0xc0, 0xc7, 0x94, 0x83, 0x05, 0x35, 0x01, 0x0d, 0xc0,
+    0xc7, 0xaa, 0x97, 0x05, 0x35, 0x11, 0xc2, 0x00, 0xc8, 0x05, 0x35, 0x21,
+    0x14, 0xc0, 0xc7, 0xcd, 0x16, 0xc0, 0xc7, 0xdf, 0x91, 0x05, 0x35, 0x39,
+    0x10, 0xc0, 0xc7, 0xeb, 0x8b, 0x05, 0x35, 0x49, 0x0e, 0xc0, 0xc8, 0x18,
+    0x8f, 0x05, 0x35, 0x9b, 0x00, 0xc8, 0x30, 0x15, 0xc0, 0xc8, 0x48, 0x1b,
+    0xc0, 0xc8, 0x62, 0x19, 0xc0, 0xc8, 0x72, 0x08, 0x40, 0xc8, 0x7c, 0x0f,
+    0xc0, 0xc8, 0x92, 0xc3, 0x0d, 0xc9, 0x05, 0x37, 0xa0, 0x47, 0x03, 0x2d,
+    0xc0, 0xc8, 0x9e, 0x01, 0xc0, 0xc8, 0xa4, 0x15, 0x40, 0xc8, 0xb0, 0x15,
+    0xc0, 0xc8, 0xbc, 0x43, 0x3c, 0xbd, 0xc0, 0xc8, 0xc8, 0x4f, 0x2c, 0x5c,
+    0xc0, 0xc8, 0xd4, 0x4b, 0x6e, 0xbb, 0xc0, 0xc8, 0xde, 0x47, 0x01, 0x92,
+    0x40, 0xc9, 0x00, 0xc3, 0x3a, 0xe9, 0x0f, 0xb6, 0x08, 0xc5, 0xbe, 0xcb,
+    0x0f, 0xa6, 0x51, 0xc7, 0xc2, 0x76, 0x0f, 0xcf, 0xe0, 0xcf, 0x69, 0x08,
+    0x01, 0x33, 0x61, 0xcc, 0x83, 0x04, 0x01, 0x33, 0x59, 0xd8, 0x22, 0xd5,
+    0x0f, 0x9c, 0xe9, 0xd7, 0x26, 0x90, 0x0f, 0x9c, 0xe0, 0xc5, 0x10, 0x8c,
+    0x0f, 0xa1, 0xd9, 0xca, 0xa7, 0x4a, 0x0f, 0xce, 0xa0, 0xcc, 0x1d, 0x58,
+    0x01, 0x1f, 0x18, 0xc5, 0xdc, 0xa1, 0x0f, 0x9b, 0x89, 0x49, 0x09, 0x99,
+    0x40, 0xc9, 0x63, 0x03, 0xc0, 0xc9, 0x69, 0x15, 0xc0, 0xc9, 0x7b, 0x47,
+    0x01, 0x92, 0xc0, 0xc9, 0x87, 0x4b, 0x6e, 0xbb, 0xc0, 0xc9, 0xea, 0x46,
+    0x04, 0x99, 0xc0, 0xca, 0x0a, 0x46, 0x7c, 0xb3, 0xc0, 0xca, 0x2e, 0x49,
+    0x3b, 0xc6, 0xc0, 0xca, 0x3a, 0xc6, 0xca, 0x8e, 0x00, 0x4f, 0xd1, 0xca,
+    0x9d, 0x18, 0x00, 0x4f, 0xd8, 0xc6, 0x07, 0xf3, 0x01, 0x1b, 0xf1, 0xd8,
+    0x23, 0x35, 0x0f, 0xa8, 0xa9, 0xc6, 0xca, 0x5e, 0x0f, 0xd6, 0x88, 0xcf,
+    0x68, 0xbd, 0x0f, 0xa3, 0x29, 0xce, 0x2d, 0x6c, 0x0f, 0xa3, 0x20, 0xc9,
+    0x16, 0x67, 0x01, 0x10, 0xc8, 0xd1, 0x55, 0x0f, 0x0f, 0xab, 0x60, 0xce,
+    0x6e, 0x3a, 0x00, 0xd0, 0xf9, 0xc7, 0xc8, 0xa4, 0x00, 0xd0, 0xf1, 0x4b,
+    0x6e, 0xbb, 0xc0, 0xca, 0x46, 0x47, 0x01, 0x92, 0x40, 0xca, 0x5c, 0x97,
+    0x00, 0xba, 0x99, 0x8b, 0x00, 0xba, 0x90, 0xc2, 0x00, 0xce, 0x00, 0xba,
+    0x89, 0xc2, 0x0d, 0x01, 0x00, 0xba, 0x81, 0xc2, 0x00, 0x71, 0x00, 0xba,
+    0x79, 0xc2, 0x00, 0x89, 0x00, 0xba, 0x71, 0xc2, 0x00, 0x3b, 0x00, 0xba,
+    0x69, 0xc2, 0x1a, 0x18, 0x00, 0xba, 0x61, 0xc2, 0x00, 0xb6, 0x00, 0xba,
+    0x59, 0xc2, 0x00, 0xa0, 0x00, 0xba, 0x51, 0xc2, 0x04, 0xf2, 0x00, 0xba,
+    0x49, 0x10, 0xc0, 0xca, 0xbc, 0xc2, 0x0e, 0x60, 0x00, 0xba, 0x39, 0xc2,
+    0x00, 0x51, 0x00, 0xba, 0x31, 0xc2, 0x00, 0xeb, 0x00, 0xba, 0x21, 0xc2,
+    0x02, 0x4d, 0x00, 0xba, 0x19, 0x97, 0x00, 0xba, 0x11, 0x8b, 0x00, 0xba,
+    0x09, 0x83, 0x00, 0xba, 0x00, 0xcb, 0x8d, 0xee, 0x0f, 0xa3, 0x81, 0xcb,
+    0x8f, 0xdd, 0x0f, 0x98, 0x48, 0xc4, 0xe0, 0x8c, 0x0f, 0xa5, 0xe1, 0x95,
+    0x0f, 0xd3, 0x90, 0x4c, 0x86, 0x94, 0xc0, 0xca, 0xc6, 0x90, 0x0f, 0xcf,
+    0x00, 0x47, 0x37, 0xb8, 0xc0, 0xca, 0xd2, 0x47, 0x01, 0x92, 0xc0, 0xca,
+    0xff, 0x18, 0xc0, 0xcb, 0x67, 0x45, 0x00, 0x8d, 0xc0, 0xcb, 0x73, 0x06,
+    0xc0, 0xcb, 0x97, 0x4c, 0x10, 0x43, 0x40, 0xcb, 0xa9, 0xdb, 0x17, 0xcf,
+    0x01, 0x1c, 0x59, 0xc5, 0x19, 0xbe, 0x0f, 0xa4, 0xa1, 0xc3, 0x02, 0xca,
+    0x00, 0x05, 0x30, 0x86, 0x0f, 0x9a, 0xf1, 0xd0, 0x5e, 0xf2, 0x00, 0x04,
+    0x11, 0xca, 0x9a, 0xb6, 0x0f, 0xc9, 0x88, 0x42, 0x00, 0x4b, 0xc0, 0xcb,
+    0xb9, 0x46, 0xcf, 0x8c, 0xc0, 0xcb, 0xc5, 0xcb, 0x90, 0xc4, 0x0e, 0x82,
+    0x28, 0xc5, 0x89, 0x8f, 0x0e, 0x81, 0x23, 0x00, 0xcb, 0xd1, 0x46, 0xd1,
+    0xb4, 0xc0, 0xcb, 0xd5, 0x11, 0xc0, 0xcb, 0xe2, 0x14, 0xc0, 0xcb, 0xf7,
+    0x42, 0x01, 0x17, 0xc0, 0xcc, 0x03, 0xc6, 0xc6, 0xbb, 0x0e, 0x83, 0x08,
+    0x14, 0xc0, 0xcc, 0x0f, 0x12, 0xc0, 0xcc, 0x1b, 0x45, 0xdc, 0xf6, 0xc0,
+    0xcc, 0x2b, 0x10, 0x40, 0xcc, 0x43, 0x16, 0xc0, 0xcc, 0x4f, 0x48, 0xbe,
+    0x80, 0xc0, 0xcc, 0x64, 0xc5, 0xd6, 0x11, 0x0e, 0x81, 0x4b, 0x00, 0xcc,
+    0x76, 0x1b, 0xc0, 0xcc, 0x7c, 0xc7, 0xc2, 0x99, 0x0e, 0x80, 0xe8, 0x0b,
+    0xc0, 0xcc, 0x89, 0xc2, 0x31, 0xda, 0x0e, 0x81, 0x79, 0xc5, 0xd5, 0x7b,
+    0x0e, 0x80, 0x08, 0x42, 0x15, 0x48, 0xc0, 0xcc, 0xa6, 0x12, 0x40, 0xcc,
+    0xb2, 0x46, 0x3a, 0xa5, 0xc0, 0xcc, 0xbc, 0xda, 0x19, 0x62, 0x0e, 0x86,
+    0x29, 0x49, 0xac, 0xaf, 0x40, 0xcc, 0xe7, 0x44, 0xdf, 0x0c, 0xc0, 0xcc,
+    0xf9, 0x47, 0xc7, 0x85, 0xc0, 0xcd, 0x0b, 0x44, 0x5c, 0x87, 0x40, 0xcd,
+    0x17, 0x42, 0x01, 0x33, 0xc0, 0xcd, 0x21, 0x15, 0xc0, 0xcd, 0x2b, 0xc6,
+    0xcc, 0x62, 0x0e, 0x81, 0xf8, 0x10, 0xc0, 0xcd, 0x37, 0x46, 0xcd, 0x9a,
+    0xc0, 0xcd, 0x43, 0xc7, 0xc3, 0xb8, 0x0e, 0x83, 0x41, 0xc9, 0xae, 0x05,
+    0x0e, 0x83, 0x21, 0xc6, 0xd1, 0x18, 0x0e, 0x82, 0xa9, 0xce, 0x6c, 0x96,
+    0x0e, 0x80, 0x70, 0x48, 0xbd, 0xc8, 0xc0, 0xcd, 0x4f, 0xca, 0x9a, 0xc0,
+    0x0e, 0x82, 0xb8, 0x14, 0xc0, 0xcd, 0x6f, 0x07, 0xc0, 0xcd, 0x79, 0x0a,
+    0xc0, 0xcd, 0x8b, 0xc6, 0xcc, 0xf2, 0x0e, 0x81, 0x38, 0x07, 0xc0, 0xcd,
+    0x95, 0xc6, 0xc0, 0x71, 0x0e, 0x82, 0xe8, 0x49, 0xaf, 0xf4, 0xc0, 0xcd,
+    0xa1, 0xc5, 0xdb, 0xbb, 0x0e, 0x82, 0xd9, 0x44, 0xdf, 0x80, 0xc0, 0xcd,
+    0xad, 0x46, 0xd0, 0xee, 0x40, 0xcd, 0xb7, 0x42, 0x00, 0x8d, 0xc0, 0xcd,
+    0xc3, 0x42, 0x00, 0x72, 0xc0, 0xcd, 0xcd, 0x46, 0xd1, 0xe4, 0xc0, 0xcd,
+    0xd9, 0x07, 0x40, 0xcd, 0xe5, 0x44, 0xe2, 0xd0, 0xc0, 0xcd, 0xfa, 0xc3,
+    0x4c, 0x98, 0x0e, 0x80, 0xc8, 0xc6, 0xcd, 0x40, 0x0e, 0x81, 0xe1, 0xc4,
+    0xc7, 0x87, 0x0e, 0x81, 0x28, 0xc2, 0x0c, 0xf3, 0x08, 0xe3, 0x58, 0x9b,
+    0x08, 0xe3, 0x50, 0xc4, 0x17, 0xf7, 0x08, 0xe3, 0x03, 0x00, 0xce, 0x04,
+    0xc2, 0x24, 0x36, 0x08, 0xe2, 0xfa, 0x00, 0xce, 0x0a, 0x0b, 0xc0, 0xce,
+    0x10, 0x11, 0x40, 0xce, 0x1c, 0x0a, 0xc0, 0xce, 0x28, 0x19, 0xc0, 0xce,
+    0x34, 0xc2, 0x00, 0x79, 0x08, 0xe3, 0x18, 0xc4, 0x28, 0x74, 0x08, 0xe2,
+    0xc9, 0xc5, 0x0a, 0xfd, 0x08, 0xe2, 0xc1, 0x15, 0xc0, 0xce, 0x3e, 0x08,
+    0xc0, 0xce, 0x4a, 0x16, 0xc0, 0xce, 0x56, 0xc3, 0x05, 0x16, 0x08, 0xe2,
+    0x89, 0xc4, 0x18, 0xa7, 0x08, 0xe2, 0x80, 0xc7, 0x7e, 0x15, 0x08, 0xe2,
+    0x01, 0xc7, 0x14, 0x03, 0x08, 0xe1, 0xe8, 0xc4, 0x1f, 0xf7, 0x08, 0xe1,
+    0xf9, 0xc5, 0x40, 0xb0, 0x08, 0xe1, 0xf0, 0x97, 0x08, 0xe1, 0xd9, 0x8b,
+    0x08, 0xe1, 0xc9, 0x83, 0x08, 0xe1, 0x78, 0x8e, 0x08, 0xe1, 0xb1, 0x94,
+    0x08, 0xe1, 0xa2, 0x00, 0xce, 0x62, 0x97, 0x08, 0xe1, 0x98, 0x8b, 0x08,
+    0xe1, 0x88, 0x83, 0x08, 0xe1, 0x69, 0xc2, 0x0d, 0x01, 0x08, 0xe1, 0x61,
+    0xc2, 0x00, 0xce, 0x08, 0xe1, 0x58, 0x83, 0x08, 0xe1, 0x51, 0x47, 0xaa,
+    0xd3, 0x40, 0xce, 0x66, 0xc2, 0x00, 0xce, 0x08, 0xe1, 0x29, 0x83, 0x08,
+    0xe1, 0x20, 0xc2, 0x00, 0xce, 0x08, 0xe1, 0x19, 0x83, 0x08, 0xe1, 0x10,
+    0x83, 0x08, 0xe1, 0x09, 0xc2, 0x03, 0x83, 0x08, 0xe0, 0xe1, 0xc2, 0x1a,
+    0x18, 0x08, 0xe0, 0xb9, 0xc2, 0x00, 0xeb, 0x08, 0xe0, 0x90, 0xc2, 0x00,
+    0xce, 0x08, 0xe1, 0x01, 0x83, 0x08, 0xe0, 0xf9, 0x06, 0x40, 0xce, 0x71,
+    0xc2, 0x00, 0xce, 0x08, 0xe0, 0xf1, 0x83, 0x08, 0xe0, 0xe9, 0x16, 0x40,
+    0xce, 0x7b, 0xc2, 0x00, 0xce, 0x08, 0xe0, 0xb1, 0x83, 0x08, 0xe0, 0xa8,
+    0xc2, 0x00, 0xce, 0x08, 0xe0, 0xa1, 0x83, 0x08, 0xe0, 0x98, 0xc2, 0x00,
+    0xce, 0x08, 0xe0, 0x89, 0x83, 0x08, 0xe0, 0x80, 0xc2, 0x00, 0xce, 0x08,
+    0xe0, 0x79, 0x83, 0x08, 0xe0, 0x70, 0x97, 0x08, 0xe0, 0x69, 0x8b, 0x08,
+    0xe0, 0x59, 0x83, 0x08, 0xe0, 0x08, 0x97, 0x08, 0xe0, 0x28, 0x8b, 0x08,
+    0xe0, 0x18, 0x45, 0x00, 0x2f, 0xc0, 0xce, 0x85, 0x46, 0x01, 0x78, 0xc0,
+    0xce, 0xab, 0x16, 0xc0, 0xce, 0xd3, 0xce, 0x6c, 0x5e, 0x01, 0x38, 0x19,
+    0x45, 0x04, 0x30, 0xc0, 0xce, 0xdf, 0xd3, 0x46, 0x59, 0x01, 0x2c, 0x39,
+    0xd2, 0x4d, 0x23, 0x01, 0x2c, 0x29, 0x44, 0x05, 0x16, 0x40, 0xce, 0xf7,
+    0x04, 0xc0, 0xcf, 0x03, 0xc8, 0x09, 0x81, 0x01, 0x02, 0x71, 0xc4, 0x00,
+    0xdf, 0x00, 0x02, 0xf9, 0xc6, 0x4a, 0xa1, 0x01, 0x72, 0x3b, 0x00, 0xcf,
+    0x0f, 0xdb, 0x16, 0x3a, 0x01, 0x80, 0xf8, 0x46, 0x00, 0x71, 0xc0, 0xcf,
+    0x15, 0xc5, 0x32, 0xbd, 0x01, 0x3e, 0xe8, 0x46, 0x00, 0x71, 0xc0, 0xcf,
+    0x2d, 0x01, 0x40, 0xcf, 0x45, 0xc7, 0x2c, 0xbe, 0x01, 0x3e, 0x61, 0x47,
+    0xc6, 0x43, 0xc0, 0xcf, 0x51, 0xc3, 0x16, 0x8d, 0x0f, 0xd4, 0xc0, 0x01,
+    0x40, 0xcf, 0x57, 0x46, 0x00, 0x91, 0x40, 0xcf, 0x63, 0xc3, 0x05, 0x16,
+    0x00, 0x00, 0x71, 0xc4, 0x18, 0xa7, 0x00, 0x00, 0x78, 0x03, 0xc0, 0xcf,
+    0x7b, 0x42, 0x00, 0xce, 0xc0, 0xcf, 0x83, 0x14, 0xc0, 0xcf, 0x8f, 0xc8,
+    0x6e, 0xf6, 0x01, 0x3e, 0xe1, 0x11, 0xc0, 0xcf, 0x9b, 0x15, 0xc0, 0xcf,
+    0xa7, 0x05, 0xc0, 0xcf, 0xca, 0x16, 0xc0, 0xcf, 0xe5, 0x08, 0xc0, 0xcf,
+    0xf9, 0x4a, 0x06, 0xbd, 0xc0, 0xd0, 0x03, 0xcb, 0x1a, 0x38, 0x00, 0x01,
+    0x43, 0x00, 0xd0, 0x0f, 0xe0, 0x04, 0x69, 0x01, 0x16, 0x49, 0x42, 0x00,
+    0xd8, 0xc0, 0xd0, 0x13, 0x19, 0xc0, 0xd0, 0x1f, 0x04, 0xc0, 0xd0, 0x31,
+    0x0e, 0x40, 0xd0, 0x3d, 0x19, 0xc0, 0xd0, 0x49, 0x16, 0xc0, 0xd0, 0x58,
+    0xd0, 0x5c, 0xd2, 0x0f, 0xc1, 0xe1, 0xc5, 0x00, 0x83, 0x01, 0x0c, 0x83,
+    0x00, 0xd0, 0x6a, 0x14, 0xc0, 0xd0, 0x74, 0xd1, 0x55, 0xca, 0x01, 0x0f,
+    0xe9, 0x06, 0xc0, 0xd0, 0x80, 0x15, 0xc0, 0xd0, 0x8c, 0x0a, 0xc0, 0xd0,
+    0x98, 0xcd, 0x79, 0x7d, 0x01, 0x0e, 0x39, 0x04, 0xc0, 0xd0, 0xa2, 0xcf,
+    0x66, 0xdd, 0x01, 0x5a, 0x29, 0x08, 0xc0, 0xd0, 0xb4, 0xd7, 0x27, 0x8d,
+    0x0f, 0xc5, 0x20, 0x49, 0x01, 0x4c, 0xc0, 0xd0, 0xc0, 0x15, 0xc0, 0xd0,
+    0xd8, 0xdb, 0x16, 0xf7, 0x01, 0x37, 0x31, 0x49, 0x38, 0xfb, 0xc0, 0xd0,
+    0xe4, 0x47, 0x56, 0xb8, 0x40, 0xd0, 0xfc, 0xca, 0x34, 0x32, 0x01, 0x17,
+    0x31, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x40, 0xc3, 0x01, 0xa5, 0x01, 0x16,
+    0xb1, 0xcd, 0x7a, 0x8e, 0x01, 0x53, 0xc9, 0xd3, 0x42, 0x1e, 0x01, 0x53,
+    0xd8, 0x42, 0x00, 0x2d, 0xc0, 0xd1, 0x11, 0xcc, 0x85, 0xa4, 0x01, 0x13,
+    0x30, 0x45, 0x00, 0xd3, 0xc0, 0xd1, 0x2c, 0x43, 0x00, 0x6c, 0x40, 0xd1,
+    0x42, 0xd4, 0x05, 0x55, 0x01, 0x55, 0x40, 0x06, 0xc0, 0xd1, 0x4e, 0x16,
+    0xc0, 0xd1, 0x5e, 0x83, 0x00, 0xe1, 0x19, 0xc2, 0x00, 0x71, 0x00, 0xe1,
+    0x11, 0x15, 0xc0, 0xd1, 0x70, 0xc2, 0x02, 0x63, 0x00, 0xe0, 0xf9, 0x0a,
+    0xc0, 0xd1, 0x7a, 0xc2, 0x00, 0x89, 0x00, 0xe0, 0xe1, 0xc2, 0x00, 0x3b,
+    0x00, 0xe0, 0xd9, 0xc2, 0x1a, 0x18, 0x00, 0xe0, 0xd1, 0x0f, 0xc0, 0xd1,
+    0x84, 0x04, 0xc0, 0xd1, 0x8e, 0x08, 0xc0, 0xd1, 0x98, 0x12, 0xc0, 0xd1,
+    0xa2, 0x10, 0xc0, 0xd1, 0xb2, 0xc2, 0x21, 0x7d, 0x00, 0xe0, 0x41, 0x05,
+    0xc0, 0xd1, 0xc2, 0x09, 0xc0, 0xd1, 0xcc, 0x0d, 0x40, 0xd1, 0xd6, 0xc4,
+    0x28, 0x74, 0x00, 0xe2, 0x49, 0xc5, 0x0a, 0xfd, 0x00, 0xe2, 0x41, 0x15,
+    0xc0, 0xd1, 0xe6, 0x08, 0xc0, 0xd1, 0xf2, 0x16, 0xc0, 0xd1, 0xfe, 0xc3,
+    0x05, 0x16, 0x00, 0xe2, 0x09, 0xc4, 0x18, 0xa7, 0x00, 0xe2, 0x00, 0x16,
+    0xc0, 0xd2, 0x0a, 0xc6, 0xc0, 0xda, 0x00, 0xe1, 0xe9, 0xd2, 0x4c, 0x93,
+    0x00, 0xe1, 0xe0, 0x44, 0x00, 0x8e, 0xc0, 0xd2, 0x19, 0x50, 0x5e, 0x22,
+    0x40, 0xd2, 0x25, 0x8d, 0x00, 0xe1, 0x6b, 0x00, 0xd2, 0x31, 0x90, 0x00,
+    0xe1, 0x83, 0x00, 0xd2, 0x37, 0x96, 0x00, 0xe1, 0x99, 0x94, 0x00, 0xe1,
+    0x91, 0x92, 0x00, 0xe1, 0x89, 0x8e, 0x00, 0xe1, 0x79, 0x8f, 0x00, 0xe1,
+    0x70, 0x87, 0x00, 0xe1, 0x61, 0x97, 0x00, 0xe1, 0x53, 0x00, 0xd2, 0x3d,
+    0x91, 0x00, 0xe1, 0x43, 0x00, 0xd2, 0x41, 0x8b, 0x00, 0xe1, 0x39, 0xc2,
+    0x12, 0x99, 0x00, 0xe1, 0x30, 0x01, 0xc0, 0xd2, 0x45, 0xc4, 0x00, 0xb0,
+    0x01, 0x30, 0x3a, 0x00, 0xd2, 0x79, 0x1b, 0xc0, 0xd2, 0x82, 0xc2, 0x00,
+    0xa0, 0x05, 0x26, 0x81, 0x12, 0xc0, 0xd2, 0x8c, 0x06, 0xc0, 0xd2, 0x96,
+    0x16, 0xc0, 0xd2, 0xa0, 0x09, 0xc0, 0xd2, 0xb4, 0x0d, 0xc0, 0xd2, 0xbe,
+    0xc2, 0x21, 0x7d, 0x05, 0x26, 0xc9, 0x05, 0xc0, 0xd2, 0xc8, 0xc2, 0x00,
+    0xb6, 0x05, 0x26, 0xf9, 0x10, 0xc0, 0xd2, 0xd2, 0xc2, 0x00, 0x89, 0x05,
+    0x27, 0x09, 0x15, 0xc0, 0xd2, 0xdc, 0x1c, 0xc0, 0xd2, 0xe6, 0x0a, 0xc0,
+    0xd2, 0xf0, 0xc2, 0x66, 0x73, 0x05, 0x27, 0x39, 0xc2, 0x04, 0x70, 0x05,
+    0x27, 0x49, 0xc2, 0x00, 0x71, 0x05, 0x27, 0x51, 0x83, 0x05, 0x27, 0x73,
+    0x00, 0xd2, 0xfa, 0x87, 0x05, 0x27, 0x83, 0x00, 0xd2, 0xfe, 0x8b, 0x05,
+    0x27, 0x91, 0x91, 0x05, 0x27, 0x9b, 0x00, 0xd3, 0x02, 0x97, 0x05, 0x27,
+    0xa2, 0x00, 0xd3, 0x06, 0xc5, 0x04, 0x0c, 0x05, 0x27, 0xf1, 0xc9, 0x11,
+    0xa1, 0x05, 0x27, 0xf8, 0x01, 0xc0, 0xd3, 0x0e, 0x43, 0x00, 0x8a, 0x40,
+    0xd3, 0x29, 0xcd, 0x7c, 0xfe, 0x0f, 0xac, 0x39, 0xc7, 0x07, 0xf2, 0x0f,
+    0xa8, 0xb8, 0x46, 0x04, 0x99, 0xc0, 0xd3, 0x35, 0xcd, 0x30, 0xea, 0x00,
+    0xca, 0x29, 0xd0, 0x0e, 0xed, 0x00, 0xca, 0x21, 0x15, 0xc0, 0xd3, 0x59,
+    0x45, 0x35, 0x43, 0xc0, 0xd3, 0x6b, 0x47, 0x01, 0x92, 0x40, 0xd3, 0x77,
+    0x95, 0x08, 0x49, 0x9b, 0x00, 0xd3, 0xc6, 0x94, 0x08, 0x49, 0x69, 0x91,
+    0x08, 0x49, 0x61, 0x90, 0x08, 0x49, 0x5b, 0x00, 0xd3, 0xca, 0x8f, 0x08,
+    0x49, 0x51, 0x8e, 0x08, 0x49, 0x4b, 0x00, 0xd3, 0xce, 0x8d, 0x08, 0x49,
+    0x41, 0x9b, 0x08, 0x49, 0x39, 0x8b, 0x08, 0x49, 0x31, 0x98, 0x08, 0x49,
+    0x29, 0x87, 0x08, 0x49, 0x23, 0x00, 0xd3, 0xd2, 0x86, 0x08, 0x49, 0x19,
+    0x89, 0x08, 0x49, 0x11, 0x84, 0x08, 0x49, 0x09, 0x83, 0x08, 0x49, 0x03,
+    0x00, 0xd3, 0xd6, 0x96, 0x08, 0x49, 0x7b, 0x00, 0xd3, 0xda, 0x97, 0x08,
+    0x49, 0x81, 0x88, 0x08, 0x49, 0x89, 0x93, 0x08, 0x49, 0x91, 0x85, 0x08,
+    0x49, 0xc8, 0x90, 0x08, 0x14, 0xc8, 0x90, 0x08, 0x14, 0xd0, 0x8a, 0x08,
+    0x14, 0x18, 0x8a, 0x08, 0x14, 0x49, 0x96, 0x08, 0x14, 0xc0, 0x8d, 0x08,
+    0x14, 0xa0, 0x8f, 0x08, 0x14, 0x80, 0x90, 0x08, 0x14, 0x88, 0x01, 0xc0,
+    0xd3, 0xde, 0xc6, 0xc6, 0x59, 0x01, 0x55, 0x5a, 0x00, 0xd4, 0x1a, 0x45,
+    0x00, 0xb6, 0xc0, 0xd4, 0x20, 0x56, 0x2f, 0x48, 0x40, 0xd4, 0x2a, 0x15,
+    0xc0, 0xd4, 0x71, 0xd5, 0x31, 0xf0, 0x00, 0x14, 0xb3, 0x00, 0xd4, 0x86,
+    0x42, 0x03, 0xe1, 0xc0, 0xd4, 0x8c, 0x03, 0xc0, 0xd4, 0x9b, 0xd8, 0x25,
+    0x45, 0x00, 0xe9, 0x21, 0xcc, 0x22, 0xbd, 0x00, 0x14, 0xa3, 0x00, 0xd4,
+    0xa7, 0xdb, 0x14, 0xdb, 0x00, 0x14, 0xa9, 0x42, 0x01, 0x8e, 0xc0, 0xd4,
+    0xad, 0xc2, 0x1e, 0x72, 0x00, 0x0d, 0x31, 0xcf, 0x63, 0xc2, 0x00, 0x0d,
+    0xd9, 0xc4, 0x99, 0xcf, 0x00, 0x0d, 0xf9, 0xcc, 0x82, 0x2c, 0x00, 0x0e,
+    0x01, 0xcd, 0x7b, 0x92, 0x00, 0x0e, 0x08, 0xc4, 0x0d, 0x23, 0x01, 0x38,
+    0xe9, 0x48, 0x09, 0x3a, 0x40, 0xd4, 0xb9, 0xca, 0xa2, 0xc2, 0x05, 0x3f,
+    0xb9, 0x49, 0x10, 0xab, 0xc0, 0xd4, 0xc5, 0x0b, 0xc0, 0xd4, 0xcd, 0xc9,
+    0xac, 0x04, 0x05, 0x3f, 0xf8, 0xc9, 0xaf, 0x0a, 0x0f, 0x98, 0xe1, 0xc6,
+    0x07, 0xf3, 0x0f, 0x98, 0xb8, 0x0d, 0xc0, 0xd4, 0xd9, 0x12, 0xc0, 0xd4,
+    0xe1, 0x10, 0xc0, 0xd4, 0xf1, 0xc2, 0x00, 0xaa, 0x00, 0x74, 0x41, 0x15,
+    0xc0, 0xd5, 0x01, 0xc2, 0x00, 0xd8, 0x00, 0x74, 0xa1, 0x16, 0xc0, 0xd5,
+    0x0d, 0xc2, 0x00, 0xd3, 0x00, 0x74, 0xd1, 0x43, 0xc3, 0xa7, 0xc0, 0xd5,
+    0x17, 0xc2, 0x08, 0x04, 0x00, 0x75, 0x09, 0xc2, 0x31, 0xda, 0x00, 0x75,
+    0x11, 0xc2, 0x00, 0x57, 0x00, 0x75, 0x19, 0xc2, 0x00, 0x29, 0x00, 0x75,
+    0x2b, 0x00, 0xd5, 0x27, 0xc2, 0x01, 0xa2, 0x00, 0x75, 0x39, 0x43, 0x61,
+    0x7d, 0xc0, 0xd5, 0x2d, 0x91, 0x00, 0x75, 0x68, 0x83, 0x00, 0x75, 0x83,
+    0x00, 0xd5, 0x39, 0x45, 0xdb, 0xc5, 0xc0, 0xd5, 0x49, 0x8b, 0x00, 0x75,
+    0xa3, 0x00, 0xd5, 0x55, 0x9b, 0x00, 0x75, 0xb3, 0x00, 0xd5, 0x59, 0x97,
+    0x00, 0x75, 0xc3, 0x00, 0xd5, 0x5d, 0x87, 0x00, 0x76, 0x03, 0x00, 0xd5,
+    0x61, 0x91, 0x00, 0x76, 0x10, 0xcf, 0x61, 0x2e, 0x00, 0x75, 0xd1, 0x4e,
+    0x6e, 0xb8, 0x40, 0xd5, 0x65, 0xc2, 0x13, 0x86, 0x00, 0x76, 0x41, 0x16,
+    0xc0, 0xd5, 0x71, 0xc6, 0xce, 0x2a, 0x00, 0x76, 0x58, 0xc4, 0x18, 0xa7,
+    0x00, 0x76, 0x81, 0xc3, 0x05, 0x16, 0x00, 0x76, 0x89, 0x16, 0xc0, 0xd5,
+    0x7b, 0x08, 0xc0, 0xd5, 0x87, 0x15, 0xc0, 0xd5, 0x93, 0xc5, 0x0a, 0xfd,
+    0x00, 0x76, 0xc1, 0xc4, 0x28, 0x74, 0x00, 0x76, 0xc8, 0xc2, 0x00, 0x10,
+    0x00, 0x76, 0xe1, 0xc2, 0x08, 0x04, 0x00, 0x76, 0xe8, 0x16, 0xc0, 0xd5,
+    0x9f, 0x4f, 0x60, 0xd4, 0xc0, 0xd5, 0xab, 0x4f, 0x02, 0xea, 0xc0, 0xd5,
+    0xb7, 0xda, 0x1d, 0x24, 0x01, 0x3a, 0x81, 0xc6, 0xcc, 0xe6, 0x01, 0x38,
+    0x81, 0xd5, 0x35, 0xf5, 0x01, 0x2e, 0xe9, 0x43, 0x04, 0x74, 0x40, 0xd5,
+    0xc3, 0x16, 0xc0, 0xd5, 0xc9, 0x4f, 0x60, 0xd4, 0xc0, 0xd5, 0xd5, 0xcf,
+    0x63, 0xe0, 0x01, 0x3e, 0xa1, 0xd5, 0x35, 0xf5, 0x01, 0x2e, 0xe1, 0x44,
+    0x1f, 0x8c, 0x40, 0xd5, 0xe1, 0x0e, 0xc0, 0xd5, 0xe7, 0x4f, 0x2b, 0xb2,
+    0x40, 0xd5, 0xf3, 0x48, 0x04, 0x35, 0xc0, 0xd5, 0xf9, 0xc5, 0x06, 0x84,
+    0x01, 0x2c, 0x03, 0x00, 0xd6, 0x03, 0xc6, 0x00, 0x7c, 0x01, 0x2f, 0x01,
+    0xcc, 0x04, 0x3d, 0x0f, 0xdc, 0x70, 0xcc, 0x0a, 0xfd, 0x01, 0x2c, 0xa1,
+    0xcd, 0x15, 0xdc, 0x0f, 0xdc, 0x10, 0xdb, 0x15, 0xce, 0x0f, 0xdb, 0x69,
+    0x45, 0x03, 0xe0, 0x40, 0xd6, 0x09, 0xc5, 0x00, 0x83, 0x01, 0x0f, 0x3b,
+    0x00, 0xd6, 0x15, 0xcc, 0x84, 0x84, 0x01, 0x0f, 0x72, 0x00, 0xd6, 0x19,
+    0x42, 0x00, 0x4c, 0xc0, 0xd6, 0x1f, 0x42, 0x01, 0xa2, 0x40, 0xd6, 0x2b,
+    0xcf, 0x5b, 0xf3, 0x0f, 0xc2, 0x89, 0xcc, 0x86, 0xd0, 0x0f, 0xc1, 0xc8,
+    0xc4, 0x00, 0x84, 0x01, 0x0c, 0x8b, 0x00, 0xd6, 0x37, 0xc5, 0xda, 0x62,
+    0x01, 0x70, 0xa8, 0xcb, 0x84, 0xcd, 0x01, 0x0f, 0x09, 0xcb, 0x84, 0x85,
+    0x01, 0x0e, 0x88, 0x51, 0x05, 0x34, 0xc0, 0xd6, 0x3b, 0x45, 0x10, 0xe5,
+    0x40, 0xd6, 0x47, 0xc5, 0x00, 0x83, 0x01, 0x58, 0x31, 0xd3, 0x45, 0x9b,
+    0x01, 0x5c, 0x48, 0xc8, 0x2c, 0x54, 0x0f, 0xb7, 0x41, 0xcc, 0x47, 0x53,
+    0x0f, 0xa9, 0xe0, 0xd0, 0x59, 0x82, 0x01, 0x2f, 0x71, 0xcf, 0x66, 0x47,
+    0x01, 0x2f, 0x68, 0xd2, 0x49, 0x57, 0x01, 0x3e, 0xf8, 0xc4, 0x01, 0xe5,
+    0x01, 0x18, 0x1b, 0x00, 0xd6, 0x53, 0xcf, 0x65, 0x48, 0x01, 0x4d, 0xe8,
+    0xcb, 0x03, 0x3e, 0x01, 0x0f, 0x99, 0xcc, 0x84, 0x84, 0x01, 0x0e, 0xa9,
+    0xc5, 0x00, 0x83, 0x01, 0x0c, 0xab, 0x00, 0xd6, 0x57, 0xcb, 0x94, 0xc3,
+    0x01, 0x58, 0x69, 0xd5, 0x02, 0xb4, 0x01, 0x5b, 0x29, 0xd0, 0x5b, 0xf2,
+    0x0f, 0xc2, 0xc8, 0x4f, 0x66, 0x29, 0xc0, 0xd6, 0x5d, 0x50, 0x57, 0xc2,
+    0x40, 0xd6, 0x69, 0x01, 0x40, 0xd6, 0x75, 0xca, 0x1b, 0x3f, 0x00, 0x00,
+    0xf9, 0xc9, 0x6e, 0xaf, 0x01, 0x5f, 0xd0, 0xc3, 0xa4, 0xac, 0x08, 0x1c,
+    0x01, 0xc2, 0x00, 0xaf, 0x08, 0x1c, 0x98, 0xc4, 0xd0, 0xc2, 0x08, 0x1c,
+    0x11, 0xc4, 0x93, 0x22, 0x08, 0x1c, 0xc8, 0xc2, 0x00, 0xce, 0x08, 0x1c,
+    0x19, 0xc2, 0x0f, 0xbb, 0x08, 0x1c, 0x58, 0xc4, 0xd6, 0x99, 0x08, 0x1c,
+    0x21, 0xc3, 0x04, 0x30, 0x08, 0x1c, 0x78, 0xc2, 0x00, 0x51, 0x08, 0x1c,
+    0x40, 0xc3, 0x07, 0x09, 0x08, 0x1c, 0x39, 0x97, 0x08, 0x1c, 0x88, 0xc2,
+    0x00, 0x3f, 0x08, 0x1c, 0x49, 0xc5, 0xde, 0x09, 0x08, 0x1c, 0xc1, 0x91,
+    0x08, 0x1c, 0xd0, 0xc3, 0x11, 0x9a, 0x08, 0x1c, 0x61, 0x03, 0xc0, 0xd6,
+    0x87, 0xc2, 0x02, 0x0b, 0x08, 0x1c, 0xe8, 0x0a, 0xc0, 0xd6, 0x93, 0x07,
+    0xc0, 0xd6, 0x9f, 0x19, 0xc0, 0xd6, 0xb1, 0x15, 0xc0, 0xd6, 0xc3, 0x46,
+    0x08, 0x9f, 0xc0, 0xd6, 0xdd, 0x0e, 0xc0, 0xd6, 0xe9, 0x16, 0xc0, 0xd6,
+    0xff, 0x04, 0xc0, 0xd7, 0x11, 0x42, 0x00, 0x6f, 0xc0, 0xd7, 0x1d, 0x05,
+    0xc0, 0xd7, 0x29, 0x06, 0xc0, 0xd7, 0x3e, 0x14, 0xc0, 0xd7, 0x4e, 0x0f,
+    0xc0, 0xd7, 0x5a, 0xc9, 0x64, 0xb2, 0x01, 0x3c, 0xa9, 0xcc, 0x06, 0xbd,
+    0x01, 0x3a, 0xd1, 0x03, 0xc0, 0xd7, 0x66, 0x11, 0xc0, 0xd7, 0x78, 0x08,
+    0xc0, 0xd7, 0x8a, 0xcb, 0x57, 0x87, 0x01, 0x38, 0xd1, 0xd4, 0x11, 0x79,
+    0x0f, 0xb3, 0xc8, 0xc5, 0xac, 0xaa, 0x0f, 0xd5, 0x33, 0x00, 0xd7, 0x96,
+    0xc5, 0x35, 0x15, 0x0f, 0x9d, 0x38, 0x42, 0x00, 0x32, 0xc0, 0xd7, 0x9c,
+    0xcf, 0x67, 0x0a, 0x0f, 0xb2, 0x48, 0xd3, 0x46, 0xa5, 0x01, 0x36, 0x89,
+    0xc7, 0x07, 0xf2, 0x01, 0x1c, 0x40, 0x42, 0x33, 0x5c, 0xc0, 0xd7, 0xae,
+    0x42, 0x31, 0x45, 0xc0, 0xd7, 0xc6, 0x42, 0x12, 0xa3, 0xc0, 0xd7, 0xe2,
+    0x42, 0x29, 0x2c, 0xc0, 0xd7, 0xf2, 0x42, 0x00, 0xdd, 0x40, 0xd8, 0x0a,
+    0x42, 0x29, 0x2c, 0xc0, 0xd8, 0x1a, 0x42, 0x00, 0xdd, 0xc0, 0xd8, 0x3a,
+    0x42, 0x33, 0x5c, 0xc0, 0xd8, 0x56, 0x42, 0x31, 0x45, 0xc0, 0xd8, 0x62,
+    0x42, 0x12, 0xa3, 0x40, 0xd8, 0x7e, 0x42, 0x29, 0x2c, 0xc0, 0xd8, 0xa5,
+    0x42, 0x00, 0xdd, 0xc0, 0xd8, 0xb9, 0x42, 0x33, 0x5c, 0xc0, 0xd8, 0xd7,
+    0x42, 0x31, 0x45, 0xc0, 0xd8, 0xe3, 0x42, 0x12, 0xa3, 0xc0, 0xd9, 0x05,
+    0x47, 0xbf, 0xcf, 0x40, 0xd9, 0x29, 0x42, 0x29, 0x2c, 0xc0, 0xd9, 0x31,
+    0x42, 0x00, 0xdd, 0xc0, 0xd9, 0x43, 0x42, 0x33, 0x5c, 0xc0, 0xd9, 0x5b,
+    0x42, 0x31, 0x45, 0xc0, 0xd9, 0x77, 0x42, 0x12, 0xa3, 0x40, 0xd9, 0x97,
+    0xa2, 0x0d, 0x80, 0xb1, 0xa1, 0x0d, 0x80, 0xa9, 0xa0, 0x0d, 0x80, 0xa0,
+    0xa5, 0x0d, 0x80, 0x99, 0xa4, 0x0d, 0x80, 0x91, 0xa3, 0x0d, 0x80, 0x89,
+    0xa2, 0x0d, 0x80, 0x81, 0xa1, 0x0d, 0x80, 0x79, 0xa0, 0x0d, 0x80, 0x08,
+    0xa4, 0x0d, 0x80, 0x71, 0xa3, 0x0d, 0x80, 0x69, 0xa2, 0x0d, 0x80, 0x61,
+    0xa1, 0x0d, 0x80, 0x59, 0xa0, 0x0d, 0x80, 0x50, 0xa3, 0x0d, 0x80, 0x49,
+    0xa2, 0x0d, 0x80, 0x41, 0xa1, 0x0d, 0x80, 0x39, 0xa0, 0x0d, 0x80, 0x30,
+    0xc2, 0x01, 0xa2, 0x0d, 0x80, 0x29, 0xa2, 0x0d, 0x80, 0x21, 0xa1, 0x0d,
+    0x80, 0x19, 0xa0, 0x0d, 0x80, 0x10, 0x42, 0x29, 0x2c, 0xc0, 0xd9, 0xc4,
+    0x42, 0x00, 0xdd, 0xc0, 0xd9, 0xe0, 0x42, 0x31, 0x45, 0xc0, 0xd9, 0xf0,
+    0x42, 0x12, 0xa3, 0x40, 0xda, 0x04, 0x42, 0x12, 0xa3, 0xc0, 0xda, 0x18,
+    0x42, 0x33, 0x5c, 0xc0, 0xda, 0x32, 0x42, 0x29, 0x2c, 0x40, 0xda, 0x42,
+    0x42, 0x29, 0x2c, 0xc0, 0xda, 0x5a, 0x42, 0x00, 0xdd, 0xc0, 0xda, 0x72,
+    0x42, 0x33, 0x5c, 0xc0, 0xda, 0x80, 0x42, 0x31, 0x45, 0xc0, 0xda, 0x90,
+    0x42, 0x12, 0xa3, 0x40, 0xda, 0xac, 0x42, 0x29, 0x2c, 0xc0, 0xda, 0xc8,
+    0x42, 0x00, 0xdd, 0xc0, 0xda, 0xe6, 0x42, 0x31, 0x45, 0xc0, 0xdb, 0x0a,
+    0x42, 0x12, 0xa3, 0xc0, 0xdb, 0x26, 0x42, 0x33, 0x5c, 0x40, 0xdb, 0x36,
+    0x42, 0x29, 0x2c, 0xc0, 0xdb, 0x4c, 0x42, 0x00, 0xdd, 0xc0, 0xdb, 0x68,
+    0x42, 0x33, 0x5c, 0xc0, 0xdb, 0x7c, 0x42, 0x31, 0x45, 0xc0, 0xdb, 0x9c,
+    0x42, 0x12, 0xa3, 0x40, 0xdb, 0xb4, 0x48, 0x1b, 0xd9, 0xc0, 0xdb, 0xd4,
+    0x46, 0x01, 0x93, 0x40, 0xdb, 0xe0, 0x45, 0x14, 0x56, 0xc0, 0xdc, 0x76,
+    0x4b, 0x10, 0x44, 0x40, 0xdc, 0xa6, 0xc9, 0xab, 0x08, 0x00, 0x2e, 0x29,
+    0xc9, 0xab, 0xa1, 0x00, 0x2e, 0x21, 0xcd, 0x78, 0xee, 0x00, 0x2d, 0x78,
+    0x1c, 0xc0, 0xdc, 0xc4, 0x06, 0xc0, 0xdc, 0xce, 0xc4, 0xdf, 0x14, 0x00,
+    0x2d, 0x61, 0xc3, 0x12, 0x1b, 0x00, 0x2d, 0x59, 0x42, 0x0d, 0x1e, 0xc0,
+    0xdc, 0xda, 0x16, 0xc0, 0xdc, 0xe6, 0x42, 0x0f, 0xba, 0xc0, 0xdc, 0xf0,
+    0xcc, 0x86, 0xb8, 0x00, 0x2d, 0x11, 0x42, 0x04, 0xf2, 0xc0, 0xdc, 0xfc,
+    0xc5, 0x4d, 0x5c, 0x00, 0x2c, 0xb9, 0x15, 0xc0, 0xdd, 0x08, 0xc7, 0xc8,
+    0x65, 0x00, 0x2c, 0x89, 0x43, 0x01, 0x3d, 0xc0, 0xdd, 0x14, 0x0f, 0x40,
+    0xdd, 0x23, 0x43, 0x00, 0x61, 0xc0, 0xdd, 0x38, 0xc7, 0x0d, 0x52, 0x02,
+    0x6e, 0x48, 0x0b, 0xc0, 0xdd, 0x68, 0xc7, 0xca, 0x09, 0x02, 0x6e, 0xf9,
+    0xd5, 0x37, 0x6f, 0x02, 0x6f, 0x19, 0x07, 0x40, 0xdd, 0x74, 0xc6, 0x78,
+    0xe8, 0x02, 0x6e, 0x21, 0xd2, 0x47, 0xef, 0x02, 0x6e, 0x88, 0x10, 0xc0,
+    0xdd, 0x86, 0xcc, 0x84, 0x60, 0x02, 0x6f, 0x58, 0x45, 0x00, 0xb6, 0xc0,
+    0xdd, 0x92, 0xc9, 0xb3, 0xff, 0x02, 0x6e, 0x59, 0xce, 0x70, 0xf6, 0x02,
+    0x6e, 0xb0, 0xc4, 0x96, 0x6c, 0x02, 0x6e, 0x51, 0xc7, 0xc1, 0x9d, 0x02,
+    0x6f, 0x11, 0xcd, 0x7c, 0xf1, 0x02, 0x6f, 0x68, 0xc9, 0xa8, 0xc8, 0x02,
+    0x6e, 0x61, 0xc8, 0xb9, 0x40, 0x02, 0x6e, 0x80, 0x14, 0xc0, 0xdd, 0x9e,
+    0xd1, 0x50, 0x8b, 0x02, 0x6f, 0x60, 0xc5, 0xd6, 0x84, 0x02, 0x6e, 0x71,
+    0xcb, 0x94, 0x6b, 0x02, 0x6e, 0xd0, 0xc7, 0xbf, 0xf2, 0x02, 0x6e, 0x91,
+    0xc8, 0xbc, 0xb0, 0x02, 0x6f, 0xb1, 0xcf, 0x61, 0x88, 0x02, 0x6f, 0xf0,
+    0xcd, 0x75, 0xbb, 0x02, 0x6e, 0xa1, 0xcb, 0x96, 0xbd, 0x02, 0x6f, 0x51,
+    0xd0, 0x5b, 0x22, 0x02, 0x6f, 0xf8, 0x16, 0xc0, 0xdd, 0xaa, 0xc8, 0xb7,
+    0x50, 0x02, 0x6f, 0x80, 0x10, 0xc0, 0xdd, 0xb6, 0xc7, 0xc0, 0xbd, 0x02,
+    0x6e, 0xf1, 0xc6, 0xd1, 0x8a, 0x02, 0x6f, 0x48, 0x42, 0x06, 0x51, 0xc0,
+    0xdd, 0xc2, 0xca, 0x9b, 0xec, 0x02, 0x6f, 0x30, 0x51, 0x51, 0x24, 0xc0,
+    0xdd, 0xce, 0xd5, 0x33, 0xfd, 0x01, 0x35, 0x49, 0x4a, 0x9e, 0xf8, 0xc0,
+    0xdd, 0xec, 0xce, 0x6d, 0x4c, 0x01, 0x1d, 0x79, 0xc8, 0x26, 0x15, 0x01,
+    0x01, 0x31, 0x04, 0xc0, 0xdd, 0xfc, 0x16, 0x40, 0xde, 0x08, 0x01, 0x40,
+    0xde, 0x14, 0xc7, 0xc7, 0xf5, 0x01, 0x33, 0x41, 0xc8, 0xbe, 0x10, 0x01,
+    0x30, 0xa9, 0xc6, 0xca, 0x5e, 0x0f, 0x99, 0xb1, 0xc3, 0xd1, 0x03, 0x0f,
+    0x99, 0x68, 0xd2, 0x4a, 0xe3, 0x01, 0x1f, 0x98, 0x01, 0x40, 0xde, 0x20,
+    0xd0, 0x0d, 0xac, 0x0f, 0xb3, 0x48, 0x83, 0x0f, 0xd5, 0x61, 0xc8, 0xbc,
+    0xd0, 0x0f, 0xa1, 0xc8, 0x45, 0x00, 0x6a, 0x40, 0xde, 0x2f, 0x42, 0x00,
+    0xa0, 0xc0, 0xde, 0x41, 0xc5, 0xc5, 0xd4, 0x0f, 0xc8, 0xe9, 0x4c, 0x8b,
+    0xec, 0x40, 0xde, 0x4b, 0x46, 0x04, 0x99, 0xc0, 0xde, 0x57, 0x45, 0x00,
+    0x8d, 0xc0, 0xde, 0x7b, 0x45, 0x01, 0x69, 0xc0, 0xde, 0x87, 0x46, 0x35,
+    0x43, 0xc0, 0xde, 0x93, 0x47, 0x01, 0x92, 0x40, 0xde, 0xa7, 0xcd, 0x7c,
+    0x21, 0x00, 0xb9, 0xa1, 0x4b, 0x6e, 0xbb, 0xc0, 0xdf, 0x11, 0x47, 0x01,
+    0x92, 0x40, 0xdf, 0x19, 0x43, 0x4b, 0xab, 0xc0, 0xdf, 0x77, 0x4d, 0x79,
+    0xff, 0x40, 0xdf, 0x99, 0x47, 0x37, 0xb8, 0xc0, 0xdf, 0xb7, 0x47, 0x01,
+    0x92, 0x40, 0xdf, 0xca, 0xc9, 0x11, 0xa1, 0x07, 0xfb, 0x09, 0xc5, 0x04,
+    0x0c, 0x07, 0xfb, 0x20, 0xcf, 0x69, 0xf8, 0x07, 0xfb, 0x11, 0xcb, 0x02,
+    0xfe, 0x07, 0xff, 0x48, 0xcf, 0x69, 0xf8, 0x07, 0xfb, 0x19, 0xcb, 0x02,
+    0xfe, 0x07, 0xff, 0x58, 0x01, 0xc0, 0xe0, 0x27, 0xde, 0x0d, 0xbc, 0x07,
+    0xfb, 0x80, 0xc6, 0x22, 0x0f, 0x07, 0xfd, 0x01, 0x47, 0x01, 0x92, 0x40,
+    0xe0, 0x3f, 0xcb, 0x93, 0x84, 0x0f, 0xb4, 0x23, 0x00, 0xe0, 0x99, 0xcb,
+    0x8e, 0x1a, 0x0f, 0xa3, 0x00, 0xcc, 0x8b, 0x38, 0x01, 0x35, 0x09, 0xd1,
+    0x53, 0xee, 0x0f, 0xa8, 0x30, 0x83, 0x01, 0x82, 0x13, 0x00, 0xe0, 0x9f,
+    0x15, 0xc0, 0xe0, 0xa5, 0x8b, 0x01, 0x82, 0x21, 0x97, 0x01, 0x82, 0x31,
+    0x87, 0x01, 0x82, 0x41, 0x91, 0x01, 0x82, 0x51, 0x0d, 0xc0, 0xe0, 0xbf,
+    0x09, 0xc0, 0xe0, 0xd3, 0x1c, 0xc0, 0xe0, 0xe7, 0x16, 0xc0, 0xe0, 0xfb,
+    0x06, 0xc0, 0xe1, 0x0f, 0x90, 0x01, 0x84, 0x9b, 0x00, 0xe1, 0x23, 0x0a,
+    0xc0, 0xe1, 0x37, 0x04, 0xc0, 0xe1, 0x4b, 0x12, 0xc0, 0xe1, 0x5f, 0x0f,
+    0xc0, 0xe1, 0x73, 0x1b, 0xc0, 0xe1, 0x87, 0x14, 0xc0, 0xe1, 0x93, 0x19,
+    0xc0, 0xe1, 0xa7, 0xc2, 0x57, 0xe3, 0x01, 0x84, 0xa0, 0x01, 0xc0, 0xe1,
+    0xb7, 0xcb, 0x97, 0x15, 0x01, 0x01, 0x39, 0xc6, 0x8a, 0x5a, 0x00, 0x01,
+    0x68, 0x43, 0x04, 0x3a, 0xc0, 0xe1, 0xc3, 0x44, 0x02, 0x21, 0x40, 0xe1,
+    0xe1, 0xc4, 0x23, 0xdf, 0x01, 0x03, 0x21, 0xc9, 0x1b, 0x40, 0x01, 0x03,
+    0x19, 0xc5, 0x00, 0xef, 0x01, 0x03, 0x10, 0xcf, 0x63, 0x77, 0x0f, 0xa9,
+    0x01, 0xc7, 0x63, 0x7f, 0x0f, 0xa9, 0x21, 0xcd, 0x7f, 0x88, 0x0f, 0xa9,
+    0x08, 0x0e, 0xc0, 0xe2, 0x09, 0xc6, 0xca, 0x3a, 0x01, 0x15, 0xd1, 0xc7,
+    0x00, 0x42, 0x01, 0x11, 0x4b, 0x00, 0xe2, 0x15, 0xc6, 0x11, 0x7e, 0x01,
+    0x01, 0xe9, 0xcb, 0x37, 0xcd, 0x01, 0x51, 0xe0, 0x01, 0x40, 0xe2, 0x19,
+    0x46, 0x65, 0xf6, 0xc0, 0xe2, 0x29, 0x47, 0xc4, 0x98, 0x40, 0xe2, 0x35,
+    0xda, 0x1c, 0xf0, 0x01, 0x4e, 0xf0, 0x15, 0xc0, 0xe2, 0x41, 0xcb, 0x96,
+    0x02, 0x0f, 0xa4, 0x08, 0xc4, 0x03, 0x85, 0x01, 0x10, 0x31, 0x43, 0x2d,
+    0x2d, 0x40, 0xe2, 0x4d, 0xcc, 0x82, 0x14, 0x0f, 0xa7, 0x41, 0xce, 0x70,
+    0x5c, 0x01, 0x4e, 0xe0, 0xcd, 0x7c, 0xb0, 0x01, 0x05, 0xc9, 0x48, 0xbc,
+    0x78, 0x40, 0xe2, 0x59, 0xd7, 0x29, 0xe3, 0x0f, 0xd7, 0xa8, 0xc2, 0x00,
+    0x5d, 0x01, 0x13, 0x0b, 0x00, 0xe2, 0x7d, 0xce, 0x33, 0x32, 0x01, 0x53,
+    0x38, 0x4a, 0x9a, 0xfc, 0xc0, 0xe2, 0x83, 0x49, 0xa7, 0xf9, 0x40, 0xe2,
+    0x91, 0x54, 0x3c, 0x52, 0xc0, 0xe2, 0x9d, 0xd1, 0x2a, 0xb8, 0x01, 0x81,
+    0x60, 0xc4, 0x04, 0x0d, 0x01, 0x80, 0x09, 0xcb, 0x91, 0x48, 0x01, 0x80,
+    0x30, 0xcc, 0x87, 0xa8, 0x01, 0x8c, 0x81, 0xcc, 0x81, 0xa8, 0x01, 0x8c,
+    0x89, 0xc8, 0x2a, 0xc1, 0x01, 0x8c, 0x91, 0x16, 0xc0, 0xe2, 0xbb, 0x08,
+    0xc0, 0xe2, 0xcb, 0x0f, 0xc0, 0xe2, 0xd7, 0xcb, 0x99, 0x1a, 0x01, 0x8c,
+    0xc1, 0xcb, 0x91, 0xab, 0x01, 0x8c, 0xd1, 0xcb, 0x8f, 0x7a, 0x01, 0x8c,
+    0xe9, 0xca, 0xa6, 0x14, 0x01, 0x8c, 0xf0, 0x47, 0x37, 0xb8, 0xc0, 0xe2,
+    0xe3, 0xcc, 0x81, 0xd8, 0x08, 0x42, 0xb9, 0x47, 0x01, 0x92, 0x40, 0xe2,
+    0xf0, 0xc8, 0x79, 0x9c, 0x0f, 0xb3, 0xf3, 0x00, 0xe3, 0x53, 0xc5, 0x01,
+    0x64, 0x01, 0x38, 0x98, 0xce, 0x71, 0xba, 0x0f, 0xa7, 0x19, 0xc8, 0xbb,
+    0x20, 0x0f, 0xce, 0x00, 0x14, 0xc0, 0xe3, 0x59, 0x45, 0xd4, 0x72, 0x40,
+    0xe3, 0x65, 0x94, 0x0f, 0xd4, 0x89, 0xc2, 0x05, 0x83, 0x01, 0x36, 0x98,
+    0x47, 0xc9, 0xca, 0xc0, 0xe3, 0x71, 0x47, 0x0b, 0xf5, 0x40, 0xe3, 0x80,
+    0x47, 0x01, 0x92, 0xc0, 0xe3, 0x8f, 0x18, 0xc0, 0xe3, 0xf1, 0xcd, 0x30,
+    0xea, 0x08, 0x8a, 0x19, 0x06, 0xc0, 0xe3, 0xfd, 0x15, 0xc0, 0xe4, 0x0f,
+    0xc7, 0xc0, 0x46, 0x08, 0x89, 0xa1, 0xc7, 0xc1, 0xd5, 0x08, 0x89, 0x91,
+    0xc6, 0xb6, 0xd2, 0x08, 0x89, 0x88, 0x4f, 0x2c, 0x5c, 0xc0, 0xe4, 0x1b,
+    0x4b, 0x6e, 0xbb, 0xc0, 0xe4, 0x39, 0x47, 0x01, 0x92, 0xc0, 0xe4, 0x58,
+    0x4c, 0x10, 0x43, 0xc0, 0xe4, 0xc1, 0x46, 0x04, 0x99, 0x40, 0xe4, 0xd1,
+    0xcc, 0x85, 0x2c, 0x0f, 0xb5, 0xc0, 0x47, 0x37, 0xb8, 0xc0, 0xe4, 0xf5,
+    0x47, 0x01, 0x92, 0x40, 0xe5, 0x08, 0xc8, 0x1a, 0xe8, 0x0f, 0xb1, 0xf9,
+    0xc4, 0x07, 0xe9, 0x0f, 0xb1, 0x10, 0x01, 0xc0, 0xe5, 0x6d, 0xc9, 0xac,
+    0xc1, 0x01, 0x36, 0x61, 0x43, 0x01, 0xc9, 0x40, 0xe5, 0x7d, 0x8e, 0x00,
+    0x00, 0xc3, 0x00, 0xe5, 0x8f, 0x94, 0x01, 0x32, 0x58, 0x95, 0x00, 0xa8,
+    0x2b, 0x00, 0xe5, 0x99, 0x90, 0x00, 0xa6, 0x83, 0x00, 0xe5, 0xc4, 0x85,
+    0x00, 0xa5, 0x0b, 0x00, 0xe6, 0x01, 0x04, 0xc0, 0xe6, 0x24, 0x96, 0x00,
+    0xa3, 0x33, 0x00, 0xe6, 0x36, 0x19, 0xc0, 0xe6, 0x68, 0x94, 0x00, 0xaa,
+    0x83, 0x00, 0xe6, 0x84, 0x88, 0x00, 0xaa, 0xeb, 0x00, 0xe6, 0xa7, 0x87,
+    0x00, 0xa0, 0x0b, 0x00, 0xe6, 0xcc, 0x91, 0x00, 0xa0, 0x2b, 0x00, 0xe6,
+    0xd6, 0x9b, 0x00, 0xa9, 0xf3, 0x00, 0xe6, 0xe8, 0x8e, 0x00, 0xa7, 0x53,
+    0x00, 0xe7, 0x0b, 0x8f, 0x00, 0xa5, 0xdb, 0x00, 0xe7, 0x2f, 0x8d, 0x00,
+    0xa4, 0x1b, 0x00, 0xe7, 0x53, 0x92, 0x00, 0xa2, 0x4b, 0x00, 0xe7, 0x73,
+    0x83, 0x00, 0xa0, 0x53, 0x00, 0xe7, 0x90, 0x93, 0x00, 0xac, 0x2b, 0x00,
+    0xe7, 0xac, 0x0a, 0xc0, 0xe7, 0xc1, 0x8b, 0x00, 0xa0, 0x1b, 0x00, 0xe7,
+    0xcb, 0xcc, 0x22, 0xbd, 0x00, 0xa0, 0xf0, 0xc2, 0x00, 0x2f, 0x0f, 0xab,
+    0x79, 0x9b, 0x0f, 0x9b, 0x60, 0xc3, 0x02, 0xd4, 0x01, 0x08, 0x29, 0x96,
+    0x01, 0x01, 0xc2, 0x00, 0xe7, 0xd3, 0xc8, 0xb9, 0xe8, 0x0f, 0xae, 0x19,
+    0xc5, 0x0a, 0xe4, 0x0f, 0xa6, 0x3a, 0x00, 0xe7, 0xd9, 0xca, 0xa2, 0x72,
+    0x0f, 0x9d, 0x01, 0x90, 0x00, 0x16, 0x38, 0xc9, 0xb4, 0x11, 0x0f, 0x9c,
+    0x79, 0xc9, 0xaf, 0x25, 0x0f, 0xd4, 0xd0, 0xcb, 0x80, 0x26, 0x00, 0x00,
+    0x69, 0xc2, 0x01, 0x5d, 0x0f, 0xca, 0xa8, 0x97, 0x08, 0x15, 0x93, 0x00,
+    0xe7, 0xdf, 0x94, 0x08, 0x15, 0x2b, 0x00, 0xe7, 0xe6, 0x8e, 0x08, 0x15,
+    0x1b, 0x00, 0xe7, 0xea, 0x83, 0x08, 0x15, 0x03, 0x00, 0xe7, 0xf1, 0x93,
+    0x08, 0x15, 0x41, 0x84, 0x08, 0x15, 0x49, 0x8f, 0x08, 0x15, 0x53, 0x00,
+    0xe7, 0xf5, 0x91, 0x08, 0x15, 0x59, 0x86, 0x08, 0x15, 0x13, 0x00, 0xe7,
+    0xfc, 0x96, 0x08, 0x15, 0x6b, 0x00, 0xe8, 0x00, 0x95, 0x08, 0x15, 0x83,
+    0x00, 0xe8, 0x07, 0x42, 0x04, 0x91, 0xc0, 0xe8, 0x19, 0x90, 0x08, 0x15,
+    0xab, 0x00, 0xe8, 0x25, 0x9a, 0x08, 0x15, 0xa1, 0x92, 0x08, 0x15, 0xbb,
+    0x00, 0xe8, 0x31, 0x8b, 0x08, 0x15, 0xcb, 0x00, 0xe8, 0x35, 0x87, 0x08,
+    0x15, 0xd3, 0x00, 0xe8, 0x39, 0x8d, 0x08, 0x15, 0xe3, 0x00, 0xe8, 0x3d,
+    0x89, 0x08, 0x16, 0x02, 0x00, 0xe8, 0x41, 0x47, 0x01, 0x92, 0xc0, 0xe8,
+    0x45, 0xcd, 0x78, 0x45, 0x08, 0x2b, 0x78, 0xcb, 0x93, 0xe7, 0x0f, 0xa7,
+    0xc0, 0x46, 0x00, 0x91, 0x40, 0xe8, 0xb9, 0xca, 0x9e, 0x62, 0x0f, 0x9b,
+    0xc1, 0xc5, 0xbf, 0xf4, 0x0f, 0xd5, 0x98, 0x09, 0xc0, 0xe8, 0xc5, 0x03,
+    0xc0, 0xe8, 0xcf, 0x14, 0xc0, 0xe8, 0xe5, 0x0e, 0xc0, 0xe8, 0xed, 0x42,
+    0x00, 0x92, 0xc0, 0xe9, 0x03, 0x16, 0xc0, 0xe9, 0x0f, 0x06, 0xc0, 0xe9,
+    0x2a, 0x07, 0xc0, 0xe9, 0x3b, 0x08, 0xc0, 0xe9, 0x47, 0x05, 0xc0, 0xe9,
+    0x53, 0x15, 0xc0, 0xe9, 0x76, 0x04, 0xc0, 0xe9, 0x98, 0x42, 0x02, 0x4d,
+    0xc0, 0xe9, 0xa2, 0x17, 0xc0, 0xe9, 0xae, 0x0b, 0xc0, 0xe9, 0xbe, 0x47,
+    0x30, 0xde, 0xc0, 0xe9, 0xc8, 0x11, 0xc0, 0xe9, 0xd4, 0x0f, 0xc0, 0xe9,
+    0xef, 0x12, 0xc0, 0xe9, 0xfe, 0x10, 0xc0, 0xea, 0x08, 0x1a, 0xc0, 0xea,
+    0x14, 0x42, 0x00, 0x4a, 0xc0, 0xea, 0x1e, 0x49, 0x06, 0xbd, 0x40, 0xea,
+    0x30, 0xce, 0x73, 0xf8, 0x01, 0x1c, 0x21, 0xc6, 0x82, 0x83, 0x01, 0x10,
+    0x09, 0xc7, 0x50, 0xe1, 0x0f, 0xae, 0xe1, 0xc3, 0x1b, 0xb0, 0x0f, 0xcf,
+    0x68, 0x47, 0xad, 0x6c, 0xc0, 0xea, 0x3c, 0x83, 0x00, 0x01, 0x60, 0x48,
+    0xb6, 0x58, 0xc0, 0xea, 0x48, 0x42, 0x00, 0x2c, 0x40, 0xea, 0x54, 0xd7,
+    0x15, 0x15, 0x01, 0x1c, 0x09, 0x45, 0x6a, 0xb7, 0xc0, 0xea, 0x60, 0xcc,
+    0x65, 0x1e, 0x01, 0x11, 0x71, 0x44, 0x77, 0x3d, 0x40, 0xea, 0x6c, 0xc6,
+    0xd2, 0x92, 0x0f, 0xa3, 0xb9, 0xc4, 0x00, 0x8d, 0x0f, 0xb5, 0x38, 0xc9,
+    0xae, 0x7a, 0x0f, 0x9c, 0x51, 0xc9, 0x99, 0xd7, 0x0f, 0xb0, 0xa9, 0xcb,
+    0x8f, 0xd2, 0x0f, 0xb0, 0xb0, 0x01, 0x40, 0xea, 0x78, 0xc2, 0x00, 0xb2,
+    0x0f, 0x9b, 0x99, 0x87, 0x0f, 0x9b, 0x50, 0xcb, 0x91, 0xed, 0x0f, 0x89,
+    0x79, 0xca, 0x9c, 0x14, 0x00, 0x05, 0x48, 0x15, 0xc0, 0xea, 0x84, 0x05,
+    0xc0, 0xea, 0x90, 0x46, 0xca, 0xa0, 0xc0, 0xea, 0x9c, 0x4b, 0x93, 0x6e,
+    0xc0, 0xea, 0xae, 0x08, 0xc0, 0xea, 0xc6, 0xd5, 0x37, 0x5a, 0x01, 0x67,
+    0xf8, 0xc7, 0xad, 0x0b, 0x0f, 0xca, 0x11, 0xc9, 0xa9, 0x6a, 0x0f, 0x9b,
+    0xd8, 0x42, 0x00, 0x6d, 0xc0, 0xea, 0xd2, 0xc3, 0x00, 0x6e, 0x01, 0x02,
+    0x80, 0x45, 0x04, 0x5f, 0xc0, 0xea, 0xf4, 0x46, 0x10, 0x8c, 0x40, 0xeb,
+    0x1a, 0x46, 0x00, 0x91, 0x40, 0xeb, 0x36, 0xc8, 0x79, 0x9c, 0x0f, 0x9d,
+    0x61, 0xce, 0x75, 0x1e, 0x0f, 0xa2, 0x78, 0x42, 0x00, 0x6d, 0xc0, 0xeb,
+    0x4e, 0x01, 0x40, 0xeb, 0xb0, 0xc6, 0xca, 0x70, 0x0f, 0x9d, 0x51, 0xcf,
+    0x68, 0xf9, 0x01, 0x50, 0x81, 0xcc, 0x0a, 0x1d, 0x00, 0x02, 0xf0, 0x1c,
+    0xc0, 0xeb, 0xbc, 0x97, 0x09, 0x18, 0x5b, 0x00, 0xeb, 0xd7, 0x16, 0xc0,
+    0xec, 0x12, 0x15, 0xc0, 0xec, 0x2e, 0x10, 0xc0, 0xec, 0x47, 0x0f, 0xc0,
+    0xec, 0x63, 0x0e, 0xc0, 0xec, 0x7f, 0x0d, 0xc0, 0xec, 0x94, 0x0a, 0xc0,
+    0xec, 0xb5, 0x09, 0xc0, 0xec, 0xca, 0x87, 0x09, 0x04, 0x53, 0x00, 0xec,
+    0xe3, 0x06, 0xc0, 0xed, 0x1b, 0x04, 0xc0, 0xed, 0x30, 0x83, 0x09, 0x00,
+    0x03, 0x00, 0xed, 0x45, 0x12, 0xc0, 0xed, 0x89, 0x14, 0xc0, 0xed, 0xa0,
+    0x8b, 0x09, 0x09, 0xfa, 0x00, 0xed, 0xaf, 0x49, 0x1f, 0xcf, 0xc0, 0xed,
+    0xe5, 0xce, 0x6d, 0x92, 0x09, 0x23, 0x89, 0xd9, 0x1e, 0x6b, 0x09, 0x23,
+    0x80, 0x42, 0x00, 0xb0, 0xc0, 0xed, 0xf7, 0x07, 0xc0, 0xee, 0x03, 0x15,
+    0xc0, 0xee, 0x0f, 0x08, 0xc0, 0xee, 0x21, 0x11, 0xc0, 0xee, 0x2d, 0x16,
+    0x40, 0xee, 0x39, 0x42, 0x00, 0x38, 0xc0, 0xee, 0x45, 0xc9, 0xac, 0xa6,
+    0x0f, 0xca, 0x60, 0x45, 0x3b, 0xca, 0xc0, 0xee, 0x51, 0xca, 0x9d, 0x04,
+    0x0f, 0x9a, 0xd8, 0xcf, 0x54, 0x12, 0x01, 0x37, 0xf1, 0xca, 0xa0, 0x92,
+    0x0f, 0xcb, 0x20, 0xcc, 0x84, 0xd8, 0x01, 0x08, 0x21, 0x45, 0x00, 0xdf,
+    0x40, 0xee, 0x5d, 0x42, 0xe4, 0x83, 0xc0, 0xee, 0x69, 0x20, 0xc0, 0xee,
+    0x71, 0x1f, 0x40, 0xee, 0x79, 0x1c, 0xc0, 0xee, 0xa1, 0x1a, 0xc0, 0xee,
+    0xa9, 0x19, 0xc0, 0xee, 0xb1, 0x16, 0xc0, 0xee, 0xc1, 0x15, 0xc0, 0xee,
+    0xd5, 0x14, 0xc0, 0xee, 0xe9, 0x12, 0xc0, 0xee, 0xfd, 0x10, 0xc0, 0xef,
+    0x11, 0x0f, 0xc0, 0xef, 0x25, 0x0e, 0xc0, 0xef, 0x39, 0x83, 0x08, 0x40,
+    0x01, 0x87, 0x08, 0x40, 0x09, 0x8b, 0x08, 0x40, 0x11, 0x91, 0x08, 0x40,
+    0x19, 0x97, 0x08, 0x40, 0x21, 0x0c, 0xc0, 0xef, 0x4d, 0x0d, 0x40, 0xef,
+    0x55, 0xd0, 0x5e, 0x12, 0x00, 0xe9, 0x59, 0xc8, 0xb5, 0x50, 0x00, 0x26,
+    0x01, 0xcd, 0x76, 0x16, 0x05, 0x33, 0x70, 0x46, 0x01, 0x93, 0xc0, 0xef,
+    0x69, 0x48, 0x1b, 0xd9, 0x40, 0xef, 0xe6, 0x46, 0x01, 0x93, 0xc0, 0xef,
+    0xf8, 0x48, 0x1b, 0xd9, 0x40, 0xf0, 0x77, 0xc5, 0x61, 0x15, 0x01, 0x74,
+    0x01, 0x03, 0x40, 0xf0, 0x89, 0x0e, 0xc0, 0xf0, 0x97, 0xc4, 0xdf, 0x4c,
+    0x01, 0x74, 0xd9, 0x0b, 0xc0, 0xf0, 0xa3, 0xc2, 0x00, 0x2a, 0x01, 0x75,
+    0x39, 0x4c, 0x8a, 0xd8, 0x40, 0xf0, 0xaf, 0x07, 0xc0, 0xf0, 0xe5, 0x45,
+    0x00, 0xb6, 0xc0, 0xf0, 0xf1, 0x10, 0xc0, 0xf0, 0xfd, 0xc2, 0x05, 0x1f,
+    0x01, 0x74, 0xe1, 0x0b, 0xc0, 0xf1, 0x09, 0x46, 0xd2, 0xb0, 0xc0, 0xf1,
+    0x15, 0xc4, 0xe1, 0x1c, 0x01, 0x75, 0xb0, 0xc5, 0x17, 0x4d, 0x01, 0x74,
+    0x29, 0x43, 0x3e, 0x29, 0x40, 0xf1, 0x21, 0x11, 0xc0, 0xf1, 0x2d, 0xc5,
+    0xc0, 0x24, 0x01, 0x75, 0x71, 0x45, 0xda, 0xe9, 0xc0, 0xf1, 0x3d, 0xc3,
+    0x89, 0x41, 0x01, 0x76, 0xc0, 0xc4, 0x13, 0x23, 0x01, 0x74, 0x39, 0xc5,
+    0x8e, 0xba, 0x01, 0x74, 0x99, 0xc4, 0xdf, 0x28, 0x01, 0x76, 0x09, 0xc5,
+    0xd9, 0xfe, 0x01, 0x77, 0x88, 0xc3, 0x05, 0x16, 0x01, 0x74, 0x41, 0xc3,
+    0x01, 0xa1, 0x01, 0x74, 0x48, 0xc9, 0xac, 0x0d, 0x01, 0x74, 0x51, 0xc4,
+    0x15, 0x49, 0x01, 0x74, 0xf1, 0xc2, 0x13, 0x72, 0x01, 0x75, 0x40, 0x44,
+    0xad, 0x14, 0xc0, 0xf1, 0x49, 0x44, 0x01, 0x0a, 0x40, 0xf1, 0x59, 0x42,
+    0x01, 0xe6, 0xc0, 0xf1, 0x65, 0xc3, 0x00, 0x6b, 0x01, 0x74, 0xc1, 0xc3,
+    0x03, 0x81, 0x01, 0x76, 0x38, 0x11, 0xc0, 0xf1, 0x6f, 0x07, 0x40, 0xf1,
+    0x87, 0x03, 0xc0, 0xf1, 0x93, 0x44, 0x17, 0xe1, 0x40, 0xf1, 0x9f, 0xc3,
+    0x04, 0x7c, 0x01, 0x75, 0x19, 0xc3, 0x60, 0x46, 0x01, 0x76, 0x50, 0xc3,
+    0x02, 0xbf, 0x01, 0x75, 0x49, 0x4c, 0x8a, 0xd8, 0x40, 0xf1, 0xab, 0xc2,
+    0x0d, 0x1e, 0x01, 0x75, 0x59, 0xc2, 0x00, 0x2b, 0x01, 0x75, 0xc1, 0x43,
+    0x02, 0xce, 0x40, 0xf1, 0xbb, 0xc3, 0x05, 0x16, 0x01, 0x75, 0x89, 0x16,
+    0xc0, 0xf1, 0xc5, 0xc4, 0x04, 0x9f, 0x01, 0x75, 0xa0, 0x45, 0x1c, 0x58,
+    0xc0, 0xf1, 0xd1, 0xc4, 0x6b, 0x89, 0x01, 0x77, 0x20, 0x90, 0x01, 0x8e,
+    0xe8, 0x99, 0x01, 0x8e, 0x23, 0x00, 0xf1, 0xdb, 0x9c, 0x01, 0x8e, 0xbb,
+    0x00, 0xf1, 0xe3, 0x92, 0x01, 0x8e, 0x99, 0x96, 0x01, 0x8e, 0xc9, 0x89,
+    0x01, 0x8e, 0xd0, 0x9c, 0x01, 0x8e, 0xab, 0x00, 0xf1, 0xed, 0x92, 0x01,
+    0x8e, 0x3b, 0x00, 0xf2, 0x03, 0x89, 0x01, 0x8e, 0xb1, 0xc3, 0xdc, 0x9a,
+    0x01, 0x8f, 0x00, 0x86, 0x01, 0x8e, 0xd9, 0x9c, 0x01, 0x8e, 0xe1, 0x89,
+    0x01, 0x8f, 0x10, 0x15, 0xc0, 0xf2, 0x09, 0x03, 0xc0, 0xf2, 0x2c, 0x11,
+    0xc0, 0xf2, 0x34, 0x42, 0x00, 0xce, 0xc0, 0xf2, 0x46, 0x4a, 0x06, 0xbd,
+    0xc0, 0xf2, 0x52, 0x05, 0xc0, 0xf2, 0x5e, 0xcb, 0x1a, 0x38, 0x00, 0x01,
+    0x4b, 0x00, 0xf2, 0x73, 0x08, 0xc0, 0xf2, 0x77, 0xe0, 0x04, 0x69, 0x01,
+    0x16, 0x51, 0x16, 0xc0, 0xf2, 0x81, 0x42, 0x00, 0xd8, 0xc0, 0xf2, 0x95,
+    0x19, 0xc0, 0xf2, 0xa1, 0x46, 0x06, 0x64, 0xc0, 0xf2, 0xad, 0xd7, 0x26,
+    0xd5, 0x01, 0x70, 0x69, 0xd6, 0x2d, 0x22, 0x01, 0x70, 0xe8, 0x19, 0xc0,
+    0xf2, 0xb9, 0x16, 0xc0, 0xf2, 0xc8, 0x15, 0xc0, 0xf2, 0xda, 0x0a, 0xc0,
+    0xf2, 0xe6, 0xd0, 0x5c, 0xd2, 0x0f, 0xc1, 0xf1, 0xc5, 0x00, 0x83, 0x01,
+    0x0c, 0x93, 0x00, 0xf2, 0xf0, 0xd1, 0x55, 0xca, 0x01, 0x0f, 0xf1, 0x06,
+    0xc0, 0xf2, 0xfa, 0xcd, 0x79, 0x7d, 0x01, 0x0e, 0x49, 0xcf, 0x66, 0xdd,
+    0x01, 0x5a, 0x31, 0x04, 0xc0, 0xf3, 0x06, 0x14, 0xc0, 0xf3, 0x18, 0x08,
+    0xc0, 0xf3, 0x24, 0xd7, 0x27, 0x8d, 0x0f, 0xc5, 0x38, 0x49, 0x01, 0x4c,
+    0xc0, 0xf3, 0x30, 0x15, 0xc0, 0xf3, 0x48, 0xdb, 0x16, 0xf7, 0x01, 0x37,
+    0x29, 0x48, 0xb7, 0x30, 0xc0, 0xf3, 0x54, 0x47, 0x56, 0xb8, 0x40, 0xf3,
+    0x6c, 0xc8, 0x0b, 0x21, 0x01, 0x12, 0xb9, 0xcb, 0x8e, 0x04, 0x01, 0x12,
+    0xb1, 0xc8, 0x16, 0x68, 0x01, 0x10, 0xc1, 0xc5, 0x00, 0xd2, 0x00, 0x16,
+    0xd1, 0xc4, 0xe0, 0x6c, 0x0f, 0xb6, 0xf9, 0xc5, 0x01, 0x4c, 0x01, 0x71,
+    0x80, 0x45, 0x10, 0xc2, 0xc0, 0xf3, 0x81, 0x43, 0x10, 0xf4, 0xc0, 0xf3,
+    0x8d, 0x45, 0x00, 0x2f, 0xc0, 0xf3, 0x99, 0x46, 0x01, 0x78, 0x40, 0xf3,
+    0xa5, 0xce, 0x6f, 0x60, 0x0f, 0xae, 0xf1, 0x42, 0x00, 0x2d, 0x40, 0xf3,
+    0xb1, 0xc6, 0xd1, 0xa2, 0x0f, 0xbc, 0x59, 0xc7, 0xc7, 0x54, 0x0f, 0xa6,
+    0x68, 0xc3, 0xe4, 0xb7, 0x0f, 0x93, 0x29, 0x42, 0x00, 0xa7, 0xc0, 0xf3,
+    0xbd, 0xc2, 0x0b, 0x0b, 0x0f, 0x93, 0x19, 0xc2, 0x11, 0xb2, 0x0f, 0x93,
+    0x09, 0xc2, 0x11, 0xa1, 0x0f, 0x93, 0x00, 0xc3, 0x05, 0x16, 0x01, 0x0b,
+    0x03, 0x00, 0xf3, 0xc9, 0x08, 0xc0, 0xf3, 0xcd, 0x15, 0xc0, 0xf3, 0xd7,
+    0xd4, 0x3c, 0x2a, 0x01, 0x0c, 0x19, 0x16, 0xc0, 0xf3, 0xe6, 0x07, 0xc0,
+    0xf3, 0xf9, 0xc4, 0x28, 0x74, 0x01, 0x0b, 0x40, 0x07, 0xc0, 0xf4, 0x05,
+    0xcb, 0x8e, 0x7d, 0x08, 0x0c, 0xa8, 0xd3, 0x45, 0xe7, 0x08, 0x0c, 0xa1,
+    0xcc, 0x82, 0xa4, 0x08, 0x0c, 0xb1, 0xcd, 0x78, 0x2b, 0x08, 0x0c, 0xc8,
+    0xc3, 0x63, 0x50, 0x0f, 0xb4, 0x19, 0xc5, 0xd6, 0xe8, 0x0f, 0xb7, 0x20,
+    0xc4, 0x01, 0x29, 0x01, 0x38, 0x5b, 0x00, 0xf4, 0x17, 0xc4, 0xba, 0xda,
+    0x01, 0x38, 0x51, 0x0f, 0xc0, 0xf4, 0x1d, 0xcc, 0x88, 0x38, 0x0f, 0xc8,
+    0xd1, 0xd4, 0x21, 0x11, 0x01, 0x70, 0x31, 0xc3, 0x01, 0xa5, 0x01, 0x71,
+    0x9b, 0x00, 0xf4, 0x2f, 0xc6, 0x09, 0x2b, 0x01, 0x70, 0x59, 0xc5, 0x04,
+    0x0c, 0x01, 0x71, 0xa0, 0xc3, 0x7f, 0x95, 0x0f, 0x98, 0x40, 0xcb, 0x97,
+    0xa4, 0x01, 0x31, 0x11, 0xc7, 0xc0, 0x77, 0x0f, 0xa8, 0xc0, 0xca, 0x9f,
+    0x34, 0x0f, 0x9e, 0x69, 0xc3, 0x63, 0x50, 0x0f, 0x9e, 0x70, 0x01, 0xc0,
+    0xf4, 0x35, 0x42, 0x00, 0x6d, 0x40, 0xf4, 0x56, 0x51, 0x52, 0x12, 0xc0,
+    0xf4, 0x9f, 0xc3, 0x4c, 0x9b, 0x0f, 0xb5, 0xd8, 0xcf, 0x24, 0x46, 0x01,
+    0x33, 0xe1, 0x4f, 0x6a, 0x70, 0x40, 0xf4, 0xa7, 0x9c, 0x0f, 0x8f, 0xf9,
+    0x9b, 0x0f, 0x8f, 0xf1, 0x9a, 0x0f, 0x8f, 0xe9, 0x99, 0x0f, 0x8f, 0xe1,
+    0x98, 0x0f, 0x8f, 0xd9, 0x97, 0x0f, 0x8f, 0xd1, 0x96, 0x0f, 0x8f, 0xc9,
+    0x95, 0x0f, 0x8f, 0xc1, 0x94, 0x0f, 0x8f, 0xb9, 0x93, 0x0f, 0x8f, 0xb1,
+    0x92, 0x0f, 0x8f, 0xa9, 0x91, 0x0f, 0x8f, 0xa1, 0x90, 0x0f, 0x8f, 0x99,
+    0x8f, 0x0f, 0x8f, 0x91, 0x8e, 0x0f, 0x8f, 0x89, 0x8d, 0x0f, 0x8f, 0x81,
+    0x8c, 0x0f, 0x8f, 0x79, 0x8b, 0x0f, 0x8f, 0x71, 0x8a, 0x0f, 0x8f, 0x69,
+    0x89, 0x0f, 0x8f, 0x61, 0x88, 0x0f, 0x8f, 0x59, 0x87, 0x0f, 0x8f, 0x51,
+    0x86, 0x0f, 0x8f, 0x49, 0x85, 0x0f, 0x8f, 0x41, 0x84, 0x0f, 0x8f, 0x39,
+    0x83, 0x0f, 0x8f, 0x30, 0xc5, 0x1f, 0xf6, 0x05, 0x4a, 0x99, 0x4a, 0x6e,
+    0xbc, 0x40, 0xf4, 0xb3, 0x8a, 0x05, 0x4a, 0x91, 0x94, 0x05, 0x4a, 0x89,
+    0x90, 0x05, 0x4a, 0x82, 0x00, 0xf4, 0xca, 0x83, 0x05, 0x4a, 0x31, 0x10,
+    0xc0, 0xf4, 0xce, 0x0f, 0xc0, 0xf4, 0xe0, 0xc2, 0x00, 0xce, 0x05, 0x4a,
+    0x09, 0xc2, 0x00, 0x71, 0x05, 0x4a, 0x01, 0xc2, 0x1a, 0x18, 0x05, 0x49,
+    0xf9, 0xc2, 0x00, 0x89, 0x05, 0x49, 0xf1, 0xc2, 0x00, 0x3b, 0x05, 0x49,
+    0xe9, 0xc2, 0x0d, 0x01, 0x05, 0x49, 0xe1, 0xc2, 0x21, 0x7d, 0x05, 0x49,
+    0xd1, 0xc2, 0x03, 0xc6, 0x05, 0x49, 0xc9, 0xc2, 0x00, 0xa0, 0x05, 0x49,
+    0xb9, 0xc2, 0x04, 0xf2, 0x05, 0x49, 0xb1, 0xc2, 0x0e, 0x60, 0x05, 0x49,
+    0xa1, 0xc2, 0x00, 0x51, 0x05, 0x49, 0x99, 0xc2, 0x00, 0xeb, 0x05, 0x49,
+    0x89, 0xc2, 0x02, 0x4d, 0x05, 0x49, 0x80, 0xca, 0x9b, 0x7e, 0x08, 0x73,
+    0xf1, 0x44, 0x05, 0x16, 0x40, 0xf4, 0xea, 0x44, 0x28, 0x74, 0xc0, 0xf4,
+    0xfc, 0x45, 0x0a, 0xfd, 0xc0, 0xf5, 0x08, 0x15, 0xc0, 0xf5, 0x12, 0x08,
+    0xc0, 0xf5, 0x1e, 0x16, 0xc0, 0xf5, 0x26, 0xcb, 0x0c, 0xe3, 0x08, 0x73,
+    0x90, 0xc4, 0x28, 0x74, 0x08, 0x73, 0x41, 0xc5, 0x0a, 0xfd, 0x08, 0x73,
+    0x39, 0x15, 0xc0, 0xf5, 0x34, 0x08, 0xc0, 0xf5, 0x40, 0x16, 0xc0, 0xf5,
+    0x4c, 0xc3, 0x05, 0x16, 0x08, 0x73, 0x00, 0x47, 0x01, 0x92, 0xc0, 0xf5,
+    0x58, 0xcf, 0x62, 0xd2, 0x00, 0xb7, 0x81, 0xcf, 0x63, 0x68, 0x00, 0xb7,
+    0x79, 0xcd, 0x79, 0xe5, 0x00, 0xb7, 0x71, 0xd1, 0x4e, 0xaf, 0x00, 0xb7,
+    0x69, 0xd4, 0x3b, 0x12, 0x00, 0xb7, 0x61, 0xd2, 0x48, 0xd9, 0x00, 0xb7,
+    0x58, 0xc2, 0x00, 0x2c, 0x0f, 0x9e, 0x19, 0xd3, 0x46, 0xf1, 0x0f, 0x9d,
+    0xe8, 0xc6, 0x58, 0xbc, 0x01, 0x03, 0x01, 0xd4, 0x3e, 0x96, 0x01, 0x71,
+    0x88, 0x42, 0x00, 0x5b, 0xc0, 0xf5, 0xe8, 0xd0, 0x5d, 0x42, 0x0f, 0xa3,
+    0x78, 0x05, 0xc0, 0xf6, 0x00, 0x0a, 0xc0, 0xf6, 0x1e, 0x52, 0x47, 0x5f,
+    0xc0, 0xf6, 0x2c, 0x15, 0xc0, 0xf6, 0x38, 0x0e, 0xc0, 0xf6, 0x6c, 0x06,
+    0xc0, 0xf6, 0x7c, 0x16, 0xc0, 0xf6, 0x91, 0xd9, 0x0e, 0xed, 0x01, 0x3a,
+    0xa9, 0xd6, 0x30, 0xea, 0x01, 0x3a, 0xa1, 0x08, 0xc0, 0xf6, 0xa7, 0xc3,
+    0xe5, 0xa7, 0x01, 0x38, 0x89, 0x14, 0xc0, 0xf6, 0xb7, 0x42, 0x00, 0x6f,
+    0xc0, 0xf6, 0xc3, 0x0f, 0xc0, 0xf6, 0xcf, 0xc6, 0x19, 0xc4, 0x01, 0x2f,
+    0x31, 0x12, 0xc0, 0xf6, 0xdb, 0x43, 0x00, 0x98, 0x40, 0xf6, 0xe7, 0x45,
+    0x17, 0xe0, 0xc0, 0xf6, 0xf3, 0x45, 0x1d, 0xe4, 0x40, 0xf7, 0x11, 0x45,
+    0x1d, 0xe4, 0xc0, 0xf7, 0x2f, 0x45, 0x17, 0xe0, 0x40, 0xf7, 0x4d, 0xd5,
+    0x36, 0xc7, 0x0f, 0xc4, 0x19, 0xca, 0x36, 0xd2, 0x0f, 0xc3, 0x59, 0xd0,
+    0x5b, 0x42, 0x0f, 0xc3, 0x19, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0x99, 0xd0,
+    0x36, 0xcc, 0x0f, 0xc3, 0xd8, 0xd5, 0x36, 0xc7, 0x0f, 0xc4, 0x11, 0xd0,
+    0x36, 0xcc, 0x0f, 0xc3, 0xd1, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x11, 0xca,
+    0x36, 0xd2, 0x0f, 0xc3, 0x51, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0x90, 0xd5,
+    0x36, 0xc7, 0x0f, 0xc4, 0x01, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x01, 0xca,
+    0x36, 0xd2, 0x0f, 0xc3, 0x41, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0x81, 0xd0,
+    0x36, 0xcc, 0x0f, 0xc3, 0xc0, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x09, 0xca,
+    0x36, 0xd2, 0x0f, 0xc3, 0x49, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0x89, 0xd0,
+    0x36, 0xcc, 0x0f, 0xc3, 0xc9, 0xd5, 0x36, 0xc7, 0x0f, 0xc4, 0x08, 0x01,
+    0xc0, 0xf7, 0x6b, 0xc2, 0x00, 0x2a, 0x0f, 0xd4, 0xf8, 0x01, 0xc0, 0xf7,
+    0x77, 0xc5, 0xdb, 0x9d, 0x0f, 0x9a, 0x48, 0xc9, 0xb0, 0x9f, 0x0f, 0x17,
+    0xf9, 0x46, 0x04, 0x99, 0xc0, 0xf7, 0x8f, 0x45, 0x2a, 0xc0, 0xc0, 0xf7,
+    0xb3, 0x47, 0x01, 0x92, 0x40, 0xf7, 0xc5, 0xd4, 0x39, 0xfa, 0x0f, 0x98,
+    0xc1, 0xd3, 0x42, 0x57, 0x0f, 0x98, 0xb0, 0xc2, 0x04, 0x0d, 0x08, 0xc7,
+    0xf9, 0x47, 0x37, 0xb8, 0xc0, 0xf8, 0x4c, 0x46, 0x04, 0x99, 0xc0, 0xf8,
+    0x64, 0x4d, 0x28, 0xa7, 0xc0, 0xf8, 0x88, 0x4f, 0x09, 0x39, 0x40, 0xf8,
+    0xe7, 0x0e, 0xc0, 0xf9, 0x46, 0xc8, 0x7b, 0x63, 0x07, 0xf2, 0x59, 0xc4,
+    0x0e, 0x60, 0x01, 0x81, 0x80, 0x58, 0x25, 0xbd, 0xc0, 0xf9, 0x52, 0xc4,
+    0x0e, 0x60, 0x01, 0x80, 0xe0, 0xca, 0x9e, 0xda, 0x0f, 0x9f, 0x99, 0xca,
+    0x9e, 0x08, 0x0f, 0x9f, 0xa1, 0xc9, 0x43, 0x45, 0x0f, 0xa2, 0x58, 0xc8,
+    0x31, 0x3a, 0x0f, 0xac, 0x29, 0xc6, 0xcb, 0x06, 0x0f, 0xb7, 0xc1, 0xc4,
+    0x57, 0x78, 0x0f, 0xca, 0x78, 0xc5, 0x8e, 0x20, 0x0f, 0xcb, 0xf9, 0xc4,
+    0x1f, 0x53, 0x01, 0x1f, 0x29, 0xc5, 0x70, 0xc7, 0x0f, 0xd6, 0x98, 0x42,
+    0x04, 0x81, 0x40, 0xf9, 0x5e, 0x01, 0xc0, 0xf9, 0x6a, 0xc7, 0x91, 0x41,
+    0x01, 0x10, 0xe1, 0xcd, 0x7a, 0x40, 0x01, 0x00, 0x28, 0xca, 0xa0, 0xc4,
+    0x0f, 0x9b, 0xa3, 0x00, 0xf9, 0x8c, 0xc3, 0x00, 0xb1, 0x01, 0x56, 0xe1,
+    0xce, 0x4b, 0x65, 0x01, 0x70, 0x80, 0x44, 0x00, 0x92, 0xc0, 0xf9, 0x92,
+    0xc4, 0x3e, 0x62, 0x0f, 0xc9, 0x31, 0xc7, 0xc4, 0x8a, 0x0f, 0xa4, 0x31,
+    0x15, 0xc0, 0xf9, 0x9c, 0xcf, 0x64, 0x3a, 0x0f, 0xb0, 0xc1, 0xd2, 0x4d,
+    0xe9, 0x0f, 0xcb, 0xc8, 0x4d, 0x28, 0xe7, 0xc0, 0xf9, 0xa8, 0xc7, 0xc9,
+    0xe6, 0x0f, 0x9a, 0x10, 0xc8, 0xbe, 0x58, 0x01, 0x05, 0x19, 0xc3, 0x8e,
+    0xd7, 0x0f, 0x9a, 0xf8, 0x46, 0x03, 0x2e, 0xc0, 0xf9, 0xb4, 0xd1, 0x56,
+    0xb8, 0x0f, 0xa1, 0x28, 0xd8, 0x21, 0x55, 0x0f, 0xb1, 0x30, 0xcd, 0x7b,
+    0xc6, 0x01, 0x0a, 0xf9, 0xc5, 0x00, 0xa4, 0x01, 0x02, 0x20, 0xc4, 0x9d,
+    0xdd, 0x0f, 0xad, 0xf1, 0xc5, 0xd6, 0x57, 0x0f, 0xad, 0xe9, 0xc7, 0x80,
+    0xbd, 0x0f, 0xad, 0xe0, 0xca, 0x9c, 0x28, 0x01, 0x3e, 0xb9, 0xc5, 0x06,
+    0x84, 0x01, 0x2c, 0x41, 0x45, 0x17, 0x72, 0xc0, 0xf9, 0xba, 0xc4, 0x08,
+    0x72, 0x00, 0x01, 0x70, 0x10, 0xc0, 0xf9, 0xc6, 0x03, 0xc0, 0xf9, 0xd2,
+    0x06, 0xc0, 0xf9, 0xe4, 0x05, 0xc0, 0xf9, 0xf0, 0x15, 0xc0, 0xfa, 0x00,
+    0x0e, 0xc0, 0xfa, 0x0c, 0x07, 0xc0, 0xfa, 0x1c, 0x42, 0x04, 0xf6, 0xc0,
+    0xfa, 0x28, 0x42, 0x00, 0xe5, 0xc0, 0xfa, 0x34, 0x14, 0xc0, 0xfa, 0x40,
+    0xc5, 0x20, 0x41, 0x07, 0xfa, 0xf1, 0x12, 0xc0, 0xfa, 0x4c, 0xc6, 0x69,
+    0x7a, 0x07, 0xff, 0x19, 0xca, 0x9c, 0x00, 0x07, 0xff, 0x21, 0xc8, 0x7f,
+    0xa7, 0x07, 0xff, 0x29, 0xc8, 0xb9, 0xf0, 0x07, 0xff, 0x31, 0xcc, 0x8a,
+    0x54, 0x07, 0xf8, 0x69, 0xc9, 0x11, 0xa1, 0x07, 0xf8, 0x71, 0xcd, 0x31,
+    0xc6, 0x07, 0xfa, 0xe0, 0xcc, 0x69, 0x83, 0x01, 0x31, 0xeb, 0x00, 0xfa,
+    0x5e, 0xce, 0x72, 0xa8, 0x01, 0x03, 0x41, 0xcb, 0x68, 0x85, 0x0f, 0xca,
+    0x38, 0x44, 0x46, 0x95, 0xc0, 0xfa, 0x62, 0x42, 0x00, 0xe3, 0xc0, 0xfa,
+    0x6c, 0xc7, 0xbf, 0xb3, 0x0f, 0xcf, 0x40, 0xc3, 0x18, 0xf5, 0x01, 0x2e,
+    0x49, 0xd1, 0x56, 0xa7, 0x0f, 0x9d, 0x19, 0xd7, 0x28, 0xfd, 0x0f, 0x9b,
+    0x28, 0xc7, 0xc4, 0x59, 0x0f, 0xae, 0x21, 0xc6, 0x9b, 0x64, 0x0f, 0xa6,
+    0x09, 0xc9, 0x1b, 0x40, 0x00, 0x00, 0xe0, 0xc9, 0xa8, 0x6e, 0x0f, 0xa7,
+    0xe9, 0xc6, 0xce, 0x0c, 0x0f, 0x9c, 0xf0, 0xc6, 0xba, 0xd2, 0x0f, 0xd4,
+    0xb1, 0xc5, 0x68, 0x8b, 0x0f, 0x9c, 0xb0, 0x14, 0xc0, 0xfa, 0x78, 0x16,
+    0xc0, 0xfa, 0x84, 0x10, 0xc0, 0xfa, 0xa2, 0x06, 0xc0, 0xfa, 0xbb, 0x15,
+    0xc0, 0xfa, 0xcf, 0x04, 0xc0, 0xfa, 0xe5, 0x0a, 0xc0, 0xfa, 0xef, 0x03,
+    0xc0, 0xfa, 0xf9, 0xc2, 0x00, 0x71, 0x0b, 0x7a, 0x11, 0x1c, 0xc0, 0xfb,
+    0x03, 0x43, 0x6f, 0xc3, 0xc0, 0xfb, 0x15, 0x09, 0xc0, 0xfb, 0x31, 0xc2,
+    0x66, 0x73, 0x0b, 0x79, 0x39, 0x13, 0xc0, 0xfb, 0x39, 0xc2, 0x02, 0x4d,
+    0x0b, 0x78, 0xf1, 0x0e, 0xc0, 0xfb, 0x43, 0x18, 0xc0, 0xfb, 0x51, 0xc2,
+    0x04, 0x70, 0x0b, 0x78, 0x39, 0x0f, 0xc0, 0xfb, 0x5b, 0x12, 0x40, 0xfb,
+    0x65, 0xc5, 0x01, 0x24, 0x0b, 0x7c, 0x91, 0xc5, 0x00, 0xd2, 0x0b, 0x7c,
+    0x89, 0xc9, 0x63, 0x1d, 0x0b, 0x7c, 0x81, 0xc5, 0x00, 0x64, 0x0b, 0x7c,
+    0x78, 0x97, 0x0b, 0x7b, 0x53, 0x00, 0xfb, 0x6f, 0x8b, 0x0b, 0x7b, 0x0b,
+    0x00, 0xfb, 0x90, 0x87, 0x0b, 0x7a, 0xeb, 0x00, 0xfb, 0xb4, 0xc2, 0x00,
+    0x18, 0x0b, 0x7c, 0x19, 0x91, 0x0b, 0x7a, 0xcb, 0x00, 0xfb, 0xca, 0x9b,
+    0x0b, 0x7b, 0x8b, 0x00, 0xfb, 0xda, 0x90, 0x0b, 0x7b, 0xeb, 0x00, 0xfb,
+    0xe4, 0x83, 0x0b, 0x7a, 0xa3, 0x00, 0xfb, 0xe8, 0xca, 0xa1, 0xc8, 0x0b,
+    0x7b, 0xc3, 0x00, 0xfc, 0x08, 0x99, 0x0b, 0x7a, 0xe2, 0x00, 0xfc, 0x0c,
+    0x49, 0xb1, 0x9b, 0xc0, 0xfc, 0x10, 0xca, 0x9d, 0xcc, 0x0b, 0x7a, 0x89,
+    0xd6, 0x2c, 0x04, 0x0b, 0x7a, 0x78, 0xcb, 0x95, 0x7e, 0x01, 0x22, 0x49,
+    0xcc, 0x80, 0xd0, 0x01, 0x22, 0x40, 0xc5, 0xbf, 0x13, 0x0f, 0xa9, 0x61,
+    0xc5, 0x35, 0x15, 0x0f, 0x9d, 0x21, 0xc5, 0x00, 0x8c, 0x00, 0x05, 0xa9,
+    0xc2, 0x01, 0x24, 0x0f, 0xcd, 0x00, 0xc3, 0x01, 0xa5, 0x00, 0x05, 0xb9,
+    0xe0, 0x0a, 0xc9, 0x0f, 0xde, 0x10, 0x01, 0xc0, 0xfc, 0x1c, 0xcd, 0x7a,
+    0x33, 0x01, 0x10, 0x98, 0xc4, 0xd2, 0xa6, 0x0f, 0xae, 0xa9, 0xc4, 0x57,
+    0x78, 0x0f, 0xa5, 0xe9, 0xc3, 0x23, 0xad, 0x0f, 0xb4, 0x80, 0x43, 0x04,
+    0x41, 0xc0, 0xfc, 0x2b, 0x45, 0xdd, 0x32, 0x40, 0xfc, 0x67, 0xce, 0x72,
+    0x62, 0x0b, 0x74, 0xd1, 0x15, 0xc0, 0xfc, 0x79, 0xc9, 0x11, 0xa1, 0x0b,
+    0x74, 0xc1, 0x05, 0xc0, 0xfc, 0x85, 0x46, 0x04, 0x99, 0xc0, 0xfc, 0x91,
+    0x47, 0x37, 0xb8, 0x40, 0xfc, 0xb8, 0xc9, 0xb0, 0xc3, 0x01, 0x1e, 0xc9,
+    0x16, 0xc0, 0xfc, 0xce, 0x4a, 0xa4, 0x7a, 0xc0, 0xfc, 0xe0, 0xcf, 0x66,
+    0x92, 0x01, 0x1e, 0x99, 0xc5, 0x20, 0x5f, 0x01, 0x1e, 0x88, 0x4a, 0x9d,
+    0x86, 0xc0, 0xfc, 0xec, 0x46, 0x04, 0x99, 0xc0, 0xfc, 0xf4, 0x51, 0x57,
+    0x0d, 0x40, 0xfd, 0x12, 0x48, 0xbf, 0x80, 0xc0, 0xfd, 0x22, 0x4d, 0x7b,
+    0x6b, 0x40, 0xfd, 0x32, 0xc2, 0x06, 0xba, 0x01, 0x12, 0xf1, 0xc5, 0x00,
+    0xc4, 0x01, 0x11, 0x0b, 0x00, 0xfd, 0x41, 0xd4, 0x3a, 0xd6, 0x01, 0x4c,
+    0xe8, 0xc5, 0x1f, 0xf6, 0x05, 0x57, 0xb1, 0x4a, 0x6e, 0xbc, 0x40, 0xfd,
+    0x45, 0xc3, 0x7a, 0x77, 0x05, 0x57, 0x91, 0xcb, 0x8f, 0x17, 0x05, 0x57,
+    0x89, 0xc8, 0xbe, 0x78, 0x05, 0x5f, 0x68, 0xc2, 0x00, 0x6b, 0x05, 0x57,
+    0x81, 0xc2, 0x0a, 0xfd, 0x05, 0x5f, 0x58, 0x46, 0x01, 0x93, 0xc0, 0xfd,
+    0x75, 0xc7, 0xc9, 0xa0, 0x05, 0x5f, 0x60, 0xc4, 0x18, 0xa7, 0x05, 0x5f,
+    0x81, 0xc4, 0x28, 0x74, 0x05, 0x5f, 0xc9, 0xc3, 0x05, 0x16, 0x05, 0x5f,
+    0x89, 0x16, 0xc0, 0xfd, 0xe4, 0x08, 0xc0, 0xfd, 0xf0, 0x15, 0xc0, 0xfd,
+    0xfc, 0xc5, 0x0a, 0xfd, 0x05, 0x5f, 0xc0, 0x01, 0xc0, 0xfe, 0x08, 0xc3,
+    0x1c, 0xa8, 0x0f, 0xb7, 0x19, 0xcf, 0x68, 0x18, 0x0f, 0xcd, 0xe0, 0xc3,
+    0x00, 0xae, 0x01, 0x37, 0x83, 0x00, 0xfe, 0x14, 0xc5, 0xd8, 0x41, 0x0f,
+    0xaf, 0xd8, 0x01, 0x40, 0xfe, 0x18, 0x49, 0x81, 0x1b, 0xc0, 0xfe, 0x24,
+    0xcd, 0x80, 0x31, 0x01, 0x1c, 0x69, 0xc4, 0x41, 0x14, 0x0f, 0xb4, 0xe8,
+    0x16, 0xc0, 0xfe, 0x2e, 0x15, 0xc0, 0xfe, 0x40, 0xce, 0x74, 0x06, 0x08,
+    0xb3, 0x3b, 0x00, 0xfe, 0x4f, 0xcd, 0x75, 0x87, 0x08, 0xb3, 0x0b, 0x00,
+    0xfe, 0x55, 0xc5, 0x03, 0x6f, 0x00, 0xc0, 0x03, 0x00, 0xfe, 0x5b, 0x06,
+    0xc0, 0xfe, 0x61, 0x47, 0x01, 0x92, 0xc0, 0xfe, 0x6d, 0x08, 0xc0, 0xfe,
+    0xf8, 0xcf, 0x66, 0x56, 0x00, 0xc0, 0x71, 0xc6, 0xce, 0x4e, 0x00, 0xc0,
+    0x51, 0x47, 0xc5, 0x08, 0xc0, 0xff, 0x0a, 0x42, 0x00, 0xaa, 0xc0, 0xff,
+    0x16, 0xc8, 0x26, 0x15, 0x00, 0xc0, 0x08, 0x01, 0xc0, 0xff, 0x22, 0xcb,
+    0x58, 0x67, 0x0f, 0xc8, 0x88, 0xc5, 0x10, 0x8c, 0x0f, 0xa1, 0xa8, 0x01,
+    0xc0, 0xff, 0x2e, 0x45, 0x01, 0xab, 0x40, 0xff, 0x4a, 0xc2, 0x07, 0xf8,
+    0x01, 0x15, 0x39, 0xcd, 0x7e, 0xdf, 0x0f, 0xc9, 0xd8, 0xc3, 0x7a, 0x27,
+    0x0f, 0xa7, 0xa1, 0xdd, 0x11, 0x36, 0x0f, 0xa7, 0x90, 0xd0, 0x59, 0xd2,
+    0x0f, 0x9c, 0x89, 0xc4, 0x28, 0xfe, 0x0f, 0xcb, 0x70, 0x47, 0xc8, 0x49,
+    0xc0, 0xff, 0x56, 0x45, 0x5f, 0x82, 0xc0, 0xff, 0x84, 0x4a, 0x9e, 0xb2,
+    0xc0, 0xff, 0xc2, 0x15, 0xc0, 0xff, 0xd4, 0x4e, 0x6f, 0xd0, 0xc0, 0xff,
+    0xe0, 0x08, 0xc0, 0xff, 0xf2, 0x42, 0x00, 0x4c, 0xc0, 0xff, 0xfe, 0x45,
+    0x00, 0x2f, 0x41, 0x00, 0x0a, 0xc4, 0x12, 0xbb, 0x0e, 0x97, 0x98, 0xc4,
+    0x00, 0x65, 0x0e, 0x97, 0x43, 0x01, 0x00, 0x22, 0xc5, 0x65, 0x84, 0x0e,
+    0x97, 0x58, 0xc4, 0x17, 0xf7, 0x0e, 0x97, 0x3b, 0x01, 0x00, 0x28, 0xc2,
+    0x24, 0x36, 0x0e, 0x97, 0x32, 0x01, 0x00, 0x2e, 0x0b, 0xc1, 0x00, 0x34,
+    0xc3, 0x04, 0xa0, 0x0e, 0x97, 0x22, 0x01, 0x00, 0x40, 0x0a, 0xc1, 0x00,
+    0x46, 0x19, 0xc1, 0x00, 0x52, 0xc2, 0x00, 0x79, 0x0e, 0x97, 0x50, 0x91,
+    0x08, 0xf7, 0xb1, 0x87, 0x08, 0xf7, 0xa9, 0x97, 0x08, 0xf7, 0xa1, 0x8b,
+    0x08, 0xf7, 0x98, 0x83, 0x08, 0xf7, 0x89, 0xc2, 0x0d, 0x01, 0x08, 0xf7,
+    0x81, 0xc2, 0x02, 0x63, 0x08, 0xf7, 0x79, 0xc2, 0x00, 0x89, 0x08, 0xf7,
+    0x71, 0xc2, 0x00, 0x3b, 0x08, 0xf7, 0x69, 0xc2, 0x1a, 0x18, 0x08, 0xf7,
+    0x61, 0x10, 0xc1, 0x00, 0x5c, 0xc2, 0x21, 0x7d, 0x08, 0xf7, 0x51, 0xc2,
+    0x03, 0xc6, 0x08, 0xf7, 0x49, 0xc2, 0x0e, 0x60, 0x08, 0xf7, 0x39, 0xc2,
+    0x00, 0x51, 0x08, 0xf7, 0x31, 0xc2, 0x00, 0xb6, 0x08, 0xf7, 0x29, 0xc2,
+    0x00, 0xa0, 0x08, 0xf7, 0x21, 0xc2, 0x04, 0xf2, 0x08, 0xf7, 0x19, 0xc2,
+    0x00, 0xeb, 0x08, 0xf7, 0x09, 0xc2, 0x02, 0x4d, 0x08, 0xf7, 0x00, 0x46,
+    0x04, 0x99, 0xc1, 0x00, 0x6c, 0x14, 0xc1, 0x00, 0x90, 0x18, 0xc1, 0x00,
+    0x9c, 0x45, 0x00, 0x8d, 0xc1, 0x00, 0xa8, 0x47, 0x01, 0x92, 0x41, 0x00,
+    0xc6, 0x15, 0xc1, 0x01, 0x2d, 0x4b, 0x6e, 0xbb, 0xc1, 0x01, 0x39, 0x47,
+    0x01, 0x92, 0xc1, 0x01, 0x4f, 0xc9, 0xaa, 0x03, 0x08, 0xe3, 0x89, 0xc9,
+    0x17, 0x63, 0x08, 0xe3, 0x80, 0x4c, 0x34, 0x02, 0xc1, 0x01, 0xaf, 0xcf,
+    0x22, 0x4e, 0x01, 0x35, 0x29, 0xc4, 0x00, 0x8d, 0x01, 0x32, 0x10, 0x45,
+    0x00, 0x8d, 0xc1, 0x01, 0xbb, 0x47, 0x01, 0x92, 0xc1, 0x01, 0xcd, 0x4b,
+    0x6e, 0xbb, 0xc1, 0x02, 0x36, 0xce, 0x73, 0x88, 0x00, 0x6a, 0xb9, 0x49,
+    0x54, 0x43, 0xc1, 0x02, 0x5c, 0x06, 0xc1, 0x02, 0x68, 0x47, 0x37, 0xb8,
+    0x41, 0x02, 0x74, 0x4c, 0x10, 0x43, 0xc1, 0x02, 0x80, 0x47, 0x37, 0xb8,
+    0xc1, 0x02, 0x9e, 0x52, 0x4d, 0x59, 0xc1, 0x02, 0xb1, 0x47, 0x01, 0x92,
+    0xc1, 0x02, 0xbd, 0xc7, 0xc6, 0x97, 0x08, 0x56, 0x40, 0xc7, 0xc7, 0xd9,
+    0x0f, 0xab, 0xd1, 0x43, 0x07, 0x9b, 0xc1, 0x03, 0x22, 0x45, 0x00, 0x92,
+    0xc1, 0x03, 0x2e, 0xd7, 0x29, 0x87, 0x0f, 0xa3, 0x58, 0xcb, 0x05, 0x1e,
+    0x00, 0x42, 0xf1, 0xcf, 0x64, 0x58, 0x00, 0x42, 0xd9, 0xd1, 0x52, 0x23,
+    0x00, 0x42, 0xd1, 0xd0, 0x58, 0x72, 0x00, 0x42, 0xc9, 0x47, 0x01, 0x92,
+    0x41, 0x03, 0x3a, 0x0e, 0xc1, 0x03, 0x5a, 0x15, 0xc1, 0x03, 0x66, 0xd1,
+    0x4f, 0x8c, 0x08, 0x8b, 0xa0, 0xc5, 0x91, 0xdd, 0x0f, 0x81, 0x51, 0x19,
+    0xc1, 0x03, 0x72, 0x07, 0xc1, 0x03, 0x84, 0x15, 0xc1, 0x03, 0x90, 0x10,
+    0xc1, 0x03, 0xae, 0xca, 0xa0, 0x1a, 0x0f, 0x80, 0x21, 0xcc, 0x89, 0x10,
+    0x0f, 0x80, 0x29, 0x11, 0xc1, 0x03, 0xba, 0x16, 0xc1, 0x03, 0xc6, 0x08,
+    0xc1, 0x03, 0xd2, 0xc4, 0xe2, 0xc4, 0x0f, 0x81, 0x11, 0xcd, 0x7a, 0xdc,
+    0x0f, 0x81, 0x29, 0x42, 0x00, 0xa0, 0xc1, 0x03, 0xde, 0xc6, 0xd0, 0x76,
+    0x0f, 0x81, 0x40, 0x43, 0x00, 0x52, 0xc1, 0x03, 0xea, 0x01, 0x41, 0x03,
+    0xfd, 0x42, 0x0d, 0x1b, 0xc1, 0x04, 0x0f, 0xc3, 0x3d, 0xe0, 0x01, 0x15,
+    0xc1, 0xc3, 0x0a, 0xc7, 0x01, 0x14, 0x62, 0x01, 0x04, 0x1b, 0xcc, 0x46,
+    0xd2, 0x08, 0x95, 0x49, 0x47, 0x01, 0x92, 0x41, 0x04, 0x1f, 0xc4, 0x28,
+    0x74, 0x0b, 0x53, 0x49, 0xc5, 0x0a, 0xfd, 0x0b, 0x53, 0x41, 0x15, 0xc1,
+    0x04, 0x7b, 0x08, 0xc1, 0x04, 0x87, 0x16, 0xc1, 0x04, 0x93, 0xc3, 0x05,
+    0x16, 0x0b, 0x53, 0x09, 0xc4, 0x18, 0xa7, 0x0b, 0x53, 0x00, 0xc2, 0x13,
+    0x86, 0x0b, 0x52, 0xf1, 0xc3, 0x01, 0xe5, 0x0b, 0x52, 0xa9, 0x83, 0x0b,
+    0x52, 0x00, 0x8b, 0x0b, 0x52, 0xe9, 0x91, 0x0b, 0x52, 0x98, 0x8b, 0x0b,
+    0x52, 0xe1, 0x91, 0x0b, 0x52, 0x48, 0x90, 0x0b, 0x52, 0xd0, 0x91, 0x0b,
+    0x52, 0xc9, 0xc4, 0xe0, 0xdc, 0x0b, 0x52, 0x61, 0xc3, 0x47, 0x29, 0x0b,
+    0x52, 0x40, 0x83, 0x0b, 0x52, 0xb0, 0x91, 0x0b, 0x52, 0x89, 0x8e, 0x0b,
+    0x52, 0x68, 0x83, 0x0b, 0x52, 0x81, 0xc2, 0x00, 0x0a, 0x0b, 0x52, 0x38,
+    0xc2, 0x00, 0xaf, 0x0b, 0x52, 0x79, 0xc2, 0x03, 0x8d, 0x0b, 0x52, 0x08,
+    0xc3, 0x7a, 0x7e, 0x0b, 0x52, 0x71, 0xc2, 0x00, 0xf0, 0x0b, 0x52, 0x18,
+    0x8b, 0x0b, 0x52, 0x50, 0x4f, 0x62, 0xe1, 0xc1, 0x04, 0x9f, 0xce, 0x6f,
+    0x28, 0x05, 0x53, 0xd9, 0x15, 0xc1, 0x04, 0xa7, 0x03, 0xc1, 0x04, 0xb3,
+    0xc9, 0x0f, 0x7e, 0x00, 0x81, 0xb9, 0x42, 0x06, 0xb4, 0xc1, 0x04, 0xbf,
+    0xce, 0x6d, 0xae, 0x00, 0x82, 0x51, 0x57, 0x27, 0x1a, 0xc1, 0x04, 0xcb,
+    0xd4, 0x38, 0x92, 0x00, 0x84, 0x79, 0x4c, 0x88, 0x8c, 0x41, 0x04, 0xdf,
+    0x03, 0xc1, 0x04, 0xe7, 0xc8, 0xb8, 0x40, 0x00, 0x82, 0x61, 0xc9, 0xb3,
+    0x9c, 0x00, 0x82, 0x69, 0xc8, 0xbc, 0x58, 0x00, 0x82, 0x79, 0x45, 0x4c,
+    0xb7, 0x41, 0x04, 0xf3, 0xc4, 0x18, 0xa7, 0x00, 0x84, 0x81, 0xc3, 0x05,
+    0x16, 0x00, 0x84, 0x89, 0x16, 0xc1, 0x04, 0xff, 0x08, 0xc1, 0x05, 0x0b,
+    0x15, 0xc1, 0x05, 0x17, 0xc5, 0x0a, 0xfd, 0x00, 0x84, 0xc1, 0xc4, 0x28,
+    0x74, 0x00, 0x84, 0xc8, 0x83, 0x00, 0x81, 0x0b, 0x01, 0x05, 0x23, 0x0d,
+    0xc1, 0x05, 0x2d, 0x16, 0xc1, 0x05, 0x3a, 0x15, 0xc1, 0x05, 0x4b, 0x09,
+    0xc1, 0x05, 0x5f, 0x10, 0xc1, 0x05, 0x6f, 0x05, 0xc1, 0x05, 0x83, 0x0c,
+    0xc1, 0x05, 0x8d, 0x06, 0xc1, 0x05, 0x97, 0x12, 0xc1, 0x05, 0xa5, 0x04,
+    0xc1, 0x05, 0xaf, 0x0f, 0xc1, 0x05, 0xb9, 0xc2, 0x1a, 0x18, 0x00, 0x80,
+    0xd1, 0x14, 0xc1, 0x05, 0xc3, 0x0e, 0xc1, 0x05, 0xcd, 0x19, 0xc1, 0x05,
+    0xd7, 0xc2, 0x00, 0xce, 0x00, 0x80, 0xf9, 0x8b, 0x00, 0x81, 0x1b, 0x01,
+    0x05, 0xe1, 0x97, 0x00, 0x81, 0x2b, 0x01, 0x05, 0xe5, 0x87, 0x00, 0x81,
+    0x3b, 0x01, 0x05, 0xe9, 0x91, 0x00, 0x81, 0x49, 0x48, 0xaa, 0xd2, 0x41,
+    0x05, 0xef, 0xc2, 0x02, 0x50, 0x05, 0x53, 0xb1, 0xc2, 0x81, 0x3b, 0x05,
+    0x53, 0xa9, 0xc3, 0xe5, 0xa1, 0x05, 0x53, 0xa0, 0xc4, 0x28, 0x74, 0x05,
+    0x4f, 0xc9, 0xc5, 0x0a, 0xfd, 0x05, 0x4f, 0xc1, 0x15, 0xc1, 0x05, 0xfd,
+    0x08, 0xc1, 0x06, 0x09, 0x16, 0xc1, 0x06, 0x15, 0xc3, 0x05, 0x16, 0x05,
+    0x4f, 0x89, 0xc4, 0x18, 0xa7, 0x05, 0x4f, 0x80, 0xc5, 0xdd, 0xff, 0x00,
+    0x83, 0x19, 0xc6, 0xd3, 0x70, 0x00, 0x83, 0x20, 0x83, 0x00, 0x81, 0x61,
+    0x8b, 0x00, 0x81, 0x92, 0x01, 0x06, 0x21, 0x8b, 0x00, 0x81, 0x70, 0x97,
+    0x00, 0x81, 0x80, 0xc6, 0x00, 0xd1, 0x00, 0x81, 0xa8, 0xc2, 0x25, 0x71,
+    0x00, 0x81, 0x99, 0x91, 0x00, 0x81, 0xa0, 0x94, 0x00, 0x82, 0xb3, 0x01,
+    0x06, 0x2a, 0x8e, 0x00, 0x82, 0xc2, 0x01, 0x06, 0x2e, 0xcc, 0x87, 0x54,
+    0x00, 0x83, 0x11, 0x44, 0x00, 0xce, 0x41, 0x06, 0x32, 0xc2, 0x27, 0xff,
+    0x00, 0x83, 0x39, 0xc2, 0x0e, 0x21, 0x00, 0x83, 0x40, 0xc2, 0x0b, 0x28,
+    0x00, 0x83, 0x91, 0x97, 0x00, 0x83, 0x99, 0xc2, 0x00, 0xc8, 0x00, 0x83,
+    0xa0, 0x46, 0x2c, 0x6c, 0xc1, 0x06, 0x45, 0x4a, 0xa0, 0x2e, 0x41, 0x06,
+    0x5d, 0xc2, 0x01, 0xa2, 0x00, 0x82, 0x11, 0xc4, 0x03, 0xe0, 0x00, 0x82,
+    0x18, 0xc3, 0x04, 0xa0, 0x00, 0x82, 0x21, 0xc3, 0x0c, 0xf7, 0x00, 0x82,
+    0x28, 0xc2, 0x24, 0x36, 0x00, 0x82, 0x31, 0xc4, 0x17, 0xf7, 0x00, 0x82,
+    0x38, 0xc3, 0x00, 0x72, 0x0f, 0xd5, 0x39, 0x45, 0x3d, 0x82, 0x41, 0x06,
+    0x6f, 0xcc, 0x83, 0xa0, 0x01, 0x08, 0x78, 0x49, 0xac, 0xf7, 0xc1, 0x06,
+    0x7b, 0xcc, 0x89, 0x1c, 0x0f, 0xb6, 0xe8, 0x46, 0x14, 0xfe, 0x41, 0x06,
+    0xb9, 0xc5, 0x00, 0x8c, 0x00, 0x01, 0x5b, 0x01, 0x06, 0xc1, 0xcb, 0x94,
+    0xa2, 0x00, 0x05, 0x88, 0xc6, 0x1f, 0x5f, 0x01, 0x11, 0xbb, 0x01, 0x06,
+    0xc5, 0xc9, 0xad, 0x87, 0x01, 0x0a, 0x50, 0x16, 0xc1, 0x06, 0xcb, 0xc2,
+    0x01, 0x0e, 0x0f, 0xc9, 0xa2, 0x01, 0x06, 0xda, 0x46, 0xd2, 0x8c, 0xc1,
+    0x06, 0xe0, 0xca, 0xa7, 0x54, 0x00, 0x04, 0xf0, 0x01, 0x41, 0x06, 0xe8,
+    0xcd, 0x77, 0xb6, 0x01, 0x08, 0xf1, 0x5b, 0x14, 0xf6, 0x41, 0x07, 0x00,
+    0xc5, 0x29, 0x8b, 0x0f, 0xc9, 0x81, 0xc3, 0x12, 0xf2, 0x0f, 0xd6, 0x19,
+    0xc6, 0x17, 0x4c, 0x0f, 0xd6, 0x20, 0xc8, 0x29, 0x95, 0x0f, 0xc8, 0x79,
+    0xca, 0xa6, 0xbe, 0x0f, 0xc8, 0x60, 0xcb, 0x98, 0xcd, 0x0f, 0x9c, 0x69,
+    0xc5, 0xd5, 0x94, 0x0f, 0x9a, 0x68, 0xc4, 0x07, 0xe9, 0x0f, 0xa1, 0xb9,
+    0xc4, 0x12, 0x8a, 0x0f, 0xa1, 0xe8, 0xd0, 0x58, 0x52, 0x01, 0x1c, 0x91,
+    0xd2, 0x4a, 0xbf, 0x01, 0x1c, 0x88, 0xc9, 0xb0, 0xba, 0x0f, 0xb7, 0x99,
+    0xc8, 0x19, 0xf6, 0x01, 0x5f, 0xe8, 0x94, 0x0f, 0xa6, 0xf9, 0x01, 0xc1,
+    0x07, 0x38, 0x95, 0x0f, 0xae, 0x80, 0x01, 0x41, 0x07, 0x44, 0xcf, 0x63,
+    0x59, 0x08, 0xd7, 0xa3, 0x01, 0x07, 0x50, 0x46, 0x01, 0x93, 0x41, 0x07,
+    0x54, 0x01, 0x41, 0x07, 0xc2, 0xc4, 0x27, 0x2c, 0x08, 0xd7, 0x63, 0x01,
+    0x07, 0xce, 0xcc, 0x22, 0xbd, 0x08, 0xd7, 0x3a, 0x01, 0x07, 0xd2, 0x01,
+    0x41, 0x07, 0xd8, 0x01, 0xc1, 0x07, 0xe7, 0x46, 0xd2, 0x20, 0xc1, 0x07,
+    0xff, 0xcd, 0x77, 0x68, 0x0f, 0xc9, 0x90, 0x43, 0x01, 0xba, 0xc1, 0x08,
+    0x11, 0xc8, 0xbf, 0x78, 0x0f, 0x9c, 0x49, 0xd1, 0x56, 0xfc, 0x01, 0x81,
+    0xe9, 0xcc, 0x82, 0x38, 0x01, 0x92, 0x80, 0x46, 0x09, 0x33, 0xc1, 0x08,
+    0x1b, 0x47, 0x37, 0xb8, 0xc1, 0x08, 0x27, 0x46, 0x04, 0x99, 0xc1, 0x08,
+    0x3d, 0x47, 0xc5, 0x16, 0xc1, 0x08, 0x5b, 0x52, 0x48, 0xfd, 0xc1, 0x08,
+    0xa1, 0x4a, 0x9a, 0x34, 0x41, 0x08, 0xad, 0x45, 0x6a, 0x4b, 0xc1, 0x08,
+    0xeb, 0x45, 0x04, 0xf6, 0xc1, 0x08, 0xf7, 0xc5, 0xd5, 0x26, 0x0f, 0xd4,
+    0x10, 0x49, 0xae, 0xb9, 0xc1, 0x09, 0x09, 0x49, 0x2c, 0x05, 0x41, 0x09,
+    0x3b, 0x44, 0xaa, 0x11, 0xc1, 0x09, 0x7d, 0x0f, 0xc1, 0x09, 0x97, 0xc3,
+    0x0c, 0x04, 0x0b, 0x5b, 0x81, 0x16, 0xc1, 0x09, 0xa3, 0xc2, 0x03, 0x4f,
+    0x0b, 0x5b, 0x61, 0x10, 0xc1, 0x09, 0xb5, 0x1a, 0xc1, 0x09, 0xc1, 0x0a,
+    0xc1, 0x09, 0xd1, 0xc8, 0xb5, 0xd8, 0x0b, 0x5b, 0x39, 0x44, 0xde, 0x84,
+    0xc1, 0x09, 0xdd, 0xc6, 0xd1, 0xea, 0x0b, 0x5a, 0x18, 0x16, 0xc1, 0x09,
+    0xf9, 0x47, 0x0c, 0xe7, 0xc1, 0x0a, 0x05, 0xc8, 0x32, 0x37, 0x0b, 0x5a,
+    0xf0, 0xc4, 0x28, 0x74, 0x0b, 0x5a, 0xc9, 0xc5, 0x0a, 0xfd, 0x0b, 0x5a,
+    0xc1, 0x15, 0xc1, 0x0a, 0x0f, 0x08, 0xc1, 0x0a, 0x1b, 0x16, 0xc1, 0x0a,
+    0x27, 0xc3, 0x05, 0x16, 0x0b, 0x5a, 0x89, 0xc4, 0x18, 0xa7, 0x0b, 0x5a,
+    0x80, 0x16, 0xc1, 0x0a, 0x33, 0xc3, 0xdf, 0x5c, 0x0b, 0x59, 0xa9, 0x15,
+    0xc1, 0x0a, 0x3f, 0x0d, 0x41, 0x0a, 0x49, 0x03, 0xc1, 0x0a, 0x55, 0x19,
+    0xc1, 0x0a, 0x6d, 0x0b, 0xc1, 0x0a, 0x75, 0x11, 0xc1, 0x0a, 0x81, 0x17,
+    0xc1, 0x0a, 0x8d, 0x07, 0x41, 0x0a, 0x99, 0xd0, 0x3d, 0xe6, 0x0f, 0xb5,
+    0x81, 0xc2, 0x00, 0x5d, 0x0f, 0xca, 0xa0, 0xc8, 0x1a, 0xe8, 0x0f, 0xb1,
+    0xf1, 0xc4, 0x07, 0xe9, 0x0f, 0xb1, 0x08, 0xcb, 0x92, 0x71, 0x01, 0x1f,
+    0xf1, 0xc5, 0x07, 0xf4, 0x01, 0x1f, 0xd8, 0xc7, 0x07, 0xf2, 0x01, 0x1f,
+    0xe9, 0xcb, 0x95, 0x05, 0x01, 0x1f, 0xe0, 0x43, 0x00, 0x52, 0xc1, 0x0a,
+    0xa5, 0xc3, 0x35, 0x56, 0x0f, 0xa7, 0x70, 0xc7, 0x02, 0x1c, 0x01, 0x03,
+    0x49, 0xca, 0x9c, 0xc8, 0x01, 0x01, 0x60, 0xd1, 0x4f, 0x04, 0x0f, 0xb5,
+    0x40, 0xc7, 0x07, 0xed, 0x01, 0x57, 0x08, 0x42, 0x00, 0x47, 0xc1, 0x0a,
+    0xb4, 0xc7, 0xc6, 0x12, 0x01, 0x18, 0x31, 0xcc, 0x80, 0x94, 0x0f, 0xb1,
+    0x18, 0xc4, 0x00, 0x8d, 0x01, 0x0a, 0x61, 0xd1, 0x53, 0xcc, 0x01, 0x01,
+    0x89, 0xca, 0x9e, 0xc6, 0x01, 0x01, 0x80, 0xc8, 0x12, 0x4f, 0x01, 0x31,
+    0x71, 0x8a, 0x0f, 0x9a, 0x89, 0xc3, 0x04, 0x5c, 0x0f, 0xcc, 0xd0, 0xc4,
+    0x03, 0xe0, 0x08, 0x5d, 0x59, 0x19, 0xc1, 0x0a, 0xbe, 0xc2, 0x00, 0x79,
+    0x08, 0x5d, 0x68, 0xc8, 0x0c, 0xe6, 0x08, 0x5d, 0x78, 0xc3, 0x11, 0x9a,
+    0x08, 0x5c, 0x81, 0x03, 0x41, 0x0a, 0xc8, 0xc2, 0x00, 0x60, 0x08, 0x5c,
+    0x38, 0xce, 0x74, 0x3e, 0x08, 0x48, 0xf9, 0x47, 0x37, 0xb8, 0xc1, 0x0a,
+    0xd4, 0x47, 0x01, 0x92, 0x41, 0x0a, 0xe1, 0x47, 0x01, 0x92, 0xc1, 0x0b,
+    0x44, 0x15, 0xc1, 0x0b, 0xca, 0xd0, 0x5a, 0xe2, 0x05, 0x43, 0xa9, 0x45,
+    0x01, 0x69, 0x41, 0x0b, 0xd4, 0x12, 0xc1, 0x0b, 0xe0, 0x16, 0xc1, 0x0b,
+    0xf0, 0x05, 0xc1, 0x0c, 0x02, 0x19, 0xc1, 0x0c, 0x16, 0x0a, 0xc1, 0x0c,
+    0x22, 0x04, 0xc1, 0x0c, 0x34, 0x15, 0xc1, 0x0c, 0x47, 0x42, 0x00, 0xb6,
+    0xc1, 0x0c, 0x65, 0x42, 0x00, 0xdf, 0xc1, 0x0c, 0x71, 0x42, 0x00, 0xd8,
+    0xc1, 0x0c, 0x7b, 0x14, 0xc1, 0x0c, 0x87, 0xc5, 0xd6, 0xd9, 0x08, 0x0f,
+    0x71, 0xc4, 0xab, 0x1a, 0x08, 0x0f, 0x99, 0xc7, 0xc5, 0xe1, 0x08, 0x0f,
+    0xb9, 0x09, 0xc1, 0x0c, 0x93, 0xc5, 0x00, 0x83, 0x08, 0x0e, 0xc9, 0xc5,
+    0xdd, 0x41, 0x08, 0x0f, 0xc0, 0xca, 0xa0, 0xb0, 0x0f, 0xad, 0x30, 0x47,
+    0x01, 0x92, 0xc1, 0x0c, 0x9f, 0xca, 0x3e, 0x00, 0x01, 0x87, 0xd9, 0xce,
+    0x1a, 0x58, 0x01, 0x87, 0xe9, 0xd5, 0x32, 0x83, 0x01, 0x87, 0xf1, 0xcc,
+    0x82, 0x44, 0x01, 0x87, 0xf8, 0xd1, 0x2f, 0x0b, 0x01, 0x84, 0xd9, 0xd6,
+    0x31, 0x42, 0x01, 0x84, 0xe1, 0xcd, 0x7e, 0x9e, 0x01, 0x85, 0x01, 0xd4,
+    0x0d, 0xc6, 0x01, 0x87, 0xe0, 0xc6, 0x00, 0xd1, 0x08, 0x86, 0x68, 0xc9,
+    0xaa, 0xd2, 0x08, 0x86, 0x11, 0x03, 0xc1, 0x0c, 0xf5, 0x91, 0x08, 0x85,
+    0xb9, 0x87, 0x08, 0x85, 0xa9, 0x97, 0x08, 0x85, 0x9b, 0x01, 0x0d, 0x01,
+    0x8b, 0x08, 0x85, 0x8a, 0x01, 0x0d, 0x05, 0x46, 0x03, 0x7b, 0xc1, 0x0d,
+    0x09, 0xc4, 0x19, 0xf1, 0x08, 0x86, 0x00, 0xcb, 0x46, 0xd3, 0x08, 0x85,
+    0xf1, 0x44, 0x00, 0x8e, 0x41, 0x0d, 0x15, 0xc2, 0x00, 0xce, 0x08, 0x85,
+    0x79, 0x15, 0xc1, 0x0d, 0x2d, 0xc2, 0x02, 0x63, 0x08, 0x85, 0x59, 0xc2,
+    0x00, 0x89, 0x08, 0x85, 0x51, 0x14, 0xc1, 0x0d, 0x3d, 0xc2, 0x1a, 0x18,
+    0x08, 0x85, 0x41, 0xc2, 0x00, 0xb6, 0x08, 0x85, 0x39, 0x04, 0xc1, 0x0d,
+    0x47, 0x12, 0xc1, 0x0d, 0x51, 0x10, 0xc1, 0x0d, 0x5b, 0x06, 0xc1, 0x0d,
+    0x71, 0x16, 0xc1, 0x0d, 0x7f, 0x0c, 0xc1, 0x0d, 0x8d, 0x05, 0xc1, 0x0d,
+    0x97, 0x09, 0xc1, 0x0d, 0xa1, 0x0d, 0xc1, 0x0d, 0xab, 0x83, 0x08, 0x84,
+    0x1b, 0x01, 0x0d, 0xb5, 0x91, 0x08, 0x84, 0x59, 0x87, 0x08, 0x84, 0x49,
+    0x97, 0x08, 0x84, 0x3b, 0x01, 0x0d, 0xc1, 0x8b, 0x08, 0x84, 0x2a, 0x01,
+    0x0d, 0xc5, 0xc4, 0xde, 0xc0, 0x05, 0x49, 0x79, 0xc3, 0xe4, 0xa8, 0x05,
+    0x49, 0x70, 0xc5, 0xd4, 0xcc, 0x05, 0x49, 0x63, 0x01, 0x0d, 0xc9, 0xc6,
+    0xc4, 0x3e, 0x05, 0x49, 0x58, 0x91, 0x05, 0x49, 0x51, 0x87, 0x05, 0x49,
+    0x3b, 0x01, 0x0d, 0xcf, 0x97, 0x05, 0x49, 0x42, 0x01, 0x0d, 0xd3, 0x11,
+    0xc1, 0x0d, 0xd7, 0x8b, 0x05, 0x49, 0x21, 0x83, 0x05, 0x49, 0x11, 0xc2,
+    0x03, 0xc6, 0x05, 0x49, 0x09, 0xc2, 0x02, 0x63, 0x05, 0x49, 0x01, 0x0a,
+    0xc1, 0x0d, 0xdf, 0x16, 0xc1, 0x0d, 0xe9, 0xc2, 0x00, 0x71, 0x05, 0x48,
+    0xe9, 0xc2, 0x00, 0x89, 0x05, 0x48, 0xe1, 0xc2, 0x1a, 0x18, 0x05, 0x48,
+    0xd9, 0xc2, 0x00, 0x3b, 0x05, 0x48, 0xd1, 0xc2, 0x00, 0xa0, 0x05, 0x48,
+    0xc9, 0xc2, 0x0e, 0x60, 0x05, 0x48, 0xc1, 0xc2, 0x00, 0xb6, 0x05, 0x48,
+    0xb9, 0x12, 0xc1, 0x0d, 0xf3, 0x10, 0xc1, 0x0d, 0xfd, 0xc2, 0x01, 0x16,
+    0x05, 0x48, 0x81, 0x15, 0xc1, 0x0e, 0x0d, 0xc2, 0x00, 0xeb, 0x05, 0x48,
+    0x61, 0x0d, 0x41, 0x0e, 0x17, 0xc4, 0x28, 0x74, 0x05, 0x48, 0x49, 0xc5,
+    0x0a, 0xfd, 0x05, 0x48, 0x41, 0x15, 0xc1, 0x0e, 0x21, 0x08, 0xc1, 0x0e,
+    0x2d, 0x16, 0xc1, 0x0e, 0x39, 0xc3, 0x05, 0x16, 0x05, 0x48, 0x09, 0xc4,
+    0x18, 0xa7, 0x05, 0x48, 0x00, 0x45, 0x00, 0x8d, 0xc1, 0x0e, 0x45, 0x42,
+    0x00, 0x2f, 0xc1, 0x0e, 0x6b, 0x4b, 0x6e, 0xbb, 0xc1, 0x0e, 0x77, 0xce,
+    0x74, 0x92, 0x00, 0x66, 0xb1, 0x46, 0x04, 0x99, 0x41, 0x0e, 0x9d, 0xc4,
+    0xe1, 0x28, 0x0f, 0xcc, 0xc1, 0x4b, 0x8e, 0x46, 0x41, 0x0e, 0xc1, 0xc4,
+    0x28, 0x74, 0x08, 0x97, 0xc9, 0x15, 0xc1, 0x0f, 0x25, 0x08, 0xc1, 0x0f,
+    0x31, 0x16, 0xc1, 0x0f, 0x3d, 0xc3, 0x05, 0x16, 0x08, 0x97, 0x89, 0xc4,
+    0x18, 0xa7, 0x08, 0x97, 0x81, 0xc5, 0x0a, 0xfd, 0x08, 0x97, 0xc0, 0xc6,
+    0x1f, 0xf5, 0x08, 0x97, 0x51, 0xc5, 0x34, 0xd9, 0x08, 0x97, 0x49, 0xc8,
+    0x14, 0x02, 0x08, 0x96, 0xf8, 0x91, 0x08, 0x97, 0x39, 0x03, 0xc1, 0x0f,
+    0x49, 0x87, 0x08, 0x97, 0x29, 0x97, 0x08, 0x97, 0x1b, 0x01, 0x0f, 0x55,
+    0x8b, 0x08, 0x97, 0x0a, 0x01, 0x0f, 0x59, 0xc2, 0x00, 0xce, 0x08, 0x96,
+    0xf1, 0x15, 0xc1, 0x0f, 0x5d, 0xc2, 0x02, 0x63, 0x08, 0x96, 0xd9, 0xc2,
+    0x00, 0x89, 0x08, 0x96, 0xd1, 0x14, 0xc1, 0x0f, 0x67, 0xc2, 0x1a, 0x18,
+    0x08, 0x96, 0xc1, 0xc2, 0x00, 0xb6, 0x08, 0x96, 0xb9, 0x04, 0xc1, 0x0f,
+    0x71, 0x12, 0xc1, 0x0f, 0x81, 0x10, 0xc1, 0x0f, 0x8b, 0x06, 0xc1, 0x0f,
+    0xa1, 0x16, 0xc1, 0x0f, 0xaf, 0x0c, 0xc1, 0x0f, 0xbd, 0x05, 0xc1, 0x0f,
+    0xcd, 0x09, 0xc1, 0x0f, 0xd7, 0x0d, 0xc1, 0x0f, 0xe7, 0x83, 0x08, 0x95,
+    0x83, 0x01, 0x0f, 0xf1, 0x91, 0x08, 0x95, 0xc1, 0x87, 0x08, 0x95, 0xb1,
+    0x97, 0x08, 0x95, 0xa3, 0x01, 0x0f, 0xfd, 0x8b, 0x08, 0x95, 0x92, 0x01,
+    0x10, 0x01, 0x44, 0x00, 0x8e, 0xc1, 0x10, 0x05, 0xcb, 0x46, 0xd3, 0x08,
+    0x91, 0xd8, 0x46, 0x03, 0x7b, 0xc1, 0x10, 0x1b, 0xc4, 0x19, 0xf1, 0x08,
+    0x91, 0xc0, 0x03, 0xc1, 0x10, 0x27, 0x91, 0x08, 0x91, 0x91, 0x87, 0x08,
+    0x91, 0x81, 0x97, 0x08, 0x91, 0x79, 0x8b, 0x08, 0x91, 0x6a, 0x01, 0x10,
+    0x33, 0x0e, 0xc1, 0x10, 0x37, 0xc2, 0x00, 0xce, 0x08, 0x91, 0x51, 0xc2,
+    0x0d, 0x01, 0x08, 0x91, 0x49, 0xc2, 0x02, 0x63, 0x08, 0x91, 0x41, 0xc2,
+    0x00, 0x3b, 0x08, 0x91, 0x31, 0xc2, 0x1a, 0x18, 0x08, 0x91, 0x29, 0xc2,
+    0x00, 0xb6, 0x08, 0x91, 0x21, 0x04, 0xc1, 0x10, 0x41, 0x12, 0xc1, 0x10,
+    0x51, 0x10, 0xc1, 0x10, 0x5b, 0x06, 0xc1, 0x10, 0x71, 0x16, 0xc1, 0x10,
+    0x7f, 0x0c, 0xc1, 0x10, 0x8d, 0x05, 0xc1, 0x10, 0x97, 0x09, 0xc1, 0x10,
+    0xa1, 0x0d, 0xc1, 0x10, 0xb1, 0x83, 0x08, 0x90, 0x03, 0x01, 0x10, 0xbb,
+    0x91, 0x08, 0x90, 0x31, 0x87, 0x08, 0x90, 0x21, 0x97, 0x08, 0x90, 0x19,
+    0x8b, 0x08, 0x90, 0x10, 0x46, 0x12, 0x2e, 0xc1, 0x10, 0xc7, 0x44, 0x00,
+    0x8e, 0x41, 0x10, 0xe7, 0xc4, 0x28, 0x74, 0x00, 0xbf, 0x49, 0xc5, 0x0a,
+    0xfd, 0x00, 0xbf, 0x41, 0x15, 0xc1, 0x11, 0x29, 0x08, 0xc1, 0x11, 0x35,
+    0x16, 0xc1, 0x11, 0x41, 0xc3, 0x05, 0x16, 0x00, 0xbf, 0x09, 0xc4, 0x18,
+    0xa7, 0x00, 0xbf, 0x00, 0x45, 0x00, 0x8d, 0xc1, 0x11, 0x4d, 0x4a, 0x9c,
+    0x78, 0x41, 0x11, 0x6e, 0x13, 0xc1, 0x11, 0x76, 0xc2, 0x00, 0x37, 0x00,
+    0xbd, 0x6b, 0x01, 0x11, 0x92, 0xc2, 0x13, 0x2e, 0x00, 0xbd, 0x5a, 0x01,
+    0x11, 0x96, 0xc2, 0x0f, 0xba, 0x00, 0xbd, 0x11, 0x0e, 0xc1, 0x11, 0x9a,
+    0xc2, 0x00, 0xce, 0x00, 0xbd, 0x01, 0x15, 0xc1, 0x11, 0xa2, 0xc2, 0x14,
+    0xe6, 0x00, 0xbc, 0xe1, 0xc2, 0x00, 0x57, 0x00, 0xbc, 0xd1, 0xc2, 0x31,
+    0xda, 0x00, 0xbc, 0xc9, 0xc2, 0x08, 0x04, 0x00, 0xbc, 0xc1, 0x12, 0xc1,
+    0x11, 0xb2, 0xc2, 0x00, 0xa0, 0x00, 0xbc, 0xa1, 0x10, 0xc1, 0x11, 0xba,
+    0x16, 0xc1, 0x11, 0xd0, 0x06, 0xc1, 0x11, 0xe2, 0x05, 0xc1, 0x11, 0xea,
+    0x0d, 0x41, 0x11, 0xf6, 0x0e, 0xc1, 0x12, 0x02, 0x06, 0xc1, 0x12, 0x0e,
+    0xc8, 0xb7, 0x80, 0x08, 0x52, 0xa1, 0x05, 0xc1, 0x12, 0x18, 0xcc, 0x11,
+    0xf5, 0x08, 0x52, 0x88, 0x44, 0x05, 0x16, 0xc1, 0x12, 0x24, 0x16, 0x41,
+    0x12, 0x30, 0xc4, 0x04, 0x9f, 0x08, 0x52, 0x19, 0x16, 0xc1, 0x12, 0x3c,
+    0xc3, 0x05, 0x16, 0x08, 0x52, 0x00, 0xc5, 0x1f, 0xf6, 0x08, 0x51, 0xf9,
+    0x45, 0x35, 0x44, 0x41, 0x12, 0x48, 0x42, 0x00, 0xd8, 0xc1, 0x12, 0x54,
+    0xc5, 0xd4, 0xbd, 0x08, 0x51, 0xc9, 0xc9, 0x30, 0x50, 0x08, 0x51, 0xc1,
+    0xc7, 0x40, 0xae, 0x08, 0x50, 0x79, 0xc8, 0x14, 0x02, 0x08, 0x50, 0x70,
+    0x18, 0xc1, 0x12, 0x60, 0x16, 0xc1, 0x12, 0x6a, 0xc2, 0x00, 0x89, 0x08,
+    0x51, 0x59, 0xc2, 0x00, 0x3b, 0x08, 0x51, 0x51, 0xc2, 0x1a, 0x18, 0x08,
+    0x51, 0x49, 0xc2, 0x00, 0xb6, 0x08, 0x51, 0x41, 0x04, 0xc1, 0x12, 0x78,
+    0x12, 0xc1, 0x12, 0x82, 0x10, 0xc1, 0x12, 0x8c, 0x06, 0xc1, 0x12, 0x9c,
+    0xc2, 0x21, 0x7d, 0x08, 0x50, 0xb9, 0x05, 0xc1, 0x12, 0xaa, 0x09, 0xc1,
+    0x12, 0xb4, 0x0d, 0xc1, 0x12, 0xbe, 0x83, 0x08, 0x50, 0x01, 0x15, 0xc1,
+    0x12, 0xce, 0xc2, 0x01, 0x16, 0x08, 0x51, 0x81, 0xc2, 0x00, 0xce, 0x08,
+    0x51, 0x88, 0xc4, 0x07, 0xe9, 0x0f, 0xb0, 0xbb, 0x01, 0x12, 0xde, 0xd9,
+    0x1f, 0xb0, 0x0f, 0xb1, 0xe8, 0xc5, 0x67, 0x41, 0x0e, 0x98, 0x2b, 0x01,
+    0x12, 0xe4, 0x0a, 0xc1, 0x12, 0xea, 0x49, 0xb4, 0x6b, 0xc1, 0x12, 0xf6,
+    0x48, 0xb9, 0x80, 0x41, 0x13, 0x02, 0xc4, 0x28, 0x74, 0x00, 0x01, 0xcb,
+    0x01, 0x13, 0x0e, 0xc5, 0x0a, 0xfd, 0x00, 0x01, 0xc3, 0x01, 0x13, 0x12,
+    0x15, 0xc1, 0x13, 0x16, 0x08, 0xc1, 0x13, 0x28, 0x16, 0xc1, 0x13, 0x3a,
+    0xc3, 0x05, 0x16, 0x00, 0x01, 0x8b, 0x01, 0x13, 0x4c, 0xc4, 0x18, 0xa7,
+    0x00, 0x01, 0x82, 0x01, 0x13, 0x50, 0x4b, 0x46, 0xc0, 0xc1, 0x13, 0x54,
+    0xca, 0xa0, 0x7e, 0x01, 0x3b, 0xf9, 0x46, 0x04, 0x99, 0x41, 0x13, 0x60,
+    0xca, 0xa0, 0x7e, 0x01, 0x3c, 0x49, 0x46, 0x04, 0x99, 0x41, 0x13, 0x7e,
+    0xc8, 0xbc, 0x28, 0x01, 0x36, 0x69, 0x49, 0xa9, 0xc4, 0x41, 0x13, 0xa2,
+    0x06, 0xc1, 0x13, 0xae, 0xd0, 0x5c, 0x12, 0x08, 0xca, 0x31, 0xca, 0x90,
+    0x2a, 0x08, 0xca, 0x29, 0x45, 0x00, 0x8d, 0xc1, 0x13, 0xba, 0x47, 0x2c,
+    0x6b, 0xc1, 0x13, 0xd2, 0xca, 0x9a, 0xde, 0x08, 0xca, 0x09, 0xd3, 0x41,
+    0xe5, 0x08, 0xc9, 0xf9, 0x18, 0xc1, 0x13, 0xde, 0x47, 0x01, 0x92, 0x41,
+    0x13, 0xea, 0x45, 0x26, 0xe0, 0xc1, 0x14, 0x57, 0xc3, 0x04, 0x47, 0x01,
+    0x11, 0x19, 0xc7, 0xc4, 0x1a, 0x0f, 0xc9, 0xf8, 0xa5, 0x01, 0x34, 0x29,
+    0xa4, 0x01, 0x34, 0x21, 0xa3, 0x01, 0x34, 0x19, 0xa2, 0x01, 0x34, 0x11,
+    0xa1, 0x01, 0x34, 0x09, 0xa0, 0x01, 0x34, 0x00, 0xc9, 0xaf, 0x91, 0x01,
+    0x18, 0x01, 0x44, 0x43, 0xf7, 0x41, 0x14, 0x61, 0xc9, 0xb0, 0x45, 0x0f,
+    0xd3, 0xc1, 0xc3, 0x01, 0x92, 0x0f, 0xa5, 0x38, 0xc5, 0x10, 0x8c, 0x0f,
+    0xa1, 0x90, 0x48, 0xb6, 0x28, 0xc1, 0x14, 0x79, 0x42, 0x00, 0x5b, 0x41,
+    0x14, 0x8b, 0xc9, 0x01, 0xe0, 0x01, 0x18, 0x21, 0xd7, 0x26, 0x34, 0x01,
+    0x17, 0x89, 0xc4, 0x32, 0xbe, 0x01, 0x15, 0x23, 0x01, 0x14, 0xd2, 0xc9,
+    0xb2, 0xdf, 0x01, 0x4b, 0xf8, 0xd2, 0x47, 0x4d, 0x0f, 0xa9, 0xe9, 0xcc,
+    0x47, 0x53, 0x0f, 0xa9, 0xd9, 0x4e, 0x6e, 0x48, 0x41, 0x14, 0xd8, 0x42,
+    0x00, 0x1e, 0xc1, 0x14, 0xe4, 0xc5, 0x00, 0x9f, 0x0f, 0x81, 0x80, 0xc5,
+    0x00, 0x9f, 0x0f, 0x83, 0x11, 0x42, 0x00, 0x1e, 0x41, 0x15, 0x0e, 0x01,
+    0xc1, 0x15, 0x38, 0x42, 0x00, 0x6d, 0xc1, 0x15, 0x8a, 0x1e, 0x41, 0x15,
+    0x9c, 0x05, 0xc1, 0x15, 0xae, 0xc5, 0x87, 0x7f, 0x01, 0x4c, 0xc9, 0x15,
+    0xc1, 0x15, 0xba, 0xc9, 0xa8, 0x41, 0x0f, 0xd7, 0x29, 0xd4, 0x39, 0x96,
+    0x01, 0x70, 0x41, 0xc6, 0xcc, 0xb6, 0x01, 0x70, 0x99, 0xd4, 0x3c, 0x8e,
+    0x01, 0x70, 0xb0, 0xc8, 0x16, 0x68, 0x01, 0x16, 0x29, 0xc5, 0x19, 0x43,
+    0x01, 0x11, 0xc1, 0xc4, 0x23, 0xdf, 0x01, 0x10, 0xa1, 0xc5, 0x00, 0xd2,
+    0x00, 0x16, 0xc8, 0xd1, 0x4f, 0x8c, 0x08, 0xc1, 0xd9, 0x45, 0x00, 0x8d,
+    0xc1, 0x15, 0xc6, 0x4b, 0x6e, 0xbb, 0xc1, 0x15, 0xd8, 0x47, 0x01, 0x92,
+    0x41, 0x15, 0xfb, 0xcf, 0x4a, 0x41, 0x01, 0x17, 0x5b, 0x01, 0x16, 0x62,
+    0xc6, 0x03, 0xb0, 0x01, 0x10, 0x60, 0xc9, 0x24, 0x61, 0x01, 0x17, 0x08,
+    0xc5, 0x2e, 0xc6, 0x01, 0x14, 0x03, 0x01, 0x16, 0x68, 0xc3, 0x00, 0x97,
+    0x01, 0x15, 0x60, 0xdd, 0x10, 0xa5, 0x01, 0x57, 0x70, 0xc7, 0x80, 0xbd,
+    0x0f, 0xad, 0xd9, 0xc4, 0x26, 0xff, 0x0f, 0xad, 0xca, 0x01, 0x16, 0x6e,
+    0xc6, 0xcf, 0x74, 0x0f, 0xae, 0xa1, 0xc8, 0x46, 0x9c, 0x0f, 0xad, 0x28,
+    0x96, 0x0f, 0x9e, 0xe3, 0x01, 0x16, 0x74, 0x43, 0x00, 0x3f, 0x41, 0x16,
+    0x7a, 0x44, 0x04, 0x6c, 0xc1, 0x16, 0x86, 0xca, 0xa7, 0xae, 0x0f, 0x99,
+    0x98, 0x44, 0x00, 0x6b, 0xc1, 0x16, 0x92, 0x45, 0x00, 0x92, 0x41, 0x16,
+    0xa4, 0x46, 0x00, 0x91, 0x41, 0x16, 0xb0, 0x46, 0x00, 0x91, 0x41, 0x16,
+    0xc2, 0x47, 0x01, 0x92, 0xc1, 0x16, 0xd4, 0x15, 0xc1, 0x17, 0x49, 0x4b,
+    0x6e, 0xbb, 0xc1, 0x17, 0x55, 0xc7, 0xc9, 0x68, 0x05, 0x47, 0xe9, 0xca,
+    0x9e, 0x80, 0x05, 0x47, 0xd9, 0xc5, 0x97, 0x83, 0x05, 0x47, 0xd1, 0x09,
+    0xc1, 0x17, 0x8a, 0x03, 0xc1, 0x17, 0x96, 0xc2, 0x04, 0x0d, 0x00, 0x4a,
+    0x81, 0x06, 0x41, 0x17, 0xa2, 0xc6, 0x58, 0x42, 0x00, 0x04, 0x81, 0xc3,
+    0x05, 0x16, 0x00, 0x00, 0x89, 0x16, 0xc1, 0x17, 0xb4, 0xc4, 0x04, 0x9f,
+    0x00, 0x00, 0xa0, 0x0e, 0xc1, 0x17, 0xc0, 0x45, 0x08, 0xad, 0xc1, 0x17,
+    0xcc, 0x49, 0xa8, 0xa4, 0xc1, 0x17, 0xfd, 0x44, 0xa9, 0x3e, 0xc1, 0x18,
+    0x1b, 0xd7, 0x28, 0x45, 0x0d, 0xe3, 0x90, 0x99, 0x0d, 0xe1, 0xc3, 0x01,
+    0x18, 0x27, 0x96, 0x0d, 0xe0, 0x1b, 0x01, 0x18, 0x46, 0x95, 0x0d, 0xe0,
+    0xe3, 0x01, 0x18, 0x4e, 0x8c, 0x0d, 0xe0, 0xdb, 0x01, 0x18, 0x5e, 0x90,
+    0x0d, 0xe0, 0xd3, 0x01, 0x18, 0x62, 0x8f, 0x0d, 0xe0, 0xcb, 0x01, 0x18,
+    0x6c, 0x94, 0x0d, 0xe0, 0x5b, 0x01, 0x18, 0x70, 0x8e, 0x0d, 0xe0, 0x33,
+    0x01, 0x18, 0x80, 0x8a, 0x0d, 0xe0, 0x03, 0x01, 0x18, 0x8a, 0x8d, 0x0d,
+    0xe0, 0x2b, 0x01, 0x18, 0x8e, 0x86, 0x0d, 0xe0, 0x43, 0x01, 0x18, 0x96,
+    0x88, 0x0d, 0xe0, 0x23, 0x01, 0x18, 0xa0, 0x92, 0x0d, 0xe0, 0x13, 0x01,
+    0x18, 0xa6, 0x89, 0x0d, 0xe0, 0x53, 0x01, 0x18, 0xb2, 0x98, 0x0d, 0xe0,
+    0x4b, 0x01, 0x18, 0xb8, 0x84, 0x0d, 0xe0, 0x39, 0x9a, 0x0d, 0xe0, 0x0b,
+    0x01, 0x18, 0xbe, 0x91, 0x0d, 0xe2, 0x23, 0x01, 0x18, 0xc2, 0x97, 0x0d,
+    0xe2, 0x8b, 0x01, 0x18, 0xd4, 0x87, 0x0d, 0xe2, 0x3b, 0x01, 0x18, 0xe2,
+    0xc2, 0x0d, 0x1e, 0x0d, 0xe2, 0x81, 0x8b, 0x0d, 0xe2, 0x33, 0x01, 0x18,
+    0xea, 0x83, 0x0d, 0xe2, 0x0a, 0x01, 0x18, 0xee, 0xe0, 0x0b, 0x69, 0x01,
+    0x3c, 0xf9, 0xc8, 0x7b, 0x63, 0x07, 0xf2, 0x49, 0xc8, 0x7f, 0x4c, 0x07,
+    0xf2, 0x68, 0xc6, 0x07, 0xf3, 0x0f, 0xa5, 0x41, 0xd0, 0x5b, 0x12, 0x01,
+    0x72, 0x18, 0xc5, 0xa0, 0xc9, 0x0f, 0xaf, 0x09, 0x45, 0x00, 0x92, 0x41,
+    0x18, 0xf4, 0xc9, 0xac, 0xdc, 0x0f, 0xd4, 0x31, 0xca, 0x9f, 0xe8, 0x0f,
+    0xd5, 0xd0, 0x46, 0xcc, 0x26, 0xc1, 0x19, 0x00, 0xc4, 0x07, 0xe9, 0x0f,
+    0xb0, 0x80, 0x15, 0xc1, 0x19, 0x37, 0x47, 0x01, 0x92, 0xc1, 0x19, 0x41,
+    0xce, 0x73, 0x50, 0x08, 0xa2, 0xe9, 0xd0, 0x5a, 0xb2, 0x08, 0xa2, 0xd9,
+    0x06, 0xc1, 0x19, 0xa8, 0xd1, 0x4f, 0x8c, 0x08, 0xa2, 0x79, 0xca, 0x90,
+    0x2a, 0x08, 0xa2, 0x71, 0xc5, 0x04, 0x0c, 0x08, 0xa2, 0x69, 0xc2, 0x04,
+    0x0d, 0x08, 0xa2, 0x49, 0x4b, 0x6e, 0xbb, 0x41, 0x19, 0xba, 0xcb, 0x90,
+    0x09, 0x01, 0x05, 0x51, 0x48, 0xbe, 0x70, 0xc1, 0x19, 0xda, 0x45, 0x17,
+    0x72, 0xc1, 0x19, 0xf9, 0xc4, 0x00, 0xdf, 0x00, 0x00, 0x50, 0xc4, 0x00,
+    0x2f, 0x01, 0x5c, 0x91, 0xc5, 0x00, 0x64, 0x01, 0x5c, 0x98, 0x48, 0x09,
+    0x2b, 0xc1, 0x1a, 0x05, 0x48, 0x1d, 0x5e, 0xc1, 0x1a, 0x35, 0xcb, 0x4b,
+    0x20, 0x00, 0x00, 0xa9, 0x49, 0x1f, 0xcf, 0x41, 0x1a, 0x53, 0xe0, 0x05,
+    0x69, 0x01, 0x15, 0x78, 0x43, 0x02, 0x0a, 0xc1, 0x1a, 0x65, 0x42, 0x06,
+    0x51, 0x41, 0x1a, 0x71, 0xc9, 0x02, 0xa0, 0x01, 0x13, 0xc9, 0x43, 0x00,
+    0xe4, 0x41, 0x1a, 0x77, 0xcc, 0x06, 0x09, 0x01, 0x13, 0xc1, 0x43, 0x00,
+    0xe4, 0x41, 0x1a, 0x83, 0x4b, 0x6e, 0xbb, 0xc1, 0x1a, 0x8f, 0xca, 0x9e,
+    0x80, 0x08, 0xcf, 0x19, 0x45, 0x00, 0x8d, 0xc1, 0x1a, 0xb8, 0x47, 0x01,
+    0x92, 0x41, 0x1a, 0xc8, 0x47, 0x37, 0xb8, 0xc1, 0x1b, 0x2b, 0xd5, 0x37,
+    0xae, 0x08, 0x45, 0x59, 0x47, 0x01, 0x92, 0x41, 0x1b, 0x3c, 0xd4, 0x3d,
+    0xe2, 0x0f, 0xb5, 0x89, 0xcf, 0x60, 0x6b, 0x01, 0x00, 0x88, 0x01, 0xc1,
+    0x1b, 0xa5, 0xd6, 0x2c, 0x46, 0x0f, 0xb7, 0x50, 0xcc, 0x24, 0x61, 0x01,
+    0x15, 0xa0, 0xe0, 0x03, 0xc9, 0x0f, 0xaa, 0x21, 0x0e, 0xc1, 0x1b, 0xb7,
+    0x4b, 0x2b, 0xac, 0x41, 0x1b, 0xc3, 0xca, 0x9c, 0xb4, 0x01, 0x1b, 0xd9,
+    0xd2, 0x4a, 0x41, 0x01, 0x17, 0x53, 0x01, 0x1b, 0xc9, 0x15, 0xc1, 0x1b,
+    0xcf, 0x16, 0xc1, 0x1b, 0xdb, 0x03, 0xc1, 0x1b, 0xe7, 0xcc, 0x06, 0x09,
+    0x01, 0x13, 0x79, 0xc9, 0x02, 0xa0, 0x01, 0x13, 0x71, 0x43, 0x00, 0xe4,
+    0xc1, 0x1b, 0xff, 0xcc, 0x85, 0x74, 0x01, 0x13, 0x11, 0xcb, 0x6a, 0x47,
+    0x01, 0x11, 0x30, 0x43, 0x04, 0xf1, 0xc1, 0x1c, 0x0b, 0xc4, 0xcf, 0xbf,
+    0x0f, 0xa6, 0x9a, 0x01, 0x1c, 0x15, 0xc5, 0x00, 0x8c, 0x0f, 0xb5, 0x58,
+    0xc5, 0xdb, 0x20, 0x0f, 0xab, 0x91, 0xca, 0xa5, 0xf6, 0x0f, 0xb5, 0xb8,
+    0xc9, 0xaa, 0xed, 0x00, 0x04, 0x19, 0xc7, 0xc8, 0xff, 0x0f, 0xb5, 0x98,
+    0x99, 0x0f, 0x09, 0x61, 0x87, 0x0f, 0x09, 0x53, 0x01, 0x1c, 0x1b, 0x91,
+    0x0f, 0x09, 0x43, 0x01, 0x1c, 0x1f, 0x97, 0x0f, 0x09, 0x39, 0x8b, 0x0f,
+    0x09, 0x31, 0x83, 0x0f, 0x09, 0x23, 0x01, 0x1c, 0x23, 0x14, 0xc1, 0x1c,
+    0x27, 0xc2, 0x00, 0xeb, 0x0f, 0x09, 0x11, 0x12, 0xc1, 0x1c, 0x31, 0x0f,
+    0xc1, 0x1c, 0x3b, 0xc2, 0x00, 0xce, 0x0f, 0x08, 0x23, 0x01, 0x1c, 0x45,
+    0x10, 0xc1, 0x1c, 0x49, 0x06, 0xc1, 0x1c, 0x73, 0x1a, 0xc1, 0x1c, 0x7d,
+    0xc2, 0x1a, 0x18, 0x0f, 0x08, 0xc1, 0xc2, 0x0f, 0xba, 0x0f, 0x08, 0xb9,
+    0xc2, 0x04, 0x70, 0x0f, 0x08, 0xa9, 0x16, 0xc1, 0x1c, 0x87, 0xc2, 0x02,
+    0x63, 0x0f, 0x08, 0x91, 0xc2, 0x02, 0x4d, 0x0f, 0x08, 0x71, 0xc2, 0x01,
+    0x16, 0x0f, 0x08, 0x59, 0xc2, 0x0d, 0x01, 0x0f, 0x08, 0x51, 0xc2, 0x00,
+    0x89, 0x0f, 0x08, 0x49, 0xc2, 0x03, 0xc6, 0x0f, 0x08, 0x40, 0xc4, 0x17,
+    0xf7, 0x0f, 0x0a, 0x39, 0xc2, 0x24, 0x36, 0x0f, 0x0a, 0x30, 0xc3, 0x0c,
+    0xf7, 0x0f, 0x0a, 0x29, 0xc3, 0x04, 0xa0, 0x0f, 0x0a, 0x20, 0xc4, 0x03,
+    0xe0, 0x0f, 0x0a, 0x19, 0xc2, 0x01, 0xa2, 0x0f, 0x0a, 0x10, 0xc5, 0xdc,
+    0x97, 0x0f, 0x09, 0xe1, 0x44, 0x15, 0x04, 0x41, 0x1c, 0x97, 0x16, 0xc1,
+    0x1c, 0xb5, 0xd2, 0x48, 0x01, 0x01, 0x24, 0xd1, 0x07, 0xc1, 0x1c, 0xc7,
+    0x15, 0xc1, 0x1c, 0xd3, 0x08, 0x41, 0x1c, 0xdd, 0xc4, 0x23, 0xdf, 0x01,
+    0x50, 0x21, 0xc3, 0x01, 0xa5, 0x01, 0x50, 0x18, 0xce, 0x73, 0xce, 0x01,
+    0x50, 0x31, 0xd5, 0x35, 0x8c, 0x01, 0x50, 0x28, 0xce, 0x6f, 0x36, 0x01,
+    0x50, 0x11, 0xcd, 0x79, 0xbe, 0x01, 0x50, 0x09, 0xcc, 0x84, 0x00, 0x01,
+    0x50, 0x00, 0xc4, 0x28, 0x74, 0x00, 0x3e, 0x49, 0xc5, 0x0a, 0xfd, 0x00,
+    0x3e, 0x41, 0x15, 0xc1, 0x1c, 0xe9, 0x08, 0xc1, 0x1c, 0xf5, 0x16, 0xc1,
+    0x1d, 0x01, 0xc3, 0x05, 0x16, 0x00, 0x3e, 0x09, 0xc4, 0x18, 0xa7, 0x00,
+    0x3e, 0x00, 0x0c, 0xc1, 0x1d, 0x0d, 0x90, 0x00, 0x3e, 0x93, 0x01, 0x1d,
+    0x17, 0xc2, 0x1a, 0x18, 0x00, 0x3f, 0x31, 0xc2, 0x00, 0x71, 0x00, 0x3f,
+    0x29, 0xc2, 0x00, 0xce, 0x00, 0x3f, 0x21, 0xc2, 0x00, 0xb6, 0x00, 0x3f,
+    0x09, 0xc2, 0x00, 0x89, 0x00, 0x3e, 0xf9, 0xc2, 0x02, 0x4d, 0x00, 0x3e,
+    0xf1, 0xc2, 0x04, 0x70, 0x00, 0x3e, 0xe9, 0xc3, 0x9b, 0x88, 0x00, 0x3e,
+    0xe1, 0xc2, 0x0d, 0x01, 0x00, 0x3e, 0xd9, 0x14, 0xc1, 0x1d, 0x27, 0xc2,
+    0x0e, 0x60, 0x00, 0x3e, 0xc3, 0x01, 0x1d, 0x31, 0xc3, 0x19, 0x59, 0x00,
+    0x3e, 0xb9, 0xc2, 0x00, 0x51, 0x00, 0x3e, 0xa9, 0xc2, 0x04, 0xf2, 0x00,
+    0x3e, 0xa1, 0xc2, 0x00, 0xa0, 0x00, 0x3e, 0x99, 0x91, 0x00, 0x3e, 0x83,
+    0x01, 0x1d, 0x37, 0x97, 0x00, 0x3e, 0x71, 0x87, 0x00, 0x3e, 0x6b, 0x01,
+    0x1d, 0x3b, 0x8b, 0x00, 0x3e, 0x61, 0x83, 0x00, 0x3e, 0x50, 0xd0, 0x5a,
+    0xf2, 0x00, 0x3f, 0x99, 0xd1, 0x50, 0x36, 0x00, 0x3f, 0x91, 0x45, 0x2b,
+    0x80, 0xc1, 0x1d, 0x3f, 0x46, 0x2c, 0x9e, 0x41, 0x1d, 0x57, 0xc6, 0x54,
+    0xa3, 0x0f, 0xd3, 0x59, 0xc5, 0xd8, 0xfa, 0x0f, 0xd3, 0x60, 0xc6, 0x54,
+    0xa3, 0x0f, 0xd3, 0x21, 0xc5, 0xd8, 0xfa, 0x0f, 0xd3, 0x28, 0xc8, 0xb4,
+    0xe0, 0x0f, 0xcd, 0x81, 0xca, 0xa7, 0x22, 0x0f, 0xcd, 0x89, 0xc4, 0xe1,
+    0x38, 0x0f, 0xcd, 0x91, 0xca, 0xa1, 0x28, 0x0f, 0xcd, 0x98, 0xc3, 0xe4,
+    0xe7, 0x0f, 0x9f, 0xd9, 0xa2, 0x0f, 0x9f, 0xe1, 0xa3, 0x0f, 0x9f, 0xe9,
+    0xa4, 0x0f, 0x9f, 0xf1, 0xa5, 0x0f, 0x9f, 0xf8, 0xc3, 0x0a, 0xc7, 0x01,
+    0x10, 0x2b, 0x01, 0x1d, 0x69, 0xc4, 0x9f, 0xd0, 0x0f, 0xae, 0x63, 0x01,
+    0x1d, 0x6f, 0xc8, 0xb6, 0x18, 0x0f, 0xae, 0x59, 0x10, 0x41, 0x1d, 0x73,
+    0x42, 0x06, 0x9c, 0x41, 0x1d, 0x82, 0x43, 0x02, 0xd5, 0xc1, 0x1d, 0x8e,
+    0xd0, 0x59, 0xe2, 0x0f, 0xcd, 0xd8, 0xca, 0xa1, 0x46, 0x09, 0xa1, 0xc1,
+    0x1f, 0x41, 0x1d, 0x9a, 0xcc, 0x83, 0x88, 0x09, 0xa1, 0xb9, 0x42, 0xcf,
+    0x56, 0x41, 0x1d, 0xaa, 0xcd, 0x76, 0x23, 0x09, 0xa1, 0xb1, 0x1f, 0x41,
+    0x1d, 0xd1, 0x49, 0xb3, 0x66, 0xc1, 0x1d, 0xe9, 0x1f, 0x41, 0x1d, 0xf5,
+    0xd0, 0x58, 0xb2, 0x09, 0xa1, 0x89, 0x42, 0xcf, 0x56, 0x41, 0x1d, 0xfd,
+    0xce, 0x71, 0xd6, 0x09, 0xa1, 0x81, 0x1f, 0x41, 0x1e, 0x20, 0x42, 0xc0,
+    0xdf, 0xc1, 0x1e, 0x39, 0x1f, 0x41, 0x1e, 0x49, 0x20, 0xc1, 0x1e, 0x6b,
+    0x1f, 0x41, 0x1e, 0x8d, 0xa7, 0x09, 0x9f, 0x19, 0xa6, 0x09, 0x9f, 0x11,
+    0xa5, 0x09, 0x9f, 0x09, 0xa4, 0x09, 0x9f, 0x01, 0xa3, 0x09, 0x9e, 0xf9,
+    0xa2, 0x09, 0x9e, 0xf1, 0xa1, 0x09, 0x9e, 0xe9, 0xa0, 0x09, 0x9e, 0xda,
+    0x01, 0x1e, 0xbd, 0xa7, 0x09, 0x9e, 0xcb, 0x01, 0x1e, 0xc1, 0xa6, 0x09,
+    0x9e, 0xc1, 0xa5, 0x09, 0x9e, 0xb3, 0x01, 0x1e, 0xc5, 0xa4, 0x09, 0x9e,
+    0xa9, 0xa3, 0x09, 0x9e, 0x93, 0x01, 0x1e, 0xc9, 0xa2, 0x09, 0x9e, 0x89,
+    0xa1, 0x09, 0x9e, 0x81, 0xa0, 0x09, 0x9e, 0x78, 0x21, 0xc1, 0x1e, 0xd1,
+    0x20, 0xc1, 0x1e, 0xec, 0x1f, 0x41, 0x1f, 0x20, 0x23, 0xc1, 0x1f, 0x4a,
+    0x22, 0xc1, 0x1f, 0x56, 0x21, 0xc1, 0x1f, 0x81, 0x20, 0xc1, 0x1f, 0xaf,
+    0x1f, 0x41, 0x1f, 0xd7, 0x22, 0xc1, 0x1f, 0xfe, 0x21, 0xc1, 0x20, 0x20,
+    0x20, 0xc1, 0x20, 0x48, 0x1f, 0x41, 0x20, 0x76, 0x23, 0xc1, 0x20, 0xa6,
+    0x22, 0xc1, 0x20, 0xc2, 0x21, 0xc1, 0x20, 0xed, 0x20, 0xc1, 0x21, 0x18,
+    0x1f, 0x41, 0x21, 0x46, 0x21, 0xc1, 0x21, 0x70, 0x20, 0xc1, 0x21, 0x98,
+    0x1f, 0x41, 0x21, 0xc6, 0xa6, 0x09, 0x95, 0x71, 0xa5, 0x09, 0x95, 0x69,
+    0xa4, 0x09, 0x95, 0x61, 0xa3, 0x09, 0x95, 0x59, 0xa2, 0x09, 0x95, 0x51,
+    0xa1, 0x09, 0x95, 0x49, 0xa0, 0x09, 0x95, 0x40, 0x20, 0xc1, 0x21, 0xf0,
+    0x1f, 0x41, 0x21, 0xf8, 0x42, 0xe2, 0xe7, 0xc1, 0x22, 0x22, 0x42, 0xe5,
+    0x7d, 0xc1, 0x22, 0x2e, 0x1f, 0x41, 0x22, 0x3c, 0x23, 0xc1, 0x22, 0x50,
+    0x22, 0xc1, 0x22, 0x67, 0x21, 0xc1, 0x22, 0x95, 0x20, 0xc1, 0x22, 0xc6,
+    0x1f, 0x41, 0x22, 0xfd, 0xa7, 0x09, 0x8d, 0x61, 0xa6, 0x09, 0x8d, 0x59,
+    0xa5, 0x09, 0x8d, 0x4b, 0x01, 0x23, 0x27, 0xa4, 0x09, 0x8d, 0x41, 0xa3,
+    0x09, 0x8d, 0x39, 0xa2, 0x09, 0x8d, 0x31, 0xa1, 0x09, 0x8d, 0x23, 0x01,
+    0x23, 0x2b, 0xa0, 0x09, 0x8d, 0x18, 0xa7, 0x09, 0x8d, 0x11, 0xa6, 0x09,
+    0x8d, 0x09, 0xa5, 0x09, 0x8d, 0x01, 0xa4, 0x09, 0x8c, 0xf9, 0xa3, 0x09,
+    0x8c, 0xf1, 0xa2, 0x09, 0x8c, 0xe9, 0xa1, 0x09, 0x8c, 0xe1, 0xa0, 0x09,
+    0x8c, 0xd8, 0x24, 0xc1, 0x23, 0x2f, 0x23, 0xc1, 0x23, 0x43, 0x22, 0xc1,
+    0x23, 0x71, 0x21, 0xc1, 0x23, 0x9f, 0x20, 0xc1, 0x23, 0xcd, 0x1f, 0x41,
+    0x23, 0xf8, 0x24, 0xc1, 0x24, 0x22, 0x23, 0xc1, 0x24, 0x35, 0x22, 0xc1,
+    0x24, 0x66, 0x21, 0xc1, 0x24, 0x97, 0x20, 0xc1, 0x24, 0xc2, 0x1f, 0x41,
+    0x24, 0xed, 0x25, 0xc1, 0x25, 0x14, 0x24, 0xc1, 0x25, 0x37, 0x23, 0xc1,
+    0x25, 0x68, 0x22, 0xc1, 0x25, 0x96, 0x21, 0xc1, 0x25, 0xc4, 0x20, 0xc1,
+    0x25, 0xef, 0x1f, 0x41, 0x26, 0x17, 0x21, 0xc1, 0x26, 0x3e, 0x20, 0xc1,
+    0x26, 0x52, 0x1f, 0x41, 0x26, 0x7d, 0x4c, 0x83, 0xd0, 0xc1, 0x26, 0xa4,
+    0xd2, 0x4c, 0xed, 0x0f, 0xa3, 0xe8, 0xc4, 0x28, 0x74, 0x00, 0x37, 0xc9,
+    0xc5, 0x0a, 0xfd, 0x00, 0x37, 0xc1, 0x15, 0xc1, 0x26, 0xba, 0x08, 0xc1,
+    0x26, 0xc6, 0x16, 0xc1, 0x26, 0xd2, 0xc3, 0x05, 0x16, 0x00, 0x37, 0x89,
+    0xc4, 0x18, 0xa7, 0x00, 0x37, 0x80, 0xcd, 0x30, 0xea, 0x01, 0x02, 0x49,
+    0xc4, 0x01, 0x65, 0x00, 0x01, 0x08, 0x09, 0xc1, 0x26, 0xde, 0x0a, 0xc1,
+    0x27, 0x10, 0x04, 0xc1, 0x27, 0x31, 0x05, 0xc1, 0x27, 0x56, 0x06, 0xc1,
+    0x27, 0x81, 0x16, 0xc1, 0x27, 0xac, 0x0e, 0xc1, 0x27, 0xe1, 0x0f, 0xc1,
+    0x28, 0x04, 0x15, 0xc1, 0x28, 0x2b, 0x14, 0xc1, 0x28, 0x5a, 0x13, 0xc1,
+    0x28, 0x83, 0x18, 0xc1, 0x28, 0xac, 0x1a, 0xc1, 0x28, 0xcc, 0x10, 0xc1,
+    0x28, 0xf1, 0x0d, 0xc1, 0x29, 0x18, 0x19, 0xc1, 0x29, 0x41, 0x12, 0xc1,
+    0x29, 0x5e, 0x1c, 0xc1, 0x29, 0x83, 0x1b, 0xc1, 0x29, 0xae, 0x0c, 0xc1,
+    0x29, 0xcb, 0x08, 0x41, 0x29, 0xee, 0xca, 0x46, 0xd4, 0x00, 0x9b, 0x01,
+    0xc7, 0x50, 0x48, 0x00, 0x9b, 0x20, 0x47, 0x1f, 0xfc, 0xc1, 0x2a, 0x12,
+    0xc2, 0x00, 0xb6, 0x00, 0x9b, 0x18, 0xc2, 0x01, 0xa2, 0x00, 0x9b, 0x51,
+    0xc4, 0x03, 0xe0, 0x00, 0x9b, 0x58, 0xc3, 0x04, 0xa0, 0x00, 0x9b, 0x61,
+    0xc3, 0x0c, 0xf7, 0x00, 0x9b, 0x68, 0xc2, 0x24, 0x36, 0x00, 0x9b, 0x71,
+    0xc4, 0x17, 0xf7, 0x00, 0x9b, 0x78, 0xc2, 0x00, 0x79, 0x00, 0x9b, 0x93,
+    0x01, 0x2a, 0x1e, 0xc5, 0x26, 0x6c, 0x00, 0x9b, 0x99, 0xc5, 0x0c, 0xf0,
+    0x00, 0x9b, 0xa0, 0xc4, 0x4b, 0x50, 0x00, 0x9b, 0xa9, 0xc4, 0x43, 0x1f,
+    0x00, 0x9b, 0xb0, 0xc4, 0xcb, 0x72, 0x00, 0x9b, 0xb9, 0xc6, 0x17, 0xf7,
+    0x00, 0x9b, 0xc0, 0xc4, 0xd6, 0xbd, 0x00, 0x9c, 0x8b, 0x01, 0x2a, 0x24,
+    0xc4, 0xdf, 0x2c, 0x00, 0x9c, 0xa0, 0xc4, 0x58, 0x06, 0x00, 0x9c, 0xa9,
+    0xc3, 0x46, 0x7d, 0x00, 0x9c, 0xc8, 0x01, 0x41, 0x2a, 0x2a, 0xcf, 0x3f,
+    0x76, 0x01, 0x1f, 0x39, 0x01, 0x41, 0x2a, 0x36, 0x16, 0xc1, 0x2a, 0x4e,
+    0x15, 0xc1, 0x2a, 0x5a, 0xc4, 0x5a, 0xd2, 0x08, 0x7f, 0x99, 0xc4, 0xb5,
+    0x0c, 0x08, 0x7f, 0x91, 0xc2, 0x00, 0x78, 0x08, 0x7f, 0x81, 0xc3, 0x20,
+    0xb0, 0x08, 0x7f, 0x69, 0xc3, 0x03, 0xb0, 0x08, 0x7f, 0x61, 0xc6, 0xd0,
+    0xf4, 0x08, 0x7f, 0x59, 0xc4, 0xe0, 0x58, 0x08, 0x7f, 0x51, 0xc4, 0x4e,
+    0x09, 0x08, 0x7f, 0x49, 0xc2, 0x00, 0x61, 0x08, 0x7f, 0x23, 0x01, 0x2a,
+    0x64, 0xc5, 0x4e, 0x03, 0x08, 0x7f, 0x31, 0xc3, 0x76, 0xe6, 0x08, 0x7f,
+    0x29, 0xc6, 0x46, 0x53, 0x08, 0x7f, 0x19, 0xc5, 0x9b, 0xd8, 0x08, 0x7f,
+    0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x7f, 0x09, 0x03, 0x41, 0x2a, 0x6a, 0x87,
+    0x08, 0x28, 0x11, 0xc2, 0x00, 0x61, 0x08, 0x28, 0x18, 0x87, 0x08, 0x28,
+    0x21, 0xc2, 0x00, 0x61, 0x08, 0x28, 0x30, 0xc2, 0x00, 0x06, 0x08, 0x28,
+    0x29, 0x87, 0x08, 0x28, 0x99, 0x83, 0x08, 0x28, 0xa1, 0xc2, 0x19, 0x48,
+    0x08, 0x28, 0xa8, 0x8b, 0x08, 0x28, 0x38, 0x87, 0x08, 0x28, 0x51, 0xc2,
+    0x19, 0x48, 0x08, 0x28, 0x59, 0x0a, 0x41, 0x2a, 0x76, 0x87, 0x08, 0x28,
+    0x79, 0xc2, 0x00, 0x61, 0x08, 0x29, 0x38, 0x87, 0x08, 0x28, 0x81, 0xc2,
+    0x00, 0x2f, 0x08, 0x28, 0x88, 0x87, 0x08, 0x28, 0xc9, 0xc2, 0x03, 0xe1,
+    0x08, 0x28, 0xd0, 0x87, 0x08, 0x28, 0xd9, 0xc2, 0x00, 0x61, 0x08, 0x28,
+    0xe0, 0x87, 0x08, 0x28, 0xe9, 0xc2, 0x00, 0x61, 0x08, 0x28, 0xf0, 0x87,
+    0x08, 0x29, 0x19, 0xc2, 0x00, 0x61, 0x08, 0x29, 0x20, 0xe0, 0x09, 0x69,
+    0x01, 0x3a, 0x50, 0xdf, 0x0c, 0xc4, 0x01, 0x3a, 0x09, 0x47, 0x08, 0xec,
+    0x41, 0x2a, 0x80, 0xc9, 0xa7, 0xd5, 0x0f, 0xac, 0x21, 0xd5, 0x35, 0xe0,
+    0x0f, 0xa7, 0x48, 0x43, 0x04, 0x82, 0xc1, 0x2a, 0x92, 0x16, 0xc1, 0x2a,
+    0x9e, 0xc4, 0x00, 0xdf, 0x00, 0x00, 0x51, 0xc6, 0x04, 0x3d, 0x00, 0x00,
+    0xc9, 0xcd, 0x79, 0x2f, 0x00, 0x04, 0x39, 0xcc, 0x89, 0x28, 0x00, 0x04,
+    0xb8, 0xc6, 0x00, 0x7c, 0x01, 0x4f, 0x99, 0xc7, 0x3f, 0x57, 0x01, 0x4f,
+    0x89, 0xc6, 0x09, 0x2b, 0x01, 0x4f, 0x78, 0xc6, 0x00, 0x7c, 0x01, 0x4f,
+    0x91, 0xc7, 0x3f, 0x57, 0x01, 0x4f, 0x81, 0xc6, 0x09, 0x2b, 0x01, 0x4f,
+    0x70, 0x43, 0x00, 0x5d, 0xc1, 0x2a, 0xad, 0xcf, 0x6a, 0x43, 0x01, 0x16,
+    0xa8, 0xc5, 0x36, 0xec, 0x01, 0x12, 0xa9, 0xc4, 0x00, 0x8d, 0x00, 0x01,
+    0xeb, 0x01, 0x2a, 0xb9, 0xcd, 0x7d, 0x25, 0x01, 0x53, 0x70, 0xc2, 0x00,
+    0x5d, 0x01, 0x12, 0x69, 0xd4, 0x3c, 0xca, 0x01, 0x53, 0xc0, 0xcb, 0x99,
+    0x30, 0x0f, 0x9f, 0x21, 0xc6, 0xcd, 0x7c, 0x0f, 0x9f, 0x80, 0xc4, 0x28,
+    0x74, 0x08, 0xed, 0x49, 0xc5, 0x0a, 0xfd, 0x08, 0xed, 0x41, 0x15, 0xc1,
+    0x2a, 0xbd, 0x08, 0xc1, 0x2a, 0xc9, 0x16, 0xc1, 0x2a, 0xd5, 0xc3, 0x05,
+    0x16, 0x08, 0xed, 0x09, 0xc4, 0x18, 0xa7, 0x08, 0xed, 0x00, 0xc5, 0x1f,
+    0xf6, 0x08, 0xec, 0xb9, 0x4a, 0x6e, 0xbc, 0x41, 0x2a, 0xe1, 0xc7, 0x40,
+    0xae, 0x08, 0xec, 0xb1, 0xc8, 0x14, 0x02, 0x08, 0xec, 0xa8, 0xc2, 0x0d,
+    0x01, 0x08, 0xec, 0x49, 0xc2, 0x00, 0x3b, 0x08, 0xec, 0x41, 0xc2, 0x00,
+    0xce, 0x08, 0xec, 0x39, 0x12, 0xc1, 0x2a, 0xff, 0x10, 0xc1, 0x2b, 0x09,
+    0x06, 0xc1, 0x2b, 0x13, 0x0c, 0xc1, 0x2b, 0x21, 0x0e, 0xc1, 0x2b, 0x2b,
+    0x16, 0xc1, 0x2b, 0x35, 0x05, 0xc1, 0x2b, 0x43, 0x09, 0xc1, 0x2b, 0x4d,
+    0x0d, 0xc1, 0x2b, 0x57, 0xc2, 0x00, 0xb6, 0x08, 0xeb, 0x81, 0x04, 0xc1,
+    0x2b, 0x61, 0xc2, 0x02, 0x63, 0x08, 0xeb, 0x69, 0xc2, 0x1a, 0x18, 0x08,
+    0xeb, 0x61, 0x83, 0x08, 0xeb, 0x03, 0x01, 0x2b, 0x6b, 0xc2, 0x05, 0x37,
+    0x08, 0xeb, 0x51, 0xc2, 0x00, 0xc8, 0x08, 0xeb, 0x39, 0x97, 0x08, 0xeb,
+    0x23, 0x01, 0x2b, 0x77, 0x8b, 0x08, 0xeb, 0x12, 0x01, 0x2b, 0x7b, 0xca,
+    0xa3, 0x62, 0x00, 0x50, 0x09, 0xc5, 0x61, 0xd3, 0x00, 0x50, 0x11, 0x42,
+    0x06, 0xb4, 0xc1, 0x2b, 0x7f, 0xc5, 0x34, 0xd9, 0x00, 0x51, 0xe1, 0xc5,
+    0xd5, 0x76, 0x00, 0x52, 0x89, 0xc6, 0xca, 0x58, 0x00, 0x53, 0xa8, 0x83,
+    0x00, 0x50, 0x2b, 0x01, 0x2b, 0x8b, 0x8b, 0x00, 0x50, 0x3b, 0x01, 0x2b,
+    0x97, 0x97, 0x00, 0x50, 0x4b, 0x01, 0x2b, 0x9b, 0xc2, 0x00, 0xc8, 0x00,
+    0x50, 0x79, 0xc2, 0x05, 0x37, 0x00, 0x50, 0x99, 0x0d, 0xc1, 0x2b, 0x9f,
+    0x09, 0xc1, 0x2b, 0xa7, 0x10, 0xc1, 0x2b, 0xaf, 0x05, 0xc1, 0x2b, 0xc5,
+    0x0c, 0xc1, 0x2b, 0xcf, 0x16, 0xc1, 0x2b, 0xd9, 0x06, 0xc1, 0x2b, 0xe7,
+    0x12, 0xc1, 0x2b, 0xf5, 0x04, 0xc1, 0x2b, 0xff, 0xc2, 0x00, 0xb6, 0x00,
+    0x51, 0x71, 0xc2, 0x1a, 0x18, 0x00, 0x51, 0x79, 0x14, 0xc1, 0x2c, 0x09,
+    0x0e, 0xc1, 0x2c, 0x13, 0xc2, 0x02, 0x63, 0x00, 0x51, 0xa9, 0x15, 0xc1,
+    0x2c, 0x1d, 0xc2, 0x00, 0xce, 0x00, 0x51, 0xc9, 0xc2, 0x01, 0x16, 0x00,
+    0x52, 0xd9, 0xc2, 0x04, 0x70, 0x00, 0x52, 0xf0, 0x03, 0xc1, 0x2c, 0x27,
+    0x8b, 0x00, 0x51, 0xfb, 0x01, 0x2c, 0x33, 0x97, 0x00, 0x52, 0x0b, 0x01,
+    0x2c, 0x37, 0xc2, 0x00, 0xc8, 0x00, 0x52, 0x39, 0xc2, 0x05, 0x37, 0x00,
+    0x52, 0x58, 0xc4, 0x18, 0xa7, 0x00, 0x53, 0x31, 0xc3, 0x05, 0x16, 0x00,
+    0x53, 0x39, 0x16, 0xc1, 0x2c, 0x3b, 0x08, 0xc1, 0x2c, 0x47, 0x15, 0xc1,
+    0x2c, 0x53, 0xc5, 0x0a, 0xfd, 0x00, 0x53, 0x71, 0xc4, 0x28, 0x74, 0x00,
+    0x53, 0x78, 0xc4, 0xe0, 0xbc, 0x00, 0x53, 0x89, 0xd0, 0x4f, 0x8d, 0x00,
+    0x53, 0xb0, 0x05, 0xc1, 0x2c, 0x5f, 0x03, 0xc1, 0x2c, 0x6b, 0x42, 0x06,
+    0xb4, 0xc1, 0x2c, 0x77, 0xc5, 0x34, 0xd9, 0x00, 0x55, 0xe1, 0x15, 0xc1,
+    0x2c, 0x83, 0xc6, 0xd3, 0x10, 0x00, 0x57, 0xe1, 0x16, 0x41, 0x2c, 0x8f,
+    0x83, 0x00, 0x54, 0x2b, 0x01, 0x2c, 0x9b, 0x8b, 0x00, 0x54, 0x3b, 0x01,
+    0x2c, 0xa7, 0x97, 0x00, 0x54, 0x4b, 0x01, 0x2c, 0xab, 0x18, 0xc1, 0x2c,
+    0xaf, 0x87, 0x00, 0x54, 0x79, 0x91, 0x00, 0x54, 0x99, 0x0d, 0xc1, 0x2c,
+    0xb9, 0x09, 0xc1, 0x2c, 0xc3, 0x10, 0xc1, 0x2c, 0xcd, 0x05, 0xc1, 0x2c,
+    0xe3, 0x0c, 0xc1, 0x2c, 0xed, 0x16, 0xc1, 0x2c, 0xf7, 0x06, 0xc1, 0x2d,
+    0x05, 0x12, 0xc1, 0x2d, 0x13, 0x04, 0xc1, 0x2d, 0x1d, 0xc2, 0x00, 0xb6,
+    0x00, 0x55, 0x71, 0xc2, 0x1a, 0x18, 0x00, 0x55, 0x79, 0xc2, 0x00, 0x3b,
+    0x00, 0x55, 0x81, 0x0e, 0xc1, 0x2d, 0x27, 0x15, 0xc1, 0x2d, 0x31, 0xc2,
+    0x00, 0xce, 0x00, 0x55, 0xc9, 0xc3, 0xae, 0x8f, 0x00, 0x57, 0xc8, 0x47,
+    0xc3, 0xbf, 0xc1, 0x2d, 0x41, 0x45, 0x00, 0x8d, 0x41, 0x2d, 0x49, 0xc4,
+    0x18, 0xa7, 0x00, 0x57, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x57, 0x39, 0x16,
+    0xc1, 0x2d, 0x6f, 0x08, 0xc1, 0x2d, 0x7b, 0x15, 0xc1, 0x2d, 0x87, 0xc5,
+    0x0a, 0xfd, 0x00, 0x57, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x57, 0x78, 0xc5,
+    0xde, 0x0e, 0x08, 0x19, 0xa1, 0xc3, 0xe6, 0x04, 0x08, 0x19, 0x80, 0xc3,
+    0xbe, 0x34, 0x08, 0x19, 0xb1, 0xc4, 0xe1, 0x80, 0x08, 0x1a, 0x38, 0xc3,
+    0xb8, 0x6e, 0x08, 0x19, 0xb9, 0xc4, 0xde, 0x5c, 0x08, 0x1a, 0x40, 0xc5,
+    0xdd, 0x87, 0x08, 0x19, 0xc1, 0xc4, 0xe0, 0x74, 0x08, 0x1a, 0x20, 0xc5,
+    0xd5, 0x5d, 0x08, 0x19, 0xe9, 0x43, 0x00, 0xe0, 0x41, 0x2d, 0x93, 0x42,
+    0x01, 0x6c, 0xc1, 0x2d, 0x9f, 0x42, 0x00, 0x48, 0x41, 0x2e, 0x09, 0x04,
+    0xc1, 0x2e, 0x21, 0xd5, 0x37, 0x99, 0x01, 0x16, 0xd9, 0x45, 0x00, 0x92,
+    0xc1, 0x2e, 0x2d, 0x11, 0xc1, 0x2e, 0x3f, 0x03, 0xc1, 0x2e, 0x4b, 0xc4,
+    0x00, 0x8d, 0x00, 0x01, 0xf1, 0xcf, 0x64, 0xdf, 0x01, 0x55, 0x3a, 0x01,
+    0x2e, 0x57, 0x4b, 0x6e, 0xbb, 0xc1, 0x2e, 0x5d, 0x47, 0x01, 0x92, 0xc1,
+    0x2e, 0x81, 0x45, 0x00, 0x8d, 0xc1, 0x2e, 0xea, 0xce, 0x73, 0x88, 0x08,
+    0x9a, 0xb9, 0xc2, 0x04, 0x0d, 0x08, 0x9a, 0x80, 0xc9, 0x1b, 0x40, 0x00,
+    0x00, 0xe9, 0xc4, 0x01, 0x65, 0x01, 0x5e, 0x90, 0xc4, 0x07, 0xe9, 0x0f,
+    0xb0, 0x03, 0x01, 0x2f, 0x04, 0xda, 0x1a, 0xe8, 0x0f, 0xb1, 0xc0, 0xc8,
+    0xb5, 0x90, 0x01, 0x37, 0x71, 0xc7, 0xc5, 0x63, 0x01, 0x37, 0x68, 0x48,
+    0x0b, 0x1c, 0xc1, 0x2f, 0x0a, 0xcb, 0x99, 0x3b, 0x01, 0x11, 0xd0, 0x58,
+    0x25, 0x15, 0xc1, 0x2f, 0x16, 0x4f, 0x09, 0x39, 0xc1, 0x2f, 0x9c, 0x47,
+    0x01, 0x92, 0xc1, 0x30, 0x20, 0xd3, 0x44, 0x91, 0x00, 0x87, 0xd9, 0x4d,
+    0x28, 0xa7, 0x41, 0x30, 0xa6, 0xc8, 0x46, 0x05, 0x0f, 0xb6, 0x50, 0x4f,
+    0x09, 0x39, 0xc1, 0x31, 0x2a, 0x4d, 0x28, 0xa7, 0x41, 0x31, 0x93, 0xc4,
+    0xcf, 0xbf, 0x0f, 0xa6, 0xc9, 0xc5, 0x19, 0xbe, 0x0f, 0xcf, 0x08, 0x45,
+    0x00, 0x8d, 0xc1, 0x31, 0xfc, 0x47, 0x01, 0x92, 0xc1, 0x32, 0x18, 0x4b,
+    0x6e, 0xbb, 0xc1, 0x32, 0x7f, 0x03, 0xc1, 0x32, 0x9f, 0x46, 0x04, 0x99,
+    0xc1, 0x32, 0xab, 0xc6, 0xca, 0x8e, 0x00, 0x5b, 0x81, 0x49, 0x54, 0x43,
+    0x41, 0x32, 0xcf, 0x08, 0xc1, 0x32, 0xdb, 0x16, 0xc1, 0x32, 0xe3, 0xc3,
+    0x05, 0x16, 0x0f, 0x68, 0x0b, 0x01, 0x32, 0xf4, 0x15, 0xc1, 0x32, 0xf8,
+    0xc5, 0x0a, 0xfd, 0x0f, 0x68, 0x43, 0x01, 0x33, 0x0a, 0xc4, 0x28, 0x74,
+    0x0f, 0x68, 0x4a, 0x01, 0x33, 0x15, 0xc5, 0xd3, 0x34, 0x0f, 0x69, 0xe9,
+    0xc4, 0x04, 0x30, 0x0f, 0x69, 0xe0, 0x16, 0xc1, 0x33, 0x22, 0x08, 0xc1,
+    0x33, 0x3a, 0x15, 0xc1, 0x33, 0x49, 0xc5, 0x0a, 0xfd, 0x0f, 0x69, 0xa9,
+    0xc4, 0x28, 0x74, 0x0f, 0x69, 0xb0, 0x44, 0x05, 0x1a, 0xc1, 0x33, 0x58,
+    0xcc, 0x85, 0xe0, 0x0f, 0xad, 0x78, 0x01, 0xc1, 0x33, 0x64, 0x1e, 0x41,
+    0x33, 0x8c, 0xc5, 0xd8, 0x2d, 0x0f, 0xad, 0xc0, 0x48, 0xbe, 0xd0, 0xc1,
+    0x33, 0x98, 0x47, 0xc8, 0xab, 0xc1, 0x33, 0xa4, 0x42, 0x02, 0x1d, 0xc1,
+    0x33, 0xb6, 0x4a, 0x9d, 0xd6, 0xc1, 0x33, 0xc2, 0x4e, 0x72, 0x38, 0xc1,
+    0x33, 0xd4, 0x4e, 0x6f, 0xfa, 0xc1, 0x33, 0xe0, 0xc3, 0x20, 0xe3, 0x0f,
+    0xae, 0xe9, 0x43, 0x02, 0x0d, 0xc1, 0x33, 0xec, 0x47, 0xc8, 0x49, 0x41,
+    0x33, 0xf6, 0xc5, 0x29, 0x8b, 0x0f, 0xa3, 0xa9, 0xc3, 0x12, 0xf2, 0x0f,
+    0xa3, 0xa1, 0xc5, 0xd8, 0xaf, 0x0f, 0xce, 0x98, 0x4b, 0x10, 0x44, 0xc1,
+    0x34, 0x02, 0xc7, 0xc6, 0x04, 0x00, 0xe3, 0xe0, 0xd1, 0x56, 0x96, 0x00,
+    0xe3, 0xd1, 0xc8, 0xb5, 0x38, 0x00, 0xe3, 0xc0, 0x11, 0xc1, 0x34, 0x0e,
+    0x0e, 0xc1, 0x34, 0x20, 0x07, 0xc1, 0x34, 0x37, 0x17, 0xc1, 0x34, 0x4b,
+    0x0b, 0xc1, 0x34, 0x5d, 0x03, 0x41, 0x34, 0x6f, 0xc4, 0x28, 0x74, 0x00,
+    0xe2, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0xe2, 0xc1, 0x15, 0xc1, 0x34, 0x85,
+    0x08, 0xc1, 0x34, 0x91, 0x16, 0xc1, 0x34, 0x9d, 0xc3, 0x05, 0x16, 0x00,
+    0xe2, 0x89, 0xc4, 0x18, 0xa7, 0x00, 0xe2, 0x80, 0xca, 0x23, 0xd3, 0x01,
+    0x39, 0x69, 0xcb, 0x8c, 0xfc, 0x01, 0x38, 0xf9, 0xcb, 0x57, 0x87, 0x01,
+    0x38, 0xc9, 0xca, 0x26, 0xb4, 0x01, 0x34, 0xe8, 0xcf, 0x60, 0xe3, 0x01,
+    0x22, 0x51, 0xc3, 0x00, 0xa6, 0x01, 0x22, 0x40, 0xd6, 0x2c, 0xca, 0x01,
+    0x22, 0x49, 0xc4, 0x68, 0x23, 0x01, 0x22, 0x08, 0xd9, 0x1f, 0x33, 0x01,
+    0x22, 0x31, 0xc6, 0xcc, 0xf8, 0x01, 0x22, 0x29, 0xca, 0xa6, 0x64, 0x01,
+    0x22, 0x20, 0xc4, 0x05, 0x45, 0x01, 0x4d, 0x39, 0xc2, 0x00, 0x6f, 0x01,
+    0x4d, 0x30, 0x45, 0x29, 0x77, 0x41, 0x34, 0xa9, 0xc5, 0xd4, 0x18, 0x00,
+    0xb4, 0xd1, 0x42, 0x01, 0xe6, 0xc1, 0x34, 0xb5, 0x0b, 0xc1, 0x34, 0xc7,
+    0x17, 0xc1, 0x34, 0xd3, 0x11, 0xc1, 0x34, 0xe3, 0xc4, 0xdf, 0x30, 0x00,
+    0xb4, 0x81, 0xc4, 0xde, 0x74, 0x00, 0xb4, 0x79, 0x15, 0xc1, 0x34, 0xed,
+    0x10, 0xc1, 0x34, 0xf9, 0xc4, 0xe1, 0x00, 0x00, 0xb4, 0x61, 0xc4, 0xe3,
+    0xe4, 0x00, 0xb4, 0x59, 0x05, 0xc1, 0x35, 0x05, 0xc5, 0xd6, 0x02, 0x00,
+    0xb4, 0x41, 0xc4, 0xe0, 0xc4, 0x00, 0xb4, 0x39, 0xc5, 0xdd, 0x0a, 0x00,
+    0xb4, 0x19, 0xc4, 0xe3, 0x4c, 0x00, 0xb4, 0x11, 0xc5, 0xd5, 0xcb, 0x00,
+    0xb4, 0x08, 0x83, 0x08, 0x24, 0xb3, 0x01, 0x35, 0x11, 0xc2, 0x00, 0xa0,
+    0x08, 0x24, 0x09, 0xc2, 0x00, 0x51, 0x08, 0x24, 0x11, 0xc2, 0x21, 0x7d,
+    0x08, 0x24, 0x19, 0xc2, 0x66, 0x73, 0x08, 0x24, 0x21, 0x0d, 0xc1, 0x35,
+    0x1b, 0x06, 0xc1, 0x35, 0x27, 0xc2, 0x00, 0x3b, 0x08, 0x24, 0x39, 0x15,
+    0xc1, 0x35, 0x33, 0xc4, 0xe0, 0x90, 0x08, 0x24, 0x59, 0xc2, 0x00, 0xeb,
+    0x08, 0x24, 0x61, 0xc2, 0x04, 0x70, 0x08, 0x24, 0x69, 0xc4, 0xd3, 0x82,
+    0x08, 0x24, 0x71, 0xc4, 0xdf, 0xb0, 0x08, 0x24, 0x81, 0xc4, 0xe4, 0x58,
+    0x08, 0x24, 0x89, 0xc4, 0xe2, 0x6c, 0x08, 0x24, 0x91, 0xc3, 0x76, 0xe6,
+    0x08, 0x24, 0x99, 0xc2, 0x00, 0xce, 0x08, 0x24, 0xa1, 0xc2, 0x1a, 0x18,
+    0x08, 0x24, 0xa9, 0x87, 0x08, 0x24, 0xbb, 0x01, 0x35, 0x3d, 0x8b, 0x08,
+    0x24, 0xc1, 0x91, 0x08, 0x24, 0xcb, 0x01, 0x35, 0x41, 0x97, 0x08, 0x24,
+    0xd0, 0xc4, 0x18, 0xa7, 0x08, 0x25, 0x01, 0xc3, 0x05, 0x16, 0x08, 0x25,
+    0x09, 0x16, 0xc1, 0x35, 0x45, 0x08, 0xc1, 0x35, 0x51, 0x15, 0xc1, 0x35,
+    0x5d, 0xc5, 0x0a, 0xfd, 0x08, 0x25, 0x41, 0xc4, 0x28, 0x74, 0x08, 0x25,
+    0x48, 0x83, 0x08, 0x25, 0x83, 0x01, 0x35, 0x69, 0xc3, 0x00, 0x3a, 0x08,
+    0x25, 0xa1, 0xc3, 0x19, 0x59, 0x08, 0x25, 0xa9, 0x87, 0x08, 0x25, 0xbb,
+    0x01, 0x35, 0x74, 0x0a, 0xc1, 0x35, 0x7e, 0x8b, 0x08, 0x25, 0xd9, 0x0d,
+    0xc1, 0x35, 0x88, 0xc2, 0x00, 0x89, 0x08, 0x25, 0xf9, 0xc2, 0x00, 0xb6,
+    0x08, 0x26, 0x01, 0xc2, 0x03, 0x83, 0x08, 0x26, 0x09, 0x91, 0x08, 0x26,
+    0x13, 0x01, 0x35, 0x98, 0xc2, 0x04, 0xf2, 0x08, 0x26, 0x21, 0x15, 0xc1,
+    0x35, 0x9e, 0x16, 0xc1, 0x35, 0xa8, 0xc3, 0x28, 0x16, 0x08, 0x26, 0x69,
+    0x97, 0x08, 0x26, 0x71, 0xc2, 0x00, 0x71, 0x08, 0x26, 0x79, 0xc3, 0x47,
+    0x28, 0x08, 0x26, 0x89, 0x1c, 0x41, 0x35, 0xb0, 0x83, 0x08, 0x26, 0xc3,
+    0x01, 0x35, 0xba, 0xc3, 0x00, 0x3a, 0x08, 0x26, 0xe1, 0xc3, 0x19, 0x59,
+    0x08, 0x26, 0xe9, 0x87, 0x08, 0x26, 0xfb, 0x01, 0x35, 0xc5, 0x0a, 0xc1,
+    0x35, 0xcf, 0x8b, 0x08, 0x27, 0x19, 0x0d, 0xc1, 0x35, 0xd9, 0xc2, 0x00,
+    0x89, 0x08, 0x27, 0x39, 0xc2, 0x00, 0xb6, 0x08, 0x27, 0x41, 0xc2, 0x03,
+    0x83, 0x08, 0x27, 0x49, 0x91, 0x08, 0x27, 0x53, 0x01, 0x35, 0xe9, 0xc2,
+    0x04, 0xf2, 0x08, 0x27, 0x61, 0x15, 0xc1, 0x35, 0xef, 0x16, 0xc1, 0x35,
+    0xf9, 0xc3, 0x28, 0x16, 0x08, 0x27, 0xa9, 0x97, 0x08, 0x27, 0xb1, 0xc2,
+    0x00, 0x71, 0x08, 0x27, 0xb9, 0xc3, 0x47, 0x28, 0x08, 0x27, 0xc9, 0x1c,
+    0x41, 0x36, 0x01, 0x03, 0xc1, 0x36, 0x0b, 0x11, 0xc1, 0x36, 0x1d, 0xc8,
+    0xb6, 0x90, 0x0e, 0x7a, 0xc2, 0x01, 0x36, 0x29, 0xc3, 0x6c, 0x2e, 0x0e,
+    0x7e, 0x09, 0x07, 0xc1, 0x36, 0x2f, 0xcf, 0x5e, 0x73, 0x0e, 0x7b, 0x59,
+    0xcb, 0x96, 0x70, 0x0e, 0x7a, 0x98, 0xc5, 0xd5, 0xad, 0x0e, 0x7e, 0x01,
+    0xc4, 0xde, 0xe8, 0x0e, 0x7d, 0x7a, 0x01, 0x36, 0x3b, 0xc6, 0xb0, 0xb4,
+    0x0e, 0x7d, 0xf9, 0xc5, 0xdd, 0x69, 0x0e, 0x7c, 0x21, 0x42, 0x13, 0x2e,
+    0xc1, 0x36, 0x3f, 0xc6, 0xd1, 0xde, 0x0e, 0x7b, 0x71, 0xc5, 0x5d, 0x8d,
+    0x0e, 0x7a, 0xa0, 0x16, 0xc1, 0x36, 0x4e, 0xc8, 0xba, 0x18, 0x0e, 0x7b,
+    0xeb, 0x01, 0x36, 0x66, 0x49, 0xaf, 0xeb, 0x41, 0x36, 0x6a, 0x01, 0x41,
+    0x36, 0x86, 0xc6, 0xaf, 0xed, 0x0e, 0x7c, 0x29, 0x03, 0x41, 0x36, 0x92,
+    0xc2, 0x13, 0x72, 0x0e, 0x7c, 0x11, 0xd2, 0x49, 0x0f, 0x0e, 0x7b, 0x60,
+    0xc5, 0xd3, 0x2f, 0x0e, 0x7b, 0x79, 0xc8, 0x49, 0x19, 0x0e, 0x7a, 0xd8,
+    0x4c, 0x88, 0x14, 0xc1, 0x36, 0x9e, 0xcb, 0x93, 0xdc, 0x0e, 0x7b, 0x31,
+    0xc8, 0x4a, 0x93, 0x0e, 0x7b, 0x29, 0xc9, 0xb1, 0x65, 0x0e, 0x7b, 0x21,
+    0xc8, 0xbd, 0x80, 0x0e, 0x7b, 0x18, 0x16, 0xc1, 0x36, 0xb6, 0xc6, 0xb7,
+    0x92, 0x0e, 0x7b, 0x09, 0xc7, 0xc3, 0x8e, 0x0e, 0x7b, 0x01, 0xc5, 0xd5,
+    0x9e, 0x0e, 0x7a, 0xf0, 0xa2, 0x0e, 0x7a, 0x19, 0xa1, 0x0e, 0x7a, 0x10,
+    0x0d, 0xc1, 0x36, 0xc2, 0x05, 0xc1, 0x36, 0xd7, 0x06, 0xc1, 0x36, 0xe6,
+    0x16, 0xc1, 0x36, 0xf2, 0x15, 0xc1, 0x37, 0x04, 0x11, 0xc1, 0x37, 0x1c,
+    0x42, 0x01, 0x4c, 0xc1, 0x37, 0x2c, 0x1c, 0xc1, 0x37, 0x36, 0x42, 0x00,
+    0x3b, 0xc1, 0x37, 0x40, 0xc5, 0xdb, 0x8e, 0x0e, 0x79, 0x39, 0xc6, 0xcf,
+    0x32, 0x0e, 0x79, 0x29, 0xc7, 0xc5, 0xbe, 0x0e, 0x79, 0x21, 0x48, 0xbb,
+    0xc0, 0xc1, 0x37, 0x4c, 0x4d, 0x77, 0xea, 0xc1, 0x37, 0x58, 0x47, 0xc4,
+    0x67, 0xc1, 0x37, 0x62, 0x46, 0xce, 0x66, 0x41, 0x37, 0x6e, 0xc9, 0xb4,
+    0x1a, 0x0e, 0x79, 0x91, 0xc6, 0xb4, 0x1d, 0x0e, 0x79, 0x89, 0xc7, 0x6f,
+    0x1a, 0x0e, 0x79, 0x80, 0x42, 0x06, 0xb4, 0xc1, 0x37, 0x7a, 0xc8, 0x14,
+    0x02, 0x08, 0xd1, 0xc1, 0x46, 0x1f, 0xe9, 0x41, 0x37, 0x86, 0xd6, 0x2c,
+    0xe0, 0x08, 0xd2, 0x31, 0xc9, 0x17, 0x63, 0x08, 0xd2, 0x00, 0x4d, 0x7a,
+    0x0c, 0xc1, 0x37, 0x95, 0xd1, 0x51, 0xce, 0x08, 0xd1, 0xd0, 0xc3, 0x1b,
+    0xb1, 0x08, 0xd1, 0x91, 0xc2, 0x00, 0xce, 0x08, 0xd0, 0x61, 0x83, 0x08,
+    0xd0, 0x58, 0x83, 0x08, 0xd1, 0x81, 0xc2, 0x0d, 0x01, 0x08, 0xd1, 0x79,
+    0xc2, 0x00, 0xce, 0x08, 0xd1, 0x70, 0x83, 0x08, 0xd1, 0x41, 0xc2, 0x00,
+    0xce, 0x08, 0xd1, 0x38, 0x1c, 0xc1, 0x37, 0xad, 0xc2, 0x00, 0xce, 0x08,
+    0xd0, 0xe1, 0x83, 0x08, 0xd0, 0xd9, 0x06, 0x41, 0x37, 0xb7, 0x15, 0xc1,
+    0x37, 0xc1, 0xc2, 0x00, 0xce, 0x08, 0xd0, 0xd1, 0x83, 0x08, 0xd0, 0xc9,
+    0x16, 0x41, 0x37, 0xcb, 0xc2, 0x00, 0xce, 0x08, 0xd1, 0x09, 0x83, 0x08,
+    0xd1, 0x00, 0xc2, 0x00, 0xce, 0x08, 0xd0, 0xf9, 0x83, 0x08, 0xd0, 0xf0,
+    0x83, 0x08, 0xd0, 0xe9, 0xc2, 0x03, 0x83, 0x08, 0xd0, 0xc1, 0xc2, 0x1a,
+    0x18, 0x08, 0xd0, 0x99, 0xc2, 0x00, 0xeb, 0x08, 0xd0, 0x78, 0xc2, 0x00,
+    0xce, 0x08, 0xd0, 0x89, 0x83, 0x08, 0xd0, 0x80, 0xc2, 0x00, 0xce, 0x08,
+    0xd0, 0x71, 0x83, 0x08, 0xd0, 0x68, 0xca, 0xa0, 0xec, 0x08, 0xd0, 0x49,
+    0x03, 0xc1, 0x37, 0xd5, 0x91, 0x08, 0xd0, 0x33, 0x01, 0x37, 0xdd, 0x87,
+    0x08, 0xd0, 0x21, 0x97, 0x08, 0xd0, 0x1b, 0x01, 0x37, 0xe1, 0x8b, 0x08,
+    0xd0, 0x08, 0x12, 0xc1, 0x37, 0xe5, 0xcb, 0x37, 0xf7, 0x01, 0x50, 0xf8,
+    0xcf, 0x61, 0xd3, 0x01, 0x4c, 0x51, 0xcd, 0x7f, 0x20, 0x01, 0x4c, 0x40,
+    0xc8, 0xb8, 0x18, 0x01, 0x00, 0x61, 0xcc, 0x40, 0x4a, 0x07, 0xf7, 0xf8,
+    0x43, 0x16, 0xc3, 0xc1, 0x37, 0xf1, 0x42, 0x00, 0xb2, 0x41, 0x38, 0x15,
+    0x45, 0x01, 0x94, 0xc1, 0x38, 0x21, 0xcc, 0x87, 0x18, 0x05, 0x4e, 0x08,
+    0x16, 0xc1, 0x38, 0xad, 0xc3, 0x05, 0x16, 0x05, 0x4e, 0x89, 0xc4, 0x18,
+    0xa7, 0x05, 0x4e, 0x81, 0x08, 0xc1, 0x38, 0xb9, 0x15, 0xc1, 0x38, 0xc5,
+    0xc5, 0x0a, 0xfd, 0x05, 0x4e, 0xc1, 0xc4, 0x28, 0x74, 0x05, 0x4e, 0xc8,
+    0xc5, 0xd4, 0xd1, 0x05, 0x4d, 0xf9, 0xc7, 0xc4, 0xde, 0x05, 0x4d, 0xf1,
+    0xc5, 0xda, 0xa8, 0x05, 0x4d, 0xe8, 0xc5, 0xd4, 0x8b, 0x05, 0x4d, 0xe1,
+    0xca, 0xa7, 0x36, 0x05, 0x4d, 0xd9, 0x16, 0xc1, 0x38, 0xd1, 0xc4, 0xc6,
+    0x82, 0x05, 0x4d, 0xc3, 0x01, 0x38, 0xdb, 0xc4, 0xdf, 0x3c, 0x05, 0x4d,
+    0xb2, 0x01, 0x38, 0xe1, 0xc5, 0xd4, 0xa9, 0x05, 0x4c, 0x0b, 0x01, 0x38,
+    0xe7, 0xc7, 0xc1, 0xea, 0x05, 0x4c, 0x19, 0xc5, 0xdb, 0xfc, 0x05, 0x4c,
+    0x11, 0xc9, 0xaf, 0x1c, 0x05, 0x4c, 0x00, 0x46, 0x06, 0x50, 0xc1, 0x38,
+    0xed, 0x46, 0x00, 0x29, 0x41, 0x38, 0xff, 0xc5, 0x16, 0x41, 0x01, 0x02,
+    0xb9, 0xd1, 0x1e, 0x5a, 0x01, 0x50, 0x60, 0x10, 0xc1, 0x39, 0x0b, 0x0c,
+    0xc1, 0x39, 0x4a, 0x13, 0xc1, 0x39, 0x6a, 0x14, 0xc1, 0x39, 0x86, 0x15,
+    0xc1, 0x39, 0xad, 0x05, 0xc1, 0x39, 0xdf, 0x1c, 0xc1, 0x3a, 0x0d, 0x19,
+    0xc1, 0x3a, 0x3f, 0x0a, 0xc1, 0x3a, 0x5b, 0x0f, 0xc1, 0x3a, 0x8d, 0x09,
+    0xc1, 0x3a, 0xbb, 0x1a, 0xc1, 0x3a, 0xe2, 0x1b, 0xc1, 0x3b, 0x00, 0x8b,
+    0x05, 0x00, 0x13, 0x01, 0x3b, 0x1c, 0x83, 0x05, 0x00, 0x53, 0x01, 0x3b,
+    0x32, 0xc2, 0x01, 0x5c, 0x05, 0x00, 0x6b, 0x01, 0x3b, 0x3e, 0x91, 0x05,
+    0x00, 0x8b, 0x01, 0x3b, 0x46, 0x87, 0x05, 0x00, 0xa3, 0x01, 0x3b, 0x52,
+    0x04, 0xc1, 0x3b, 0x56, 0x12, 0xc1, 0x3b, 0x84, 0x08, 0xc1, 0x3b, 0xa7,
+    0x18, 0xc1, 0x3b, 0xca, 0x06, 0xc1, 0x3b, 0xf1, 0x16, 0xc1, 0x3c, 0x18,
+    0x0e, 0xc1, 0x3c, 0x3b, 0x0d, 0x41, 0x3c, 0x65, 0xc3, 0xe5, 0x98, 0x05,
+    0x24, 0x81, 0x0e, 0xc1, 0x3c, 0x88, 0x0d, 0xc1, 0x3c, 0x95, 0x10, 0xc1,
+    0x3c, 0x9f, 0x05, 0xc1, 0x3c, 0xaf, 0x15, 0xc1, 0x3c, 0xc8, 0x09, 0xc1,
+    0x3c, 0xd2, 0x0f, 0xc1, 0x3c, 0xe6, 0x0a, 0xc1, 0x3c, 0xf0, 0x04, 0xc1,
+    0x3c, 0xfa, 0x1b, 0xc1, 0x3d, 0x06, 0x12, 0xc1, 0x3d, 0x10, 0x16, 0xc1,
+    0x3d, 0x1c, 0x1c, 0xc1, 0x3d, 0x26, 0x06, 0xc1, 0x3d, 0x3a, 0xc2, 0x00,
+    0x11, 0x05, 0x25, 0x49, 0x0c, 0xc1, 0x3d, 0x44, 0x18, 0xc1, 0x3d, 0x4c,
+    0xc2, 0x01, 0xa2, 0x05, 0x25, 0xc0, 0xc3, 0xd4, 0x44, 0x08, 0x75, 0x43,
+    0x01, 0x3d, 0x58, 0xc3, 0x0e, 0xf0, 0x08, 0x75, 0x03, 0x01, 0x3d, 0x5e,
+    0x07, 0xc1, 0x3d, 0x64, 0x0a, 0xc1, 0x3d, 0x78, 0xc2, 0x00, 0x2a, 0x08,
+    0x75, 0x29, 0xc3, 0x76, 0xe6, 0x08, 0x75, 0x21, 0xc2, 0x04, 0x41, 0x08,
+    0x75, 0x19, 0xc3, 0x20, 0xb0, 0x08, 0x75, 0x11, 0xc3, 0x88, 0x52, 0x08,
+    0x75, 0x09, 0xc3, 0xb2, 0x8c, 0x08, 0x74, 0xf9, 0x0d, 0xc1, 0x3d, 0x84,
+    0xc3, 0x0f, 0xba, 0x08, 0x74, 0xe1, 0xc2, 0x02, 0x63, 0x08, 0x74, 0xd3,
+    0x01, 0x3d, 0x90, 0xc2, 0x04, 0x70, 0x08, 0x74, 0xc9, 0x1a, 0xc1, 0x3d,
+    0x96, 0x1c, 0xc1, 0x3d, 0xa0, 0x16, 0xc1, 0x3d, 0xab, 0x42, 0x0e, 0x60,
+    0xc1, 0x3d, 0xb5, 0x15, 0xc1, 0x3d, 0xbd, 0xc2, 0x21, 0x7d, 0x08, 0x74,
+    0x81, 0x14, 0xc1, 0x3d, 0xd3, 0x05, 0xc1, 0x3d, 0xdd, 0x12, 0xc1, 0x3d,
+    0xe7, 0xc2, 0x01, 0x24, 0x08, 0x74, 0x08, 0xca, 0x9f, 0x7a, 0x08, 0x75,
+    0x61, 0xca, 0x9e, 0x3a, 0x08, 0x75, 0x58, 0xa3, 0x70, 0x0c, 0x49, 0xa2,
+    0x70, 0x0c, 0x41, 0xa8, 0x70, 0x0c, 0x71, 0xa7, 0x70, 0x0c, 0x69, 0xa6,
+    0x70, 0x0c, 0x61, 0xa5, 0x70, 0x0c, 0x59, 0xa4, 0x70, 0x0c, 0x51, 0xa1,
+    0x70, 0x0c, 0x39, 0xa0, 0x70, 0x0c, 0x31, 0x9f, 0x70, 0x0c, 0x28, 0xa2,
+    0x70, 0x0b, 0x01, 0xa1, 0x70, 0x0a, 0xf9, 0xa0, 0x70, 0x0a, 0xf1, 0x9f,
+    0x70, 0x0a, 0xe9, 0xa8, 0x70, 0x0b, 0x31, 0xa7, 0x70, 0x0b, 0x29, 0xa6,
+    0x70, 0x0b, 0x21, 0xa5, 0x70, 0x0b, 0x19, 0xa4, 0x70, 0x0b, 0x11, 0xa3,
+    0x70, 0x0b, 0x08, 0xa8, 0x70, 0x0a, 0xe1, 0xa7, 0x70, 0x0a, 0xd9, 0xa6,
+    0x70, 0x0a, 0xd1, 0xa5, 0x70, 0x0a, 0xc9, 0xa4, 0x70, 0x0a, 0xc1, 0xa3,
+    0x70, 0x0a, 0xb9, 0xa2, 0x70, 0x0a, 0xb1, 0xa1, 0x70, 0x0a, 0xa9, 0xa0,
+    0x70, 0x0a, 0xa1, 0x9f, 0x70, 0x0a, 0x98, 0xa8, 0x70, 0x0d, 0xb1, 0xa7,
+    0x70, 0x0d, 0xa9, 0xa6, 0x70, 0x0d, 0xa1, 0xa5, 0x70, 0x0d, 0x99, 0xa4,
+    0x70, 0x0d, 0x91, 0xa3, 0x70, 0x0d, 0x89, 0xa2, 0x70, 0x0d, 0x81, 0xa1,
+    0x70, 0x0d, 0x79, 0xa0, 0x70, 0x0d, 0x71, 0x9f, 0x70, 0x0d, 0x68, 0xa8,
+    0x70, 0x0d, 0x61, 0xa7, 0x70, 0x0d, 0x59, 0xa6, 0x70, 0x0d, 0x51, 0xa5,
+    0x70, 0x0d, 0x49, 0xa4, 0x70, 0x0d, 0x41, 0xa3, 0x70, 0x0d, 0x39, 0xa2,
+    0x70, 0x0d, 0x31, 0xa1, 0x70, 0x0d, 0x29, 0xa0, 0x70, 0x0d, 0x21, 0x9f,
+    0x70, 0x0d, 0x18, 0xa8, 0x70, 0x0d, 0x11, 0xa7, 0x70, 0x0d, 0x09, 0xa6,
+    0x70, 0x0d, 0x01, 0xa5, 0x70, 0x0c, 0xf9, 0xa4, 0x70, 0x0c, 0xf1, 0xa3,
+    0x70, 0x0c, 0xe9, 0xa2, 0x70, 0x0c, 0xe1, 0xa1, 0x70, 0x0c, 0xd9, 0xa0,
+    0x70, 0x0c, 0xd1, 0x9f, 0x70, 0x0c, 0xc8, 0xa8, 0x70, 0x0c, 0xc1, 0xa7,
+    0x70, 0x0c, 0xb9, 0xa6, 0x70, 0x0c, 0xb1, 0xa5, 0x70, 0x0c, 0xa9, 0xa4,
+    0x70, 0x0c, 0xa1, 0xa3, 0x70, 0x0c, 0x99, 0xa2, 0x70, 0x0c, 0x91, 0xa1,
+    0x70, 0x0c, 0x89, 0xa0, 0x70, 0x0c, 0x81, 0x9f, 0x70, 0x0c, 0x78, 0xa8,
+    0x70, 0x0c, 0x21, 0xa7, 0x70, 0x0c, 0x19, 0xa6, 0x70, 0x0c, 0x11, 0xa5,
+    0x70, 0x0c, 0x09, 0xa4, 0x70, 0x0c, 0x01, 0xa3, 0x70, 0x0b, 0xf9, 0xa2,
+    0x70, 0x0b, 0xf1, 0xa1, 0x70, 0x0b, 0xe9, 0xa0, 0x70, 0x0b, 0xe1, 0x9f,
+    0x70, 0x0b, 0xd8, 0xa8, 0x70, 0x0b, 0xd1, 0xa7, 0x70, 0x0b, 0xc9, 0xa6,
+    0x70, 0x0b, 0xc1, 0xa5, 0x70, 0x0b, 0xb9, 0xa4, 0x70, 0x0b, 0xb1, 0xa3,
+    0x70, 0x0b, 0xa9, 0xa2, 0x70, 0x0b, 0xa1, 0xa1, 0x70, 0x0b, 0x99, 0xa0,
+    0x70, 0x0b, 0x91, 0x9f, 0x70, 0x0b, 0x88, 0xa8, 0x70, 0x0b, 0x81, 0xa7,
+    0x70, 0x0b, 0x79, 0xa6, 0x70, 0x0b, 0x71, 0xa5, 0x70, 0x0b, 0x69, 0xa4,
+    0x70, 0x0b, 0x61, 0xa3, 0x70, 0x0b, 0x59, 0xa2, 0x70, 0x0b, 0x51, 0xa1,
+    0x70, 0x0b, 0x49, 0xa0, 0x70, 0x0b, 0x41, 0x9f, 0x70, 0x0b, 0x38, 0xa5,
+    0x70, 0x0f, 0x79, 0xa4, 0x70, 0x0f, 0x71, 0xa3, 0x70, 0x0f, 0x69, 0xa2,
+    0x70, 0x0f, 0x61, 0xa1, 0x70, 0x0f, 0x59, 0xa0, 0x70, 0x0f, 0x51, 0x9f,
+    0x70, 0x0f, 0x48, 0xa8, 0x70, 0x0f, 0x41, 0xa7, 0x70, 0x0f, 0x39, 0xa6,
+    0x70, 0x0f, 0x31, 0xa5, 0x70, 0x0f, 0x29, 0xa4, 0x70, 0x0f, 0x21, 0xa3,
+    0x70, 0x0f, 0x19, 0xa2, 0x70, 0x0f, 0x11, 0xa1, 0x70, 0x0f, 0x09, 0xa0,
+    0x70, 0x0f, 0x01, 0x9f, 0x70, 0x0e, 0xf8, 0xa8, 0x70, 0x0e, 0xf1, 0xa7,
+    0x70, 0x0e, 0xe9, 0xa6, 0x70, 0x0e, 0xe1, 0xa5, 0x70, 0x0e, 0xd9, 0xa4,
+    0x70, 0x0e, 0xd1, 0xa3, 0x70, 0x0e, 0xc9, 0xa2, 0x70, 0x0e, 0xc1, 0xa1,
+    0x70, 0x0e, 0xb9, 0xa0, 0x70, 0x0e, 0xb1, 0x9f, 0x70, 0x0e, 0xa8, 0xa8,
+    0x70, 0x0e, 0xa1, 0xa7, 0x70, 0x0e, 0x99, 0xa6, 0x70, 0x0e, 0x91, 0xa5,
+    0x70, 0x0e, 0x89, 0xa4, 0x70, 0x0e, 0x81, 0xa3, 0x70, 0x0e, 0x79, 0xa2,
+    0x70, 0x0e, 0x71, 0xa1, 0x70, 0x0e, 0x69, 0xa0, 0x70, 0x0e, 0x61, 0x9f,
+    0x70, 0x0e, 0x58, 0xa8, 0x70, 0x0e, 0x51, 0xa7, 0x70, 0x0e, 0x49, 0xa6,
+    0x70, 0x0e, 0x41, 0xa5, 0x70, 0x0e, 0x39, 0xa4, 0x70, 0x0e, 0x31, 0xa3,
+    0x70, 0x0e, 0x29, 0xa2, 0x70, 0x0e, 0x21, 0xa1, 0x70, 0x0e, 0x19, 0xa0,
+    0x70, 0x0e, 0x11, 0x9f, 0x70, 0x0e, 0x08, 0xa8, 0x70, 0x0e, 0x01, 0xa7,
+    0x70, 0x0d, 0xf9, 0xa6, 0x70, 0x0d, 0xf1, 0xa5, 0x70, 0x0d, 0xe9, 0xa4,
+    0x70, 0x0d, 0xe1, 0xa3, 0x70, 0x0d, 0xd9, 0xa2, 0x70, 0x0d, 0xd1, 0xa1,
+    0x70, 0x0d, 0xc9, 0xa0, 0x70, 0x0d, 0xc1, 0x9f, 0x70, 0x0d, 0xb8, 0x87,
+    0x05, 0x2f, 0x0b, 0x01, 0x3d, 0xf1, 0x0a, 0xc1, 0x3d, 0xfc, 0x19, 0xc1,
+    0x3e, 0x1f, 0x12, 0xc1, 0x3e, 0x42, 0x04, 0xc1, 0x3e, 0x5c, 0x0f, 0xc1,
+    0x3e, 0x7a, 0x0d, 0xc1, 0x3e, 0x9e, 0x09, 0xc1, 0x3e, 0xbf, 0x08, 0xc1,
+    0x3e, 0xdd, 0x18, 0xc1, 0x3e, 0xf7, 0x16, 0xc1, 0x3f, 0x11, 0x06, 0xc1,
+    0x3f, 0x2f, 0x0e, 0xc1, 0x3f, 0x4d, 0x14, 0xc1, 0x3f, 0x67, 0x10, 0xc1,
+    0x3f, 0x81, 0x15, 0xc1, 0x3f, 0xae, 0x1c, 0xc1, 0x3f, 0xcc, 0x05, 0xc1,
+    0x3f, 0xea, 0x0c, 0xc1, 0x40, 0x04, 0x1b, 0xc1, 0x40, 0x1e, 0x8b, 0x05,
+    0x29, 0x23, 0x01, 0x40, 0x38, 0x83, 0x05, 0x2a, 0x4b, 0x01, 0x40, 0x3c,
+    0x91, 0x05, 0x2d, 0xd3, 0x01, 0x40, 0x40, 0x97, 0x05, 0x2c, 0xaa, 0x01,
+    0x40, 0x4b, 0x08, 0xc1, 0x40, 0x4f, 0x0d, 0xc1, 0x40, 0x5b, 0x16, 0xc1,
+    0x40, 0x67, 0xc3, 0xe5, 0xaa, 0x05, 0x30, 0xb1, 0xc4, 0x11, 0x80, 0x05,
+    0x30, 0xb9, 0x06, 0xc1, 0x40, 0x79, 0xc4, 0xa3, 0xbc, 0x05, 0x30, 0xf8,
+    0xc2, 0x01, 0xa2, 0x05, 0x31, 0x11, 0xc4, 0x03, 0xe0, 0x05, 0x31, 0x18,
+    0xc3, 0x04, 0xa0, 0x05, 0x31, 0x21, 0xc3, 0x0c, 0xf7, 0x05, 0x31, 0x28,
+    0xc2, 0x24, 0x36, 0x05, 0x31, 0x31, 0xc4, 0x17, 0xf7, 0x05, 0x31, 0x38,
+    0xa1, 0x0f, 0xdb, 0x81, 0xa2, 0x0f, 0xdb, 0x89, 0xa3, 0x0f, 0xdb, 0x91,
+    0xa4, 0x0f, 0xdb, 0x99, 0xa5, 0x0f, 0xdb, 0xa1, 0xa6, 0x0f, 0xdb, 0xa8,
+    0xd6, 0x2e, 0x40, 0x01, 0x3e, 0x51, 0xd5, 0x38, 0x02, 0x01, 0x4e, 0x81,
+    0xd6, 0x2f, 0xe2, 0x01, 0x57, 0x11, 0xd5, 0x32, 0xd7, 0x01, 0x57, 0x20,
+    0x01, 0x41, 0x40, 0x83, 0x42, 0x00, 0x03, 0xc1, 0x40, 0x8f, 0xcc, 0x8a,
+    0x3c, 0x0f, 0xb5, 0x31, 0xc4, 0x20, 0x42, 0x01, 0x71, 0x78, 0xc4, 0x01,
+    0x65, 0x01, 0x81, 0x8b, 0x01, 0x40, 0x9e, 0xd6, 0x2f, 0x06, 0x01, 0x81,
+    0x92, 0x01, 0x40, 0xa2, 0x46, 0x0d, 0xe6, 0xc1, 0x40, 0xa8, 0xcb, 0x57,
+    0x87, 0x0f, 0xbd, 0x31, 0x46, 0x00, 0xbb, 0xc1, 0x40, 0xb4, 0x15, 0xc1,
+    0x40, 0xc0, 0xcf, 0x69, 0x62, 0x0f, 0xb3, 0xe9, 0xd4, 0x3e, 0x46, 0x0f,
+    0xbd, 0x98, 0xcc, 0x06, 0x09, 0x01, 0x16, 0xc9, 0xc9, 0x02, 0xa0, 0x01,
+    0x16, 0xc0, 0xc7, 0xc7, 0x77, 0x00, 0xe7, 0xb9, 0xcb, 0x40, 0xaa, 0x00,
+    0xe7, 0x91, 0x48, 0x14, 0x03, 0x41, 0x40, 0xd2, 0xd3, 0x40, 0xa2, 0x00,
+    0xe7, 0x99, 0xd3, 0x44, 0x0c, 0x00, 0xe7, 0x81, 0x50, 0x5d, 0x12, 0x41,
+    0x40, 0xed, 0xc8, 0x6c, 0x2c, 0x00, 0xe7, 0x2b, 0x01, 0x40, 0xf9, 0xc6,
+    0x6c, 0x2e, 0x00, 0xe7, 0x1b, 0x01, 0x40, 0xff, 0xc7, 0x02, 0x62, 0x00,
+    0xe7, 0x10, 0x45, 0x03, 0x7c, 0xc1, 0x41, 0x05, 0xc7, 0x0f, 0x80, 0x00,
+    0xe6, 0xe8, 0xc8, 0xa6, 0x84, 0x00, 0xe7, 0xc1, 0x43, 0xa8, 0x91, 0x41,
+    0x41, 0x11, 0xc5, 0x00, 0xd2, 0x00, 0xe7, 0xa1, 0xc5, 0x01, 0x24, 0x00,
+    0xe6, 0xc0, 0xcf, 0x61, 0xf1, 0x00, 0xe6, 0xf9, 0xcd, 0x03, 0x1c, 0x00,
+    0xe6, 0xf1, 0xcd, 0x7d, 0xdb, 0x00, 0xe6, 0xd8, 0xce, 0x6c, 0x26, 0x00,
+    0xe6, 0xe1, 0xc6, 0xcc, 0xfe, 0x00, 0xe6, 0x80, 0xdb, 0x17, 0x99, 0x00,
+    0xe6, 0xbb, 0x01, 0x41, 0x17, 0xd3, 0x02, 0x56, 0x00, 0xe6, 0xb1, 0xde,
+    0x0f, 0x24, 0x00, 0xe6, 0xa8, 0xc2, 0x01, 0x24, 0x08, 0x2b, 0x89, 0x87,
+    0x08, 0x2b, 0x90, 0x87, 0x08, 0x2b, 0x99, 0xc2, 0x00, 0x61, 0x08, 0x2b,
+    0xa0, 0x87, 0x08, 0x2b, 0xa9, 0xc2, 0x00, 0x61, 0x08, 0x2b, 0xb0, 0x8b,
+    0x08, 0x2b, 0xb8, 0xc2, 0x00, 0xce, 0x08, 0x2b, 0xe9, 0x83, 0x08, 0x2b,
+    0xe0, 0xc2, 0x19, 0x48, 0x08, 0x2b, 0xf8, 0xc2, 0x00, 0x89, 0x08, 0x2c,
+    0x19, 0x83, 0x08, 0x2c, 0x10, 0x87, 0x08, 0x2c, 0x29, 0xc2, 0x19, 0x48,
+    0x08, 0x2c, 0x30, 0xc2, 0x00, 0x61, 0x08, 0x2c, 0x69, 0x87, 0x08, 0x2c,
+    0x60, 0x87, 0x08, 0x2c, 0x71, 0xc2, 0x00, 0x61, 0x08, 0x2c, 0x78, 0xc2,
+    0x01, 0x24, 0x08, 0x2c, 0xc1, 0x87, 0x08, 0x2c, 0xc8, 0x87, 0x08, 0x2c,
+    0xd1, 0xc2, 0x00, 0x61, 0x08, 0x2c, 0xd8, 0x87, 0x08, 0x2c, 0xe1, 0xc2,
+    0x00, 0x61, 0x08, 0x2c, 0xe8, 0x8b, 0x08, 0x2c, 0xf0, 0x83, 0x08, 0x2d,
+    0x19, 0xc2, 0x00, 0xce, 0x08, 0x2d, 0x20, 0xc2, 0x19, 0x48, 0x08, 0x2d,
+    0x30, 0x83, 0x08, 0x2d, 0x49, 0xc2, 0x00, 0x89, 0x08, 0x2d, 0x50, 0x87,
+    0x08, 0x2d, 0x61, 0xc2, 0x19, 0x48, 0x08, 0x2d, 0x68, 0x87, 0x08, 0x2d,
+    0x99, 0xc2, 0x00, 0x61, 0x08, 0x2d, 0xa0, 0x87, 0x08, 0x2d, 0xa9, 0xc2,
+    0x00, 0x61, 0x08, 0x2d, 0xb0, 0xc7, 0x46, 0x5f, 0x01, 0x0a, 0xe9, 0xc6,
+    0xd3, 0x34, 0x01, 0x0a, 0xd0, 0xc7, 0x46, 0x5f, 0x01, 0x0a, 0xe1, 0xc6,
+    0x9e, 0x5c, 0x01, 0x0a, 0xb9, 0xc8, 0x06, 0x7b, 0x00, 0x05, 0xf0, 0xc6,
+    0x9e, 0x5c, 0x01, 0x0a, 0xb1, 0xc6, 0x8d, 0x49, 0x01, 0x0a, 0xa0, 0xc4,
+    0xa3, 0x6c, 0x01, 0x0a, 0xc9, 0xc6, 0xcf, 0x9e, 0x01, 0x0a, 0x80, 0xc4,
+    0x0a, 0xca, 0x01, 0x0a, 0x99, 0xc4, 0x1a, 0x3b, 0x01, 0x0a, 0x90, 0xca,
+    0x20, 0x55, 0x70, 0x03, 0x01, 0xcf, 0x51, 0x7b, 0x70, 0x01, 0xf0, 0xc7,
+    0x7f, 0x4d, 0x70, 0x02, 0xf9, 0x07, 0xc1, 0x41, 0x1d, 0x45, 0x09, 0x34,
+    0x41, 0x41, 0x29, 0xd0, 0x0a, 0x19, 0x70, 0x02, 0xf1, 0x11, 0x41, 0x41,
+    0x35, 0x45, 0x01, 0x79, 0xc1, 0x41, 0x41, 0xce, 0x69, 0x63, 0x70, 0x02,
+    0xe0, 0xcb, 0x30, 0xec, 0x70, 0x01, 0xf9, 0xcc, 0x01, 0x5d, 0x70, 0x01,
+    0x10, 0xca, 0x0f, 0xb0, 0x70, 0x01, 0xe9, 0xcf, 0x0e, 0xee, 0x70, 0x01,
+    0x08, 0xc8, 0x50, 0x47, 0x70, 0x01, 0xd9, 0xc6, 0x2a, 0x12, 0x70, 0x01,
+    0x79, 0xc4, 0x40, 0x52, 0x70, 0x01, 0x00, 0x45, 0x04, 0x9a, 0xc1, 0x41,
+    0x53, 0xca, 0x94, 0xe5, 0x70, 0x01, 0x20, 0xc8, 0x64, 0xb3, 0x70, 0x01,
+    0x59, 0xcb, 0x8f, 0xfe, 0x70, 0x01, 0x28, 0xc7, 0x09, 0x82, 0x70, 0x01,
+    0x51, 0xc9, 0x2e, 0xd1, 0x70, 0x01, 0x39, 0xc8, 0x33, 0xd7, 0x70, 0x01,
+    0x30, 0x97, 0x00, 0xbb, 0x99, 0x8b, 0x00, 0xbb, 0x90, 0xc2, 0x0d, 0x01,
+    0x00, 0xbb, 0x81, 0xc2, 0x00, 0x71, 0x00, 0xbb, 0x79, 0xc2, 0x00, 0x89,
+    0x00, 0xbb, 0x71, 0xc2, 0x1a, 0x18, 0x00, 0xbb, 0x61, 0xc2, 0x00, 0xb6,
+    0x00, 0xbb, 0x59, 0xc2, 0x00, 0xa0, 0x00, 0xbb, 0x51, 0xc2, 0x04, 0xf2,
+    0x00, 0xbb, 0x49, 0x10, 0xc1, 0x41, 0x77, 0xc2, 0x0e, 0x60, 0x00, 0xbb,
+    0x39, 0xc2, 0x00, 0x51, 0x00, 0xbb, 0x31, 0xc2, 0x00, 0xeb, 0x00, 0xbb,
+    0x21, 0xc2, 0x02, 0x4d, 0x00, 0xbb, 0x19, 0x97, 0x00, 0xbb, 0x11, 0x8b,
+    0x00, 0xbb, 0x09, 0x83, 0x00, 0xbb, 0x00, 0x83, 0x00, 0xb8, 0x03, 0x01,
+    0x41, 0x81, 0xc2, 0x00, 0xce, 0x00, 0xb8, 0x89, 0xc2, 0x0d, 0x01, 0x00,
+    0xb8, 0x81, 0xc2, 0x00, 0x71, 0x00, 0xb8, 0x79, 0xc2, 0x00, 0x89, 0x00,
+    0xb8, 0x71, 0xc2, 0x00, 0x3b, 0x00, 0xb8, 0x69, 0xc2, 0x1a, 0x18, 0x00,
+    0xb8, 0x61, 0xc2, 0x00, 0xb6, 0x00, 0xb8, 0x59, 0xc2, 0x00, 0xa0, 0x00,
+    0xb8, 0x51, 0xc2, 0x04, 0xf2, 0x00, 0xb8, 0x49, 0x10, 0xc1, 0x41, 0x87,
+    0xc2, 0x0e, 0x60, 0x00, 0xb8, 0x39, 0xc2, 0x00, 0x51, 0x00, 0xb8, 0x31,
+    0xc2, 0x00, 0xeb, 0x00, 0xb8, 0x21, 0xc2, 0x02, 0x4d, 0x00, 0xb8, 0x19,
+    0x97, 0x00, 0xb8, 0x11, 0x8b, 0x00, 0xb8, 0x08, 0xc8, 0x7c, 0x26, 0x00,
+    0xb8, 0xa9, 0xc6, 0x1f, 0xf5, 0x00, 0xb8, 0xa0, 0x97, 0x00, 0xb8, 0x99,
+    0x8b, 0x00, 0xb8, 0x90, 0x4a, 0xa7, 0x0e, 0xc1, 0x41, 0x91, 0xce, 0x1a,
+    0x58, 0x0b, 0x7f, 0x00, 0x46, 0x04, 0x99, 0xc1, 0x41, 0xb1, 0x47, 0x01,
+    0x92, 0x41, 0x41, 0xd5, 0x44, 0x00, 0x8e, 0xc1, 0x42, 0x41, 0xd1, 0x52,
+    0xbc, 0x08, 0xff, 0x79, 0xc9, 0xb3, 0x93, 0x08, 0xff, 0x61, 0xcc, 0x82,
+    0x68, 0x08, 0xff, 0x38, 0xc9, 0xaf, 0xd0, 0x08, 0xff, 0x69, 0x4b, 0x94,
+    0x1e, 0x41, 0x42, 0x69, 0xcb, 0x93, 0x0b, 0x08, 0xff, 0x59, 0xcd, 0x73,
+    0x89, 0x00, 0x5e, 0xb9, 0xcc, 0x82, 0x5c, 0x00, 0x5f, 0xc0, 0xcb, 0x94,
+    0xb8, 0x08, 0xff, 0x51, 0xca, 0x96, 0xd4, 0x00, 0x5f, 0xb8, 0xc8, 0x43,
+    0x46, 0x08, 0xff, 0x31, 0x46, 0x01, 0x93, 0x41, 0x42, 0x75, 0xd3, 0x44,
+    0x45, 0x08, 0xff, 0x29, 0x45, 0x04, 0x9a, 0xc1, 0x42, 0xdc, 0xc7, 0xc2,
+    0xa7, 0x00, 0x5f, 0x99, 0xc9, 0xb1, 0x2f, 0x00, 0x5f, 0xb0, 0xd8, 0x25,
+    0x5d, 0x08, 0xfe, 0xa1, 0x46, 0x03, 0xdf, 0xc1, 0x43, 0x00, 0x44, 0x05,
+    0x16, 0x41, 0x43, 0x18, 0x03, 0xc1, 0x43, 0x3e, 0x8b, 0x00, 0x5d, 0xfb,
+    0x01, 0x43, 0x4a, 0x97, 0x00, 0x5e, 0x0b, 0x01, 0x43, 0x4e, 0x87, 0x00,
+    0x5e, 0x33, 0x01, 0x43, 0x52, 0x91, 0x00, 0x5e, 0x52, 0x01, 0x43, 0x56,
+    0xc3, 0x01, 0x43, 0x00, 0x5f, 0x81, 0x44, 0x05, 0x16, 0xc1, 0x43, 0x5a,
+    0xc4, 0x00, 0x8d, 0x00, 0x5f, 0xd0, 0xc4, 0x28, 0x74, 0x08, 0xb6, 0x49,
+    0xc5, 0x0a, 0xfd, 0x08, 0xb6, 0x41, 0x15, 0xc1, 0x43, 0x66, 0x08, 0xc1,
+    0x43, 0x72, 0x16, 0xc1, 0x43, 0x7e, 0xc3, 0x05, 0x16, 0x08, 0xb6, 0x09,
+    0xc4, 0x18, 0xa7, 0x08, 0xb6, 0x00, 0x83, 0x08, 0xb4, 0x03, 0x01, 0x43,
+    0x8a, 0x14, 0xc1, 0x43, 0x9c, 0xc2, 0x00, 0xce, 0x08, 0xb5, 0x49, 0x15,
+    0xc1, 0x43, 0xa6, 0xc2, 0x02, 0x63, 0x08, 0xb5, 0x31, 0xc2, 0x00, 0x89,
+    0x08, 0xb5, 0x29, 0xc2, 0x1a, 0x18, 0x08, 0xb5, 0x19, 0xc2, 0x00, 0xb6,
+    0x08, 0xb5, 0x11, 0x04, 0xc1, 0x43, 0xb0, 0x12, 0xc1, 0x43, 0xba, 0x10,
+    0xc1, 0x43, 0xc4, 0x06, 0xc1, 0x43, 0xda, 0x16, 0xc1, 0x43, 0xe8, 0x0c,
+    0xc1, 0x43, 0xf6, 0x05, 0xc1, 0x44, 0x00, 0x09, 0xc1, 0x44, 0x0a, 0x0d,
+    0xc1, 0x44, 0x14, 0x91, 0x08, 0xb4, 0x41, 0x87, 0x08, 0xb4, 0x31, 0x97,
+    0x08, 0xb4, 0x23, 0x01, 0x44, 0x1e, 0x8b, 0x08, 0xb4, 0x12, 0x01, 0x44,
+    0x22, 0xc5, 0x34, 0xd9, 0x08, 0xb5, 0xb9, 0x42, 0x06, 0xb4, 0xc1, 0x44,
+    0x26, 0xc8, 0x14, 0x02, 0x08, 0xb5, 0x58, 0x03, 0xc1, 0x44, 0x32, 0x91,
+    0x08, 0xb5, 0xa1, 0x87, 0x08, 0xb5, 0x91, 0x97, 0x08, 0xb5, 0x83, 0x01,
+    0x44, 0x3e, 0x8b, 0x08, 0xb5, 0x72, 0x01, 0x44, 0x42, 0xc5, 0xd4, 0xdb,
+    0x00, 0xd5, 0x69, 0x0a, 0xc1, 0x44, 0x46, 0x42, 0x0d, 0x01, 0xc1, 0x44,
+    0x52, 0x0d, 0xc1, 0x44, 0x67, 0x44, 0x38, 0x94, 0xc1, 0x44, 0x7c, 0x14,
+    0xc1, 0x44, 0x91, 0xc6, 0xd2, 0x68, 0x00, 0xd5, 0x29, 0xc5, 0xd4, 0x59,
+    0x00, 0xd5, 0x03, 0x01, 0x44, 0x9d, 0x45, 0x27, 0x2c, 0x41, 0x44, 0xa3,
+    0xc4, 0x28, 0x74, 0x00, 0xd4, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0xd4, 0xc1,
+    0x15, 0xc1, 0x44, 0xab, 0x08, 0xc1, 0x44, 0xb7, 0x16, 0xc1, 0x44, 0xc3,
+    0xc3, 0x05, 0x16, 0x00, 0xd4, 0x89, 0xc4, 0x18, 0xa7, 0x00, 0xd4, 0x80,
+    0xc4, 0x28, 0x74, 0x00, 0xd4, 0x49, 0xc5, 0x0a, 0xfd, 0x00, 0xd4, 0x41,
+    0x15, 0xc1, 0x44, 0xcf, 0x08, 0xc1, 0x44, 0xdb, 0x16, 0xc1, 0x44, 0xe7,
+    0xc3, 0x05, 0x16, 0x00, 0xd4, 0x09, 0xc4, 0x18, 0xa7, 0x00, 0xd4, 0x00,
+    0xd9, 0x1f, 0xfb, 0x00, 0xd3, 0xf9, 0x4d, 0x2c, 0x5e, 0x41, 0x44, 0xf3,
+    0x91, 0x00, 0xd3, 0x5b, 0x01, 0x45, 0x13, 0x16, 0xc1, 0x45, 0x21, 0x83,
+    0x00, 0xd3, 0x0b, 0x01, 0x45, 0x2d, 0x87, 0x00, 0xd3, 0x71, 0x97, 0x00,
+    0xd3, 0x4b, 0x01, 0x45, 0x39, 0x8b, 0x00, 0xd3, 0x2b, 0x01, 0x45, 0x44,
+    0xc7, 0xbf, 0xc1, 0x00, 0xd3, 0x10, 0xc8, 0xbb, 0x98, 0x00, 0xd2, 0xa1,
+    0x0e, 0xc1, 0x45, 0x48, 0xc2, 0x05, 0x37, 0x00, 0xd2, 0x91, 0xc2, 0x00,
+    0xc8, 0x00, 0xd2, 0x89, 0x97, 0x00, 0xd2, 0x7b, 0x01, 0x45, 0x61, 0x8b,
+    0x00, 0xd2, 0x6b, 0x01, 0x45, 0x65, 0x83, 0x00, 0xd2, 0x59, 0x45, 0x08,
+    0xad, 0xc1, 0x45, 0x69, 0xc2, 0x00, 0x71, 0x00, 0xd2, 0x29, 0x14, 0xc1,
+    0x45, 0x95, 0xc2, 0x00, 0xb6, 0x00, 0xd1, 0xf1, 0xc2, 0x00, 0xa0, 0x00,
+    0xd1, 0xb9, 0x10, 0xc1, 0x45, 0xa2, 0xc2, 0x0e, 0x60, 0x00, 0xd1, 0x78,
+    0x44, 0x1c, 0xa4, 0xc1, 0x45, 0xb2, 0x15, 0xc1, 0x45, 0xc6, 0xc2, 0x00,
+    0xce, 0x00, 0xca, 0xb9, 0x83, 0x00, 0xca, 0xb0, 0x8b, 0x00, 0xcb, 0x69,
+    0xc2, 0x0e, 0x21, 0x00, 0xcb, 0x60, 0x8a, 0x00, 0xcb, 0x31, 0x87, 0x00,
+    0xcb, 0x28, 0x87, 0x00, 0xcb, 0x50, 0x91, 0x00, 0xcb, 0x40, 0x83, 0x00,
+    0xcb, 0x11, 0xc2, 0x00, 0xeb, 0x00, 0xca, 0x90, 0xc2, 0x00, 0xce, 0x00,
+    0xcb, 0x01, 0x83, 0x00, 0xca, 0x80, 0xc2, 0x00, 0xce, 0x00, 0xca, 0xd1,
+    0x83, 0x00, 0xca, 0xc8, 0x42, 0x08, 0x6a, 0xc1, 0x45, 0xd0, 0xc6, 0xd1,
+    0x60, 0x05, 0x56, 0xf1, 0xc3, 0x55, 0x1f, 0x05, 0x56, 0xe9, 0xc5, 0xdc,
+    0x6a, 0x05, 0x56, 0xe0, 0xc4, 0xc0, 0x29, 0x05, 0x56, 0x11, 0xc3, 0x1a,
+    0x68, 0x05, 0x56, 0x09, 0xc5, 0xdc, 0x6a, 0x05, 0x56, 0x01, 0xc2, 0x13,
+    0x86, 0x05, 0x55, 0xf8, 0x03, 0xc1, 0x45, 0xda, 0x97, 0x05, 0x55, 0xa3,
+    0x01, 0x45, 0xf0, 0x8b, 0x05, 0x55, 0x93, 0x01, 0x45, 0xfb, 0x87, 0x05,
+    0x55, 0xa9, 0x91, 0x05, 0x55, 0xb0, 0xc3, 0x00, 0xc4, 0x05, 0x55, 0x81,
+    0xc3, 0x00, 0xbc, 0x05, 0x55, 0xb8, 0x45, 0x08, 0xad, 0xc1, 0x45, 0xff,
+    0x44, 0x0a, 0x78, 0x41, 0x46, 0x59, 0xcb, 0x57, 0x35, 0x01, 0x36, 0x51,
+    0xc8, 0xb5, 0x88, 0x01, 0x5e, 0x10, 0xc6, 0x2c, 0x64, 0x01, 0x18, 0xc9,
+    0x44, 0x08, 0xa1, 0x41, 0x46, 0xb3, 0x46, 0x10, 0x2b, 0xc1, 0x46, 0xbf,
+    0xc5, 0xd2, 0xc3, 0x01, 0x71, 0xc0, 0xc6, 0xd2, 0xc8, 0x01, 0x0a, 0x71,
+    0x52, 0x44, 0x1f, 0xc1, 0x46, 0xcb, 0x45, 0x1c, 0x28, 0xc1, 0x46, 0xd7,
+    0xc8, 0x50, 0x47, 0x01, 0x71, 0xa8, 0xc8, 0x33, 0xd7, 0x01, 0x0a, 0x59,
+    0xc4, 0x00, 0xc5, 0x01, 0x4d, 0x10, 0xc8, 0xbc, 0x70, 0x01, 0x09, 0x91,
+    0xc4, 0x04, 0x0d, 0x01, 0x71, 0x90, 0xd0, 0x57, 0x92, 0x01, 0x3e, 0x01,
+    0xce, 0x05, 0x1b, 0x01, 0x02, 0xb0, 0x50, 0x59, 0x52, 0xc1, 0x46, 0xe3,
+    0xcf, 0x60, 0xf2, 0x01, 0x59, 0x88, 0xd0, 0x27, 0xc2, 0x01, 0x0f, 0xb1,
+    0x44, 0x3f, 0x63, 0x41, 0x46, 0xef, 0x4c, 0x81, 0xe4, 0xc1, 0x47, 0x07,
+    0x4b, 0x95, 0xb5, 0xc1, 0x47, 0x13, 0x43, 0x07, 0x90, 0xc1, 0x47, 0x19,
+    0x4c, 0x86, 0x64, 0x41, 0x47, 0x1f, 0x15, 0xc1, 0x47, 0x25, 0xcb, 0x57,
+    0x87, 0x0f, 0xbd, 0x08, 0xce, 0x70, 0x32, 0x01, 0x10, 0x21, 0xc6, 0xd1,
+    0xae, 0x01, 0x10, 0x18, 0x0a, 0xc1, 0x47, 0x31, 0x15, 0xc1, 0x47, 0x3d,
+    0x10, 0xc1, 0x47, 0x4d, 0xc3, 0x44, 0x1d, 0x00, 0x3c, 0x19, 0xc3, 0x4a,
+    0x53, 0x00, 0x3c, 0x21, 0x0e, 0xc1, 0x47, 0x59, 0x0d, 0xc1, 0x47, 0x65,
+    0x03, 0xc1, 0x47, 0x71, 0xc5, 0xd9, 0x2c, 0x00, 0x3c, 0x41, 0xc5, 0xdb,
+    0x98, 0x00, 0x3c, 0x49, 0xc5, 0xdd, 0x14, 0x00, 0x3c, 0x51, 0x06, 0xc1,
+    0x47, 0x7d, 0x16, 0xc1, 0x47, 0x87, 0x09, 0xc1, 0x47, 0xa0, 0x1c, 0xc1,
+    0x47, 0xb2, 0xc3, 0xa8, 0xb0, 0x00, 0x3c, 0xa1, 0xc8, 0xb4, 0xf0, 0x00,
+    0x3c, 0xa9, 0xc8, 0xb5, 0x78, 0x00, 0x3c, 0xb1, 0xc9, 0xb2, 0x46, 0x00,
+    0x3c, 0xb9, 0xc5, 0xd3, 0x82, 0x00, 0x3d, 0x21, 0xc5, 0xd8, 0x19, 0x00,
+    0x3d, 0x28, 0xc6, 0xce, 0x9c, 0x00, 0x3d, 0x31, 0xc8, 0xb5, 0xc0, 0x00,
+    0x3d, 0x38, 0xc8, 0xb8, 0x38, 0x00, 0x3d, 0x49, 0xc6, 0xd3, 0x58, 0x00,
+    0x3d, 0x61, 0xc8, 0xb6, 0x68, 0x00, 0x3d, 0x68, 0xc8, 0xb7, 0x40, 0x00,
+    0x3d, 0x59, 0xc6, 0xd2, 0x74, 0x00, 0x3d, 0x71, 0xc8, 0xb5, 0xb0, 0x00,
+    0x3d, 0x78, 0x49, 0x39, 0x83, 0xc1, 0x47, 0xba, 0xd3, 0x42, 0x7d, 0x00,
+    0x71, 0xf8, 0xc4, 0x18, 0xa7, 0x00, 0x72, 0x81, 0xc3, 0x05, 0x16, 0x00,
+    0x72, 0x89, 0x16, 0xc1, 0x48, 0x0e, 0x08, 0xc1, 0x48, 0x1a, 0x15, 0xc1,
+    0x48, 0x26, 0xc5, 0x0a, 0xfd, 0x00, 0x72, 0xc1, 0xc4, 0x28, 0x74, 0x00,
+    0x72, 0xc8, 0xc8, 0x1e, 0x5a, 0x01, 0x19, 0x01, 0xcc, 0x89, 0x94, 0x01,
+    0x5e, 0x51, 0xcc, 0x81, 0xd8, 0x01, 0x71, 0xc9, 0xd0, 0x1e, 0xb6, 0x01,
+    0x72, 0xc9, 0xd1, 0x1a, 0x32, 0x01, 0x72, 0xd0, 0xc5, 0x13, 0x4d, 0x01,
+    0x18, 0xe9, 0xc3, 0x09, 0x6c, 0x01, 0x18, 0x70, 0xc5, 0x13, 0x4d, 0x01,
+    0x18, 0xe1, 0xc3, 0x09, 0x6c, 0x01, 0x18, 0x78, 0xca, 0x9f, 0xc0, 0x01,
+    0x49, 0xe8, 0x83, 0x0f, 0x15, 0x6b, 0x01, 0x48, 0x32, 0x04, 0xc1, 0x48,
+    0x36, 0x91, 0x0f, 0x15, 0x51, 0x87, 0x0f, 0x15, 0x33, 0x01, 0x48, 0x40,
+    0x97, 0x0f, 0x15, 0x29, 0x8b, 0x0f, 0x15, 0x0b, 0x01, 0x48, 0x44, 0xc2,
+    0x00, 0x89, 0x0f, 0x15, 0x01, 0xc2, 0x00, 0x3b, 0x0f, 0x14, 0xf9, 0xc2,
+    0x00, 0xce, 0x0f, 0x14, 0xf1, 0xc2, 0x21, 0x7d, 0x0f, 0x14, 0xe9, 0xc2,
+    0x00, 0x71, 0x0f, 0x14, 0xe1, 0xc2, 0x1a, 0x18, 0x0f, 0x14, 0xd9, 0xc3,
+    0x19, 0x59, 0x0f, 0x14, 0xd1, 0xc2, 0x0d, 0x01, 0x0f, 0x14, 0xc9, 0x10,
+    0xc1, 0x48, 0x48, 0xc2, 0x00, 0xb6, 0x0f, 0x14, 0xb1, 0xc2, 0x00, 0xeb,
+    0x0f, 0x14, 0xa9, 0xc2, 0x02, 0x4d, 0x0f, 0x14, 0xa1, 0xc2, 0x0e, 0x60,
+    0x0f, 0x14, 0x99, 0xc2, 0x00, 0x51, 0x0f, 0x14, 0x91, 0xc2, 0x04, 0xf2,
+    0x0f, 0x14, 0x80, 0xc2, 0xe6, 0x36, 0x0f, 0x92, 0x09, 0xc2, 0xe5, 0xc0,
+    0x0f, 0x92, 0x10, 0xc3, 0xe5, 0x29, 0x0f, 0x92, 0x41, 0xc3, 0xe4, 0xea,
+    0x0f, 0x92, 0x29, 0xc3, 0xe4, 0x9f, 0x0f, 0x92, 0x00, 0xc3, 0xe4, 0xff,
+    0x0f, 0x92, 0x39, 0xc3, 0xe5, 0x14, 0x0f, 0x92, 0x18, 0xc3, 0xe4, 0xc6,
+    0x0f, 0x92, 0x31, 0xc3, 0xe5, 0x17, 0x0f, 0x92, 0x20, 0xd8, 0x0b, 0x71,
+    0x01, 0x3c, 0xe9, 0x46, 0x00, 0x91, 0x41, 0x48, 0x52, 0xc6, 0x19, 0xc4,
+    0x01, 0x01, 0x19, 0xc5, 0xcb, 0xcd, 0x0f, 0xa6, 0x81, 0xcc, 0x8b, 0x44,
+    0x0f, 0xb5, 0x48, 0xc4, 0x01, 0xd9, 0x01, 0x31, 0xa9, 0xc3, 0x02, 0x56,
+    0x01, 0x31, 0xa0, 0xcf, 0x05, 0x7a, 0x01, 0x15, 0x51, 0xc9, 0x32, 0xf8,
+    0x01, 0x4c, 0x01, 0xcf, 0x2a, 0x19, 0x01, 0x57, 0xa1, 0xd6, 0x2e, 0x40,
+    0x01, 0x57, 0xa8, 0xc4, 0x16, 0x42, 0x01, 0x01, 0xa1, 0xc3, 0x23, 0xe0,
+    0x01, 0x4f, 0xd8, 0xd6, 0x2d, 0xd2, 0x01, 0x53, 0x41, 0xd6, 0x30, 0x0e,
+    0x01, 0x53, 0x48, 0xc9, 0x02, 0xa0, 0x01, 0x57, 0xb9, 0xcc, 0x06, 0x09,
+    0x01, 0x57, 0xc0, 0xc5, 0xc2, 0x71, 0x0f, 0x9b, 0xc9, 0xc4, 0x56, 0xb4,
+    0x0f, 0xa1, 0x00, 0xc7, 0xc6, 0x51, 0x0e, 0x9a, 0xb1, 0xc7, 0xb9, 0x41,
+    0x0e, 0x98, 0xc0, 0xc4, 0x1f, 0x53, 0x0e, 0x99, 0x59, 0xc7, 0x00, 0x7b,
+    0x0e, 0x98, 0x38, 0xc7, 0xc3, 0x48, 0x0e, 0x9a, 0xa9, 0xca, 0xa1, 0x78,
+    0x0e, 0x99, 0x68, 0xca, 0xa6, 0x46, 0x0e, 0x9a, 0xa1, 0x0f, 0xc1, 0x48,
+    0x6a, 0xc8, 0xb9, 0x98, 0x0e, 0x98, 0x80, 0xc7, 0xa8, 0x5e, 0x0e, 0x9a,
+    0x39, 0xca, 0xa7, 0x2c, 0x0e, 0x99, 0x11, 0xd9, 0x1f, 0x4c, 0x0e, 0x98,
+    0x78, 0x43, 0x5b, 0x2a, 0xc1, 0x48, 0x76, 0x10, 0x41, 0x48, 0x82, 0xc3,
+    0x13, 0xb2, 0x0e, 0x9a, 0x79, 0x07, 0x41, 0x48, 0x8c, 0x11, 0xc1, 0x48,
+    0x98, 0xc6, 0xce, 0x6c, 0x0e, 0x99, 0x48, 0xc9, 0xae, 0xa7, 0x0e, 0x99,
+    0x99, 0xc8, 0xbe, 0x40, 0x0e, 0x99, 0x81, 0xc7, 0xc9, 0xd1, 0x0e, 0x98,
+    0xf8, 0xc3, 0x02, 0x55, 0x0e, 0x99, 0xf8, 0x15, 0xc1, 0x48, 0xa4, 0xc5,
+    0xdb, 0xed, 0x0e, 0x98, 0xd1, 0xc3, 0x29, 0xfd, 0x0e, 0x98, 0xa0, 0xc5,
+    0x1e, 0x51, 0x0e, 0x99, 0xa1, 0xc5, 0x59, 0xa5, 0x0e, 0x99, 0x20, 0xd7,
+    0x27, 0x03, 0x01, 0x3d, 0xd1, 0xcf, 0x17, 0x39, 0x01, 0x39, 0xd8, 0xcd,
+    0x77, 0x75, 0x01, 0x38, 0x31, 0x43, 0x04, 0x7d, 0xc1, 0x48, 0xae, 0xc4,
+    0x00, 0x8d, 0x01, 0x09, 0x09, 0xcf, 0x65, 0xcf, 0x0f, 0xac, 0x00, 0x05,
+    0xc1, 0x48, 0xbd, 0x03, 0xc1, 0x48, 0xc9, 0x42, 0x06, 0xb4, 0xc1, 0x48,
+    0xd5, 0xc5, 0x34, 0xd9, 0x00, 0x61, 0xe1, 0xc7, 0xc8, 0xf1, 0x00, 0x63,
+    0xb9, 0xc5, 0xd5, 0x30, 0x00, 0x63, 0xf8, 0x45, 0x01, 0x94, 0xc1, 0x48,
+    0xe1, 0xc9, 0x35, 0x6e, 0x00, 0x62, 0xa8, 0x03, 0xc1, 0x49, 0x4a, 0x8b,
+    0x00, 0x61, 0xfb, 0x01, 0x49, 0x56, 0x97, 0x00, 0x62, 0x0b, 0x01, 0x49,
+    0x5a, 0x48, 0xaa, 0xd2, 0xc1, 0x49, 0x5e, 0x87, 0x00, 0x62, 0x33, 0x01,
+    0x49, 0x6c, 0x91, 0x00, 0x62, 0x52, 0x01, 0x49, 0x70, 0xc4, 0x18, 0xa7,
+    0x00, 0x63, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x63, 0x39, 0x16, 0xc1, 0x49,
+    0x74, 0x08, 0xc1, 0x49, 0x80, 0x15, 0xc1, 0x49, 0x8c, 0xc5, 0x0a, 0xfd,
+    0x00, 0x63, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x63, 0x78, 0xdb, 0x18, 0xa7,
+    0x00, 0x63, 0xc1, 0x48, 0xb6, 0x08, 0xc1, 0x49, 0x98, 0x16, 0x41, 0x49,
+    0xa4, 0x01, 0x41, 0x49, 0xb0, 0xca, 0xa6, 0x82, 0x01, 0x70, 0xd9, 0x44,
+    0x05, 0x1a, 0x41, 0x49, 0xbc, 0xc4, 0x28, 0x74, 0x08, 0xa6, 0xc9, 0xc5,
+    0x0a, 0xfd, 0x08, 0xa6, 0xc1, 0x15, 0xc1, 0x49, 0xc8, 0x08, 0xc1, 0x49,
+    0xd4, 0x16, 0xc1, 0x49, 0xe0, 0xc3, 0x05, 0x16, 0x08, 0xa6, 0x89, 0xc4,
+    0x18, 0xa7, 0x08, 0xa6, 0x80, 0xd0, 0x4f, 0x8d, 0x08, 0xa6, 0x31, 0xc3,
+    0x7a, 0x77, 0x08, 0xa4, 0x00, 0x03, 0xc1, 0x49, 0xec, 0xc5, 0x34, 0xd9,
+    0x08, 0xa6, 0x19, 0xcb, 0x1f, 0xe9, 0x08, 0xa5, 0xf9, 0x42, 0x06, 0xb4,
+    0x41, 0x49, 0xf8, 0x03, 0xc1, 0x4a, 0x04, 0x46, 0x2c, 0x9e, 0xc1, 0x4a,
+    0x10, 0x91, 0x08, 0xa5, 0xe1, 0x87, 0x08, 0xa5, 0xc9, 0x48, 0xaa, 0xd2,
+    0xc1, 0x4a, 0x18, 0x97, 0x08, 0xa5, 0x9b, 0x01, 0x4a, 0x26, 0x8b, 0x08,
+    0xa5, 0x8a, 0x01, 0x4a, 0x2a, 0xc2, 0x00, 0xce, 0x08, 0xa5, 0x79, 0x15,
+    0xc1, 0x4a, 0x2e, 0x18, 0xc1, 0x4a, 0x3e, 0xc2, 0x00, 0x89, 0x08, 0xa5,
+    0x51, 0xc2, 0x00, 0x3b, 0x08, 0xa5, 0x49, 0xc2, 0x1a, 0x18, 0x08, 0xa5,
+    0x41, 0xc2, 0x00, 0xb6, 0x08, 0xa5, 0x39, 0x04, 0xc1, 0x4a, 0x48, 0x12,
+    0xc1, 0x4a, 0x52, 0x10, 0xc1, 0x4a, 0x5c, 0x06, 0xc1, 0x4a, 0x72, 0x16,
+    0xc1, 0x4a, 0x80, 0x0c, 0xc1, 0x4a, 0x8e, 0x05, 0xc1, 0x4a, 0x98, 0x09,
+    0xc1, 0x4a, 0xa2, 0x0d, 0xc1, 0x4a, 0xac, 0x83, 0x08, 0xa4, 0x0b, 0x01,
+    0x4a, 0xb6, 0x91, 0x08, 0xa4, 0x69, 0x87, 0x08, 0xa4, 0x59, 0x97, 0x08,
+    0xa4, 0x2b, 0x01, 0x4a, 0xc2, 0x8b, 0x08, 0xa4, 0x1a, 0x01, 0x4a, 0xc6,
+    0xc9, 0xaa, 0x78, 0x00, 0x78, 0x01, 0x45, 0x12, 0x2f, 0x41, 0x4a, 0xca,
+    0x14, 0xc1, 0x4a, 0xe6, 0x42, 0x1a, 0x18, 0xc1, 0x4a, 0xf8, 0x0f, 0xc1,
+    0x4b, 0x04, 0xce, 0x6f, 0xc2, 0x00, 0x7c, 0x11, 0xc8, 0xb5, 0x98, 0x00,
+    0x7c, 0x19, 0x42, 0x1a, 0xe7, 0xc1, 0x4b, 0x10, 0x44, 0xe0, 0xf8, 0xc1,
+    0x4b, 0x1c, 0xd1, 0x51, 0x8a, 0x00, 0x7c, 0x60, 0x45, 0x00, 0x8d, 0xc1,
+    0x4b, 0x28, 0x47, 0x01, 0x92, 0x41, 0x4b, 0x3a, 0x44, 0x01, 0x95, 0xc1,
+    0x4b, 0x9c, 0x4b, 0x96, 0xb2, 0x41, 0x4b, 0xa8, 0x46, 0x11, 0x2c, 0xc1,
+    0x4b, 0xb4, 0xd1, 0x53, 0xbb, 0x00, 0x78, 0x58, 0x47, 0x91, 0x48, 0xc1,
+    0x4b, 0xc0, 0x45, 0x97, 0x84, 0xc1, 0x4b, 0xcc, 0xc6, 0xd2, 0xd4, 0x00,
+    0x79, 0xc0, 0xc9, 0xb1, 0x41, 0x00, 0x78, 0x41, 0xc3, 0x02, 0xeb, 0x00,
+    0x78, 0x68, 0x15, 0xc1, 0x4b, 0xd8, 0x49, 0xaf, 0x40, 0x41, 0x4b, 0xe2,
+    0x44, 0x8e, 0x26, 0xc1, 0x4b, 0xee, 0x4a, 0x9d, 0x36, 0x41, 0x4b, 0xfd,
+    0x15, 0xc1, 0x4c, 0x09, 0xd3, 0x41, 0x14, 0x00, 0x7e, 0xd0, 0xd3, 0x43,
+    0x61, 0x00, 0x78, 0x89, 0xcd, 0x7c, 0xbd, 0x00, 0x78, 0x90, 0xc2, 0x00,
+    0x47, 0x00, 0x79, 0xe1, 0xc2, 0x00, 0xa6, 0x00, 0x79, 0xe8, 0xca, 0x9c,
+    0xd2, 0x00, 0x78, 0xa9, 0xca, 0xa5, 0xba, 0x00, 0x78, 0xb0, 0x0d, 0xc1,
+    0x4c, 0x15, 0x09, 0xc1, 0x4c, 0x2b, 0x10, 0xc1, 0x4c, 0x35, 0x05, 0xc1,
+    0x4c, 0x4b, 0xc2, 0x21, 0x7d, 0x00, 0x7a, 0x39, 0x16, 0xc1, 0x4c, 0x55,
+    0x06, 0xc1, 0x4c, 0x67, 0x12, 0xc1, 0x4c, 0x79, 0x04, 0xc1, 0x4c, 0x83,
+    0xc2, 0x00, 0xb6, 0x00, 0x7a, 0xc1, 0xc2, 0x00, 0x71, 0x00, 0x7a, 0xe9,
+    0x1c, 0xc1, 0x4c, 0x8d, 0xc2, 0x1e, 0x12, 0x00, 0x7b, 0x01, 0xc2, 0x1a,
+    0x18, 0x00, 0x7b, 0x09, 0x14, 0xc1, 0x4c, 0x97, 0xc2, 0x00, 0x89, 0x00,
+    0x7b, 0x19, 0x15, 0xc1, 0x4c, 0xa1, 0xc2, 0x00, 0xce, 0x00, 0x7b, 0x39,
+    0x83, 0x00, 0x7b, 0x41, 0xcd, 0x79, 0x56, 0x00, 0x7b, 0x50, 0xd4, 0x38,
+    0xba, 0x00, 0x78, 0xb9, 0xcb, 0x94, 0xce, 0x00, 0x78, 0xc8, 0xc2, 0x01,
+    0xa2, 0x00, 0x79, 0x11, 0xc4, 0x03, 0xe0, 0x00, 0x79, 0x18, 0xc3, 0x04,
+    0xa0, 0x00, 0x79, 0x21, 0xc3, 0x0c, 0xf7, 0x00, 0x79, 0x28, 0xc2, 0x24,
+    0x36, 0x00, 0x79, 0x31, 0xc4, 0x17, 0xf7, 0x00, 0x79, 0x38, 0xc3, 0x05,
+    0x16, 0x00, 0x79, 0x51, 0x16, 0xc1, 0x4c, 0xb1, 0x08, 0xc1, 0x4c, 0xbd,
+    0x15, 0xc1, 0x4c, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0x79, 0x89, 0xc4, 0x28,
+    0x74, 0x00, 0x79, 0x91, 0xc4, 0x18, 0xa7, 0x00, 0x79, 0x98, 0x8b, 0x00,
+    0x7b, 0x98, 0x97, 0x00, 0x7b, 0xa8, 0x94, 0x00, 0x7b, 0xb3, 0x01, 0x4c,
+    0xd5, 0x8e, 0x00, 0x7b, 0xc2, 0x01, 0x4c, 0xd9, 0x87, 0x00, 0x7b, 0xd8,
+    0x91, 0x00, 0x7b, 0xe8, 0x8b, 0x00, 0x7c, 0x08, 0x83, 0x01, 0x69, 0x83,
+    0x01, 0x4c, 0xdd, 0x87, 0x01, 0x6b, 0x33, 0x01, 0x4d, 0x4e, 0x8b, 0x01,
+    0x6a, 0x49, 0x97, 0x01, 0x6a, 0x99, 0x91, 0x01, 0x6b, 0x38, 0x8c, 0x01,
+    0x69, 0xa9, 0x8a, 0x01, 0x6a, 0x08, 0x48, 0xbe, 0x00, 0xc1, 0x4d, 0x52,
+    0xcd, 0x80, 0x0a, 0x01, 0x6b, 0x20, 0xcb, 0x8d, 0x12, 0x01, 0x6a, 0x59,
+    0xc8, 0xbe, 0x98, 0x01, 0x6a, 0xc0, 0x01, 0xc1, 0x4d, 0x71, 0xda, 0x05,
+    0x0f, 0x01, 0x71, 0x50, 0xcb, 0x93, 0x4d, 0x01, 0x50, 0x41, 0xcc, 0x84,
+    0x90, 0x01, 0x50, 0x38, 0xc3, 0x00, 0x6b, 0x01, 0x52, 0xa9, 0xc2, 0x00,
+    0x4b, 0x01, 0x52, 0xb0, 0xc2, 0x01, 0xa2, 0x0f, 0xdf, 0x91, 0xc4, 0x03,
+    0xe0, 0x0f, 0xdf, 0x98, 0xc3, 0x04, 0xa0, 0x0f, 0xdf, 0xa1, 0xc3, 0x0c,
+    0xf7, 0x0f, 0xdf, 0xa8, 0xc2, 0x24, 0x36, 0x0f, 0xdf, 0xb1, 0xc4, 0x17,
+    0xf7, 0x0f, 0xdf, 0xb8, 0x11, 0xc1, 0x4d, 0x7d, 0xcc, 0x84, 0x48, 0x01,
+    0x31, 0x51, 0xc6, 0x0f, 0xaf, 0x01, 0x12, 0xd9, 0x45, 0x00, 0x92, 0x41,
+    0x4d, 0x89, 0xc7, 0xc0, 0x7e, 0x00, 0x00, 0x09, 0xc4, 0x26, 0xff, 0x00,
+    0x00, 0x11, 0x15, 0xc1, 0x4d, 0x95, 0xce, 0x72, 0xee, 0x00, 0x04, 0xb1,
+    0xcc, 0x89, 0x28, 0x00, 0x04, 0xb0, 0xc4, 0x1f, 0x53, 0x01, 0x1f, 0x21,
+    0xc6, 0xcb, 0xcc, 0x0f, 0xa6, 0x78, 0xcb, 0x96, 0x44, 0x0f, 0xde, 0x31,
+    0xc5, 0x25, 0x04, 0x0f, 0xde, 0x48, 0xc4, 0x00, 0x2f, 0x0f, 0xde, 0x39,
+    0xc5, 0x00, 0x64, 0x0f, 0xde, 0x40, 0x45, 0x04, 0x9a, 0xc1, 0x4d, 0xa1,
+    0xcb, 0x8c, 0xe6, 0x05, 0x46, 0x79, 0xc4, 0x19, 0xf1, 0x05, 0x46, 0x70,
+    0xcb, 0x1f, 0xe9, 0x05, 0x46, 0x29, 0x42, 0x06, 0xb4, 0xc1, 0x4d, 0xc5,
+    0xc8, 0x14, 0x02, 0x05, 0x44, 0x00, 0x03, 0xc1, 0x4d, 0xd1, 0x91, 0x05,
+    0x46, 0x0b, 0x01, 0x4d, 0xdd, 0x87, 0x05, 0x45, 0xf3, 0x01, 0x4d, 0xe1,
+    0x48, 0xaa, 0xd2, 0xc1, 0x4d, 0xe5, 0x97, 0x05, 0x45, 0xc3, 0x01, 0x4d,
+    0xf3, 0x8b, 0x05, 0x45, 0xb2, 0x01, 0x4d, 0xf7, 0x0e, 0xc1, 0x4d, 0xfb,
+    0xc2, 0x00, 0xce, 0x05, 0x45, 0x91, 0x15, 0xc1, 0x4e, 0x05, 0x18, 0xc1,
+    0x4e, 0x15, 0xc2, 0x00, 0x3b, 0x05, 0x45, 0x61, 0xc2, 0x1a, 0x18, 0x05,
+    0x45, 0x59, 0xc2, 0x00, 0xb6, 0x05, 0x45, 0x51, 0x04, 0xc1, 0x4e, 0x1f,
+    0x12, 0xc1, 0x4e, 0x29, 0x10, 0xc1, 0x4e, 0x33, 0x06, 0xc1, 0x4e, 0x49,
+    0x16, 0xc1, 0x4e, 0x57, 0x0c, 0xc1, 0x4e, 0x65, 0x91, 0x05, 0x44, 0x7b,
+    0x01, 0x4e, 0x6f, 0x83, 0x05, 0x44, 0x13, 0x01, 0x4e, 0x73, 0x0d, 0xc1,
+    0x4e, 0x7f, 0x09, 0xc1, 0x4e, 0x89, 0x05, 0xc1, 0x4e, 0x93, 0x8b, 0x05,
+    0x44, 0x23, 0x01, 0x4e, 0x9d, 0x97, 0x05, 0x44, 0x33, 0x01, 0x4e, 0xa1,
+    0x87, 0x05, 0x44, 0x62, 0x01, 0x4e, 0xa5, 0x47, 0x03, 0x7a, 0xc1, 0x4e,
+    0xa9, 0x48, 0xba, 0xa8, 0x41, 0x4e, 0xb5, 0x10, 0xc1, 0x4e, 0xbb, 0xc6,
+    0xca, 0x76, 0x00, 0x41, 0xe1, 0xc5, 0xd6, 0x20, 0x00, 0x41, 0xa1, 0xc5,
+    0xdd, 0x55, 0x00, 0x41, 0x88, 0xcb, 0x8d, 0xe3, 0x00, 0x41, 0xe9, 0xc9,
+    0xa8, 0xad, 0x00, 0x41, 0xa8, 0xc3, 0xe5, 0x41, 0x00, 0x41, 0xd1, 0xc4,
+    0xdf, 0x34, 0x00, 0x41, 0xc0, 0xc7, 0xc3, 0xf0, 0x00, 0x41, 0x69, 0xce,
+    0x6f, 0x44, 0x00, 0x40, 0xd9, 0xc6, 0x62, 0x96, 0x00, 0x40, 0xc9, 0xc9,
+    0xb2, 0x73, 0x00, 0x40, 0xc1, 0xc2, 0x00, 0xaf, 0x00, 0x40, 0xb2, 0x01,
+    0x4e, 0xc7, 0x8b, 0x00, 0x41, 0x41, 0xc7, 0xc1, 0x50, 0x00, 0x41, 0x21,
+    0xce, 0x6f, 0x44, 0x00, 0x40, 0xd0, 0xc4, 0xdd, 0xba, 0x00, 0x41, 0x61,
+    0xc6, 0xc1, 0x51, 0x00, 0x41, 0x28, 0xc9, 0xa8, 0xf5, 0x00, 0x41, 0x0a,
+    0x01, 0x4e, 0xcd, 0x8b, 0x00, 0x41, 0x49, 0x97, 0x00, 0x41, 0x31, 0x83,
+    0x00, 0x41, 0x13, 0x01, 0x4e, 0xd1, 0x87, 0x00, 0x40, 0xe0, 0x83, 0x00,
+    0x41, 0x00, 0xc3, 0xb5, 0xc2, 0x00, 0x40, 0xa9, 0xc6, 0xcb, 0x84, 0x00,
+    0x40, 0x89, 0xc2, 0x00, 0x93, 0x00, 0x40, 0x40, 0xc3, 0x00, 0xce, 0x00,
+    0x40, 0xa1, 0xc6, 0xcc, 0x14, 0x00, 0x40, 0x70, 0x90, 0x00, 0x40, 0x79,
+    0x96, 0x00, 0x40, 0x39, 0x9b, 0x00, 0x40, 0x20, 0xc2, 0x12, 0x99, 0x00,
+    0x40, 0x29, 0xc2, 0x00, 0x93, 0x00, 0x40, 0x08, 0xc2, 0x00, 0x4b, 0x01,
+    0x52, 0xb9, 0xc3, 0x00, 0x6b, 0x01, 0x52, 0xc0, 0xc6, 0x07, 0xf3, 0x0f,
+    0xa5, 0x21, 0xc4, 0x07, 0xe9, 0x0f, 0xb1, 0xa1, 0xcd, 0x76, 0x8b, 0x0f,
+    0xb6, 0x60, 0xc9, 0x02, 0xa0, 0x01, 0x54, 0xab, 0x01, 0x4e, 0xd5, 0xcc,
+    0x06, 0x09, 0x01, 0x54, 0xb2, 0x01, 0x4e, 0xdb, 0xc9, 0xb0, 0x84, 0x01,
+    0x5a, 0xd1, 0xcd, 0x7a, 0x9b, 0x01, 0x5a, 0xe0, 0x15, 0xc1, 0x4e, 0xe1,
+    0xd1, 0x55, 0x75, 0x08, 0x8e, 0xe9, 0xca, 0x9e, 0x80, 0x08, 0x8e, 0xe1,
+    0x07, 0xc1, 0x4e, 0xf7, 0x06, 0xc1, 0x4f, 0x03, 0x46, 0x35, 0x43, 0xc1,
+    0x4f, 0x15, 0xd1, 0x4f, 0x8c, 0x08, 0x8e, 0x39, 0xc2, 0x04, 0x0d, 0x08,
+    0x8e, 0x21, 0x47, 0x01, 0x92, 0x41, 0x4f, 0x21, 0xc4, 0xe3, 0x1c, 0x08,
+    0x22, 0x81, 0x16, 0xc1, 0x4f, 0x86, 0xc4, 0xe0, 0x48, 0x08, 0x22, 0x91,
+    0xc3, 0x1b, 0x3b, 0x08, 0x22, 0x99, 0x15, 0xc1, 0x4f, 0x90, 0xc6, 0xcc,
+    0xbc, 0x08, 0x22, 0xb9, 0x42, 0x0d, 0x1e, 0xc1, 0x4f, 0x9a, 0x0a, 0xc1,
+    0x4f, 0xa2, 0xc3, 0xe4, 0x78, 0x08, 0x22, 0xd1, 0xc4, 0xe0, 0xb4, 0x08,
+    0x22, 0xd9, 0xc3, 0x75, 0x92, 0x08, 0x22, 0xe1, 0xc3, 0x35, 0x43, 0x08,
+    0x22, 0xe9, 0xc3, 0xe2, 0xfa, 0x08, 0x22, 0xf9, 0x0f, 0xc1, 0x4f, 0xae,
+    0xc5, 0xda, 0x4e, 0x08, 0x23, 0x09, 0x42, 0x01, 0xa2, 0xc1, 0x4f, 0xba,
+    0xc4, 0xe3, 0xfc, 0x08, 0x23, 0x21, 0x0b, 0xc1, 0x4f, 0xc4, 0x07, 0xc1,
+    0x4f, 0xd4, 0x03, 0xc1, 0x4f, 0xe4, 0x11, 0xc1, 0x50, 0x0a, 0xc4, 0xde,
+    0xcc, 0x08, 0x23, 0x71, 0xc3, 0x20, 0xb0, 0x08, 0x23, 0x79, 0xc2, 0x00,
+    0x6f, 0x08, 0x23, 0x98, 0xc7, 0xc8, 0x3b, 0x0d, 0xe5, 0x19, 0xc9, 0xb0,
+    0x57, 0x0d, 0xe5, 0x11, 0xd2, 0x48, 0x91, 0x0d, 0xe5, 0x09, 0xce, 0x6c,
+    0xb2, 0x0d, 0xe5, 0x00, 0x46, 0x02, 0xf9, 0xc1, 0x50, 0x2a, 0xc9, 0xa8,
+    0x9b, 0x01, 0x56, 0xf1, 0xc9, 0x32, 0xb9, 0x01, 0x56, 0xfb, 0x01, 0x50,
+    0x30, 0xc7, 0xc8, 0x26, 0x01, 0x57, 0x03, 0x01, 0x50, 0x36, 0xd3, 0x41,
+    0xbf, 0x01, 0x5a, 0x71, 0x04, 0x41, 0x50, 0x3a, 0x91, 0x01, 0x09, 0xa1,
+    0x87, 0x01, 0x09, 0x79, 0x8e, 0x01, 0x08, 0x99, 0x89, 0x01, 0x08, 0x50,
+    0x8f, 0x01, 0x09, 0x99, 0x88, 0x01, 0x09, 0x89, 0x87, 0x01, 0x09, 0x81,
+    0x84, 0x01, 0x09, 0x61, 0x94, 0x01, 0x08, 0xd9, 0x92, 0x01, 0x08, 0xc1,
+    0x8e, 0x01, 0x08, 0x91, 0x8b, 0x01, 0x08, 0x81, 0x8a, 0x01, 0x08, 0x58,
+    0xd0, 0x5b, 0xf2, 0x0f, 0xc2, 0xb9, 0xcc, 0x84, 0x84, 0x01, 0x0e, 0xc9,
+    0xc5, 0x00, 0x83, 0x01, 0x0c, 0xcb, 0x01, 0x50, 0x46, 0xcb, 0x03, 0x3e,
+    0x01, 0x58, 0x19, 0xcb, 0x94, 0xc3, 0x01, 0x58, 0x59, 0xd5, 0x02, 0xb4,
+    0x01, 0x5b, 0x4b, 0x01, 0x50, 0x4a, 0x49, 0x01, 0x4c, 0x41, 0x50, 0x50,
+    0xd0, 0x5b, 0xf2, 0x0f, 0xc2, 0xb1, 0xc5, 0x00, 0x83, 0x01, 0x0c, 0xc3,
+    0x01, 0x50, 0x62, 0xcc, 0x84, 0x84, 0x01, 0x0e, 0xc1, 0xcb, 0x03, 0x3e,
+    0x01, 0x58, 0x11, 0xcb, 0x94, 0xc3, 0x01, 0x58, 0x51, 0xd5, 0x02, 0xb4,
+    0x01, 0x5b, 0x43, 0x01, 0x50, 0x66, 0x49, 0x01, 0x4c, 0x41, 0x50, 0x6c,
+    0xc5, 0x82, 0x7b, 0x08, 0xd4, 0xf9, 0xcc, 0x82, 0x74, 0x08, 0xd4, 0xf0,
+    0xc7, 0x40, 0xae, 0x08, 0xd4, 0xb9, 0xc8, 0x14, 0x02, 0x08, 0xd4, 0xb1,
+    0xcb, 0x98, 0x33, 0x08, 0xd4, 0x29, 0xcb, 0x92, 0xf5, 0x08, 0xd4, 0x20,
+    0x8a, 0x08, 0xd4, 0x98, 0x89, 0x08, 0xd4, 0x60, 0x83, 0x08, 0xd4, 0x49,
+    0xc2, 0x00, 0xce, 0x08, 0xd4, 0x40, 0xc3, 0x1b, 0xb1, 0x08, 0xd4, 0x19,
+    0xc2, 0x00, 0xce, 0x08, 0xd2, 0xe9, 0x83, 0x08, 0xd2, 0xe0, 0x83, 0x08,
+    0xd4, 0x09, 0xc2, 0x0d, 0x01, 0x08, 0xd4, 0x01, 0xc2, 0x00, 0xce, 0x08,
+    0xd3, 0xf8, 0x83, 0x08, 0xd3, 0xc9, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0xc0,
+    0xc2, 0x01, 0x16, 0x08, 0xd3, 0xb9, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0x71,
+    0x83, 0x08, 0xd3, 0x69, 0x06, 0x41, 0x50, 0x7e, 0x15, 0xc1, 0x50, 0x88,
+    0xc2, 0x00, 0xce, 0x08, 0xd3, 0x61, 0x83, 0x08, 0xd3, 0x59, 0x16, 0x41,
+    0x50, 0x92, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0x99, 0x83, 0x08, 0xd3, 0x90,
+    0xc2, 0x00, 0xce, 0x08, 0xd3, 0x89, 0x83, 0x08, 0xd3, 0x80, 0x83, 0x08,
+    0xd3, 0x79, 0xc2, 0x03, 0x83, 0x08, 0xd3, 0x51, 0xc2, 0x1a, 0x18, 0x08,
+    0xd3, 0x29, 0xc2, 0x00, 0xeb, 0x08, 0xd3, 0x00, 0xc2, 0x00, 0xce, 0x08,
+    0xd3, 0x21, 0x83, 0x08, 0xd3, 0x18, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0x11,
+    0x83, 0x08, 0xd3, 0x08, 0xc2, 0x00, 0xce, 0x08, 0xd2, 0xf9, 0x83, 0x08,
+    0xd2, 0xf0, 0x48, 0xaa, 0xd2, 0xc1, 0x50, 0x9c, 0x03, 0xc1, 0x50, 0xa4,
+    0x91, 0x08, 0xd2, 0xab, 0x01, 0x50, 0xac, 0x87, 0x08, 0xd2, 0xa1, 0x97,
+    0x08, 0xd2, 0x9b, 0x01, 0x50, 0xb0, 0x8b, 0x08, 0xd2, 0x88, 0xc4, 0x17,
+    0xf7, 0x08, 0x87, 0xb9, 0xc2, 0x24, 0x36, 0x08, 0x87, 0xb0, 0xc3, 0x0c,
+    0xf7, 0x08, 0x87, 0xa9, 0xc3, 0x04, 0xa0, 0x08, 0x87, 0xa0, 0xc4, 0x03,
+    0xe0, 0x08, 0x87, 0x99, 0xc2, 0x01, 0xa2, 0x08, 0x87, 0x90, 0x87, 0x08,
+    0x87, 0x41, 0x8a, 0x08, 0x86, 0xb0, 0x8a, 0x08, 0x87, 0x39, 0xc2, 0x07,
+    0x28, 0x08, 0x87, 0x18, 0xc3, 0x40, 0x1a, 0x08, 0x87, 0x09, 0xc2, 0x01,
+    0x9a, 0x08, 0x86, 0xc9, 0xc3, 0x93, 0xae, 0x08, 0x86, 0xb8, 0xd1, 0x52,
+    0x34, 0x08, 0x7a, 0xc1, 0xcd, 0x76, 0xa5, 0x08, 0x7a, 0xaa, 0x01, 0x50,
+    0xb4, 0xc8, 0x0c, 0xe6, 0x08, 0x7a, 0xa0, 0xc5, 0x26, 0x6c, 0x08, 0x7a,
+    0x99, 0xc2, 0x00, 0x79, 0x08, 0x7a, 0x90, 0xc5, 0x01, 0x24, 0x08, 0x7a,
+    0x69, 0xc5, 0x00, 0xd2, 0x08, 0x7a, 0x60, 0xc5, 0x01, 0x24, 0x08, 0x7a,
+    0x59, 0xc5, 0x00, 0xd2, 0x08, 0x7a, 0x50, 0xc5, 0x00, 0xd2, 0x08, 0x7a,
+    0x49, 0xc5, 0x01, 0x24, 0x08, 0x7a, 0x38, 0xc5, 0x00, 0xd2, 0x08, 0x7a,
+    0x41, 0xc5, 0x01, 0x24, 0x08, 0x7a, 0x30, 0xc3, 0x22, 0xeb, 0x08, 0x7a,
+    0x21, 0xc5, 0xd0, 0xf5, 0x08, 0x79, 0xc8, 0xc3, 0x11, 0x9a, 0x08, 0x7a,
+    0x09, 0x03, 0x41, 0x50, 0xba, 0xc3, 0x16, 0xc8, 0x08, 0x79, 0xe9, 0xc4,
+    0x35, 0x13, 0x08, 0x79, 0x80, 0xc2, 0x00, 0x60, 0x08, 0x79, 0xb0, 0x16,
+    0xc1, 0x50, 0xc6, 0x08, 0xc1, 0x50, 0xd8, 0x19, 0xc1, 0x50, 0xe0, 0x0e,
+    0xc1, 0x50, 0xf0, 0x11, 0xc1, 0x51, 0x06, 0x0b, 0xc1, 0x51, 0x1f, 0x05,
+    0xc1, 0x51, 0x33, 0x14, 0xc1, 0x51, 0x59, 0x0a, 0xc1, 0x51, 0x74, 0x06,
+    0xc1, 0x51, 0x9c, 0x12, 0xc1, 0x51, 0xc2, 0x07, 0xc1, 0x51, 0xfb, 0x03,
+    0xc1, 0x52, 0x0f, 0xc3, 0xde, 0xfc, 0x01, 0x98, 0x31, 0x0d, 0xc1, 0x52,
+    0x35, 0x09, 0xc1, 0x52, 0x96, 0x15, 0xc1, 0x52, 0xbb, 0x10, 0xc1, 0x52,
+    0xd3, 0x04, 0xc1, 0x52, 0xf4, 0x0f, 0xc1, 0x53, 0x14, 0x1b, 0xc1, 0x53,
+    0x67, 0xc8, 0xb8, 0x78, 0x01, 0x9e, 0xf0, 0x0e, 0xc1, 0x53, 0x73, 0x15,
+    0xc1, 0x53, 0x7d, 0x0d, 0xc1, 0x53, 0xad, 0xcc, 0x84, 0x00, 0x01, 0x15,
+    0x09, 0x16, 0xc1, 0x53, 0xb9, 0x0f, 0xc1, 0x53, 0xc9, 0x12, 0xc1, 0x53,
+    0xd3, 0x05, 0xc1, 0x53, 0xdf, 0x18, 0xc1, 0x53, 0xef, 0x17, 0xc1, 0x53,
+    0xf9, 0x0a, 0xc1, 0x54, 0x05, 0x11, 0xc1, 0x54, 0x19, 0x08, 0xc1, 0x54,
+    0x23, 0xc7, 0xbf, 0xa5, 0x0f, 0x8c, 0xf9, 0x10, 0xc1, 0x54, 0x3b, 0xc2,
+    0x00, 0x9d, 0x0f, 0x8c, 0xa1, 0xc2, 0x17, 0xce, 0x0f, 0x8a, 0x79, 0xc8,
+    0x09, 0x81, 0x01, 0x4e, 0x31, 0xd5, 0x33, 0xbe, 0x01, 0x4e, 0x20, 0xc9,
+    0xab, 0x3e, 0x01, 0x20, 0xd3, 0x01, 0x54, 0x45, 0xc4, 0x40, 0x52, 0x01,
+    0x21, 0x01, 0xcf, 0x65, 0x57, 0x01, 0x20, 0xb1, 0x45, 0x9b, 0x47, 0xc1,
+    0x54, 0x4b, 0x48, 0x40, 0x56, 0xc1, 0x54, 0x57, 0xcf, 0x6a, 0xca, 0x01,
+    0x0a, 0x78, 0x07, 0xc1, 0x54, 0x63, 0xcf, 0x62, 0x78, 0x01, 0x20, 0x80,
+    0x07, 0xc1, 0x54, 0x72, 0xc3, 0x11, 0xa2, 0x01, 0x20, 0x00, 0xcd, 0x7d,
+    0xce, 0x01, 0x20, 0xe1, 0xc8, 0xb7, 0x60, 0x01, 0x20, 0x60, 0xc5, 0x62,
+    0x82, 0x01, 0x20, 0xd9, 0x10, 0x41, 0x54, 0x7e, 0xc4, 0x23, 0x3c, 0x01,
+    0x20, 0xc1, 0xcd, 0x80, 0x24, 0x01, 0x20, 0x68, 0xc8, 0xb6, 0x20, 0x01,
+    0x20, 0x41, 0xc3, 0x06, 0xf5, 0x01, 0x20, 0x38, 0x0f, 0xc1, 0x54, 0x8a,
+    0x16, 0xc1, 0x54, 0x96, 0xc2, 0x00, 0x61, 0x00, 0x38, 0xbb, 0x01, 0x54,
+    0xa5, 0xc4, 0x6b, 0x15, 0x00, 0x38, 0xc9, 0xc3, 0x76, 0xe6, 0x00, 0x38,
+    0xc1, 0x06, 0xc1, 0x54, 0xab, 0xc5, 0xdc, 0xb0, 0x00, 0x38, 0x9b, 0x01,
+    0x54, 0xb7, 0xc4, 0xe0, 0x9c, 0x00, 0x38, 0x91, 0x15, 0xc1, 0x54, 0xbd,
+    0xc5, 0x59, 0xbd, 0x00, 0x38, 0x81, 0xc2, 0x00, 0x78, 0x00, 0x39, 0x33,
+    0x01, 0x54, 0xdb, 0x14, 0xc1, 0x54, 0xe1, 0xc4, 0xc3, 0x9d, 0x00, 0x39,
+    0x49, 0xc4, 0xdf, 0xa4, 0x00, 0x38, 0xeb, 0x01, 0x54, 0xed, 0xc4, 0xe0,
+    0x58, 0x00, 0x38, 0xf9, 0xc6, 0xd0, 0xc4, 0x00, 0x39, 0x01, 0xc3, 0x20,
+    0xb0, 0x00, 0x39, 0x11, 0xcd, 0x7a, 0xb5, 0x00, 0x39, 0x21, 0x87, 0x00,
+    0x39, 0x28, 0xc5, 0x01, 0x24, 0x00, 0x39, 0xa1, 0xc5, 0x00, 0xd2, 0x00,
+    0x39, 0x99, 0xc6, 0x1c, 0x6e, 0x00, 0x39, 0xa8, 0xc6, 0x1c, 0x6e, 0x00,
+    0x39, 0x91, 0xc5, 0x01, 0x24, 0x00, 0x39, 0x89, 0xc5, 0x00, 0xd2, 0x00,
+    0x39, 0x80, 0x48, 0xbc, 0x40, 0xc1, 0x54, 0xf3, 0xcf, 0x67, 0xeb, 0x00,
+    0x38, 0x29, 0x44, 0x7f, 0x6e, 0x41, 0x55, 0x05, 0xc9, 0xb2, 0x22, 0x00,
+    0x38, 0x51, 0x4b, 0x90, 0xe5, 0x41, 0x55, 0x0f, 0x48, 0xbc, 0x30, 0xc1,
+    0x55, 0x1b, 0x4a, 0x9e, 0x76, 0x41, 0x55, 0x2a, 0xcf, 0x6a, 0x61, 0x00,
+    0x38, 0x01, 0x45, 0x77, 0xc5, 0x41, 0x55, 0x39, 0xca, 0x00, 0x4a, 0x00,
+    0x39, 0xc1, 0xc7, 0x06, 0x6d, 0x00, 0x39, 0xc8, 0x45, 0xd5, 0xd5, 0xc1,
+    0x55, 0x45, 0xc4, 0xde, 0x50, 0x00, 0x39, 0xf9, 0xc7, 0xc9, 0x76, 0x00,
+    0x3a, 0x10, 0x51, 0x54, 0xed, 0xc1, 0x55, 0x51, 0x4a, 0x0f, 0x8d, 0x41,
+    0x55, 0x5d, 0xc5, 0x00, 0xd2, 0x00, 0x3a, 0x39, 0xc5, 0x01, 0x24, 0x00,
+    0x3a, 0x40, 0x91, 0x05, 0x40, 0x39, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0x40,
+    0x91, 0x05, 0x40, 0x49, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0x50, 0x91, 0x05,
+    0x40, 0x61, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0x68, 0x16, 0xc1, 0x55, 0x69,
+    0x91, 0x05, 0x40, 0xa1, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0xa8, 0x06, 0xc1,
+    0x55, 0x73, 0x91, 0x05, 0x40, 0xb1, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0xb8,
+    0x91, 0x05, 0x40, 0x71, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0x78, 0x91, 0x05,
+    0x40, 0xc9, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0xd0, 0x91, 0x05, 0x40, 0xd9,
+    0xc2, 0x00, 0x4a, 0x05, 0x40, 0xe0, 0x91, 0x05, 0x40, 0xf1, 0xc2, 0x00,
+    0x57, 0x05, 0x41, 0x00, 0xc7, 0x14, 0x03, 0x05, 0x40, 0x59, 0xd0, 0x5a,
+    0x22, 0x05, 0x41, 0x60, 0x46, 0x00, 0x91, 0x41, 0x55, 0x7d, 0x95, 0x01,
+    0x39, 0x40, 0x47, 0x01, 0x5d, 0xc1, 0x55, 0x8f, 0x43, 0x40, 0x5f, 0x41,
+    0x55, 0x99, 0x0b, 0xc1, 0x55, 0xab, 0xc8, 0x11, 0xa2, 0x0e, 0xd4, 0x41,
+    0x0e, 0xc1, 0x55, 0xb7, 0x48, 0xb6, 0x00, 0xc1, 0x55, 0xc3, 0x5c, 0x12,
+    0x73, 0x41, 0x55, 0xd5, 0x11, 0xc1, 0x55, 0xe4, 0x46, 0x8c, 0x5c, 0x41,
+    0x55, 0xf0, 0xc8, 0x50, 0x47, 0x0e, 0xd4, 0x49, 0x48, 0x15, 0xf4, 0xc1,
+    0x56, 0x02, 0x47, 0xc7, 0x4d, 0xc1, 0x56, 0x0e, 0x47, 0xc6, 0x3c, 0xc1,
+    0x56, 0x1e, 0x46, 0xd0, 0xe2, 0x41, 0x56, 0x2a, 0x47, 0x77, 0x76, 0xc1,
+    0x56, 0x3c, 0x0b, 0x41, 0x56, 0x44, 0xe0, 0x08, 0x29, 0x0e, 0xd3, 0xa8,
+    0x11, 0xc1, 0x56, 0x4e, 0x07, 0xc1, 0x56, 0x60, 0x46, 0xd0, 0xb8, 0x41,
+    0x56, 0x6f, 0xc9, 0xae, 0x4d, 0x0e, 0xd3, 0x61, 0xc3, 0x16, 0xf4, 0x0e,
+    0xd1, 0x81, 0x42, 0x0d, 0x1e, 0x41, 0x56, 0x7b, 0x03, 0xc1, 0x56, 0x97,
+    0xc3, 0x01, 0xe6, 0x0e, 0xcf, 0xfa, 0x01, 0x56, 0xa3, 0xc3, 0x64, 0xed,
+    0x0e, 0xd3, 0x51, 0x44, 0x12, 0x8b, 0x41, 0x56, 0xa7, 0x47, 0xc1, 0x11,
+    0xc1, 0x56, 0xb7, 0x44, 0x1c, 0x29, 0x41, 0x56, 0xcf, 0x45, 0x97, 0x2a,
+    0xc1, 0x57, 0x03, 0x44, 0xda, 0xea, 0x41, 0x57, 0x0f, 0x44, 0xcf, 0x50,
+    0xc1, 0x57, 0x21, 0x44, 0x89, 0x4c, 0x41, 0x57, 0x2d, 0x4f, 0x67, 0x73,
+    0xc1, 0x57, 0x39, 0x47, 0xc9, 0xdf, 0x41, 0x57, 0x4b, 0xc7, 0x02, 0x6a,
+    0x0e, 0xc8, 0x51, 0xc8, 0x3b, 0x12, 0x0e, 0xc8, 0x49, 0xc6, 0x23, 0x4d,
+    0x0e, 0xc8, 0x40, 0xca, 0x23, 0xd3, 0x01, 0x39, 0xb1, 0xd4, 0x3d, 0xf6,
+    0x0f, 0xa9, 0x79, 0xcd, 0x0e, 0x9f, 0x0f, 0xbe, 0x68, 0x03, 0xc1, 0x57,
+    0x73, 0x91, 0x08, 0xad, 0xd1, 0x87, 0x08, 0xad, 0xc1, 0xc9, 0xaa, 0xd2,
+    0x08, 0xad, 0xa3, 0x01, 0x57, 0x88, 0x97, 0x08, 0xad, 0x93, 0x01, 0x57,
+    0x8c, 0x8b, 0x08, 0xad, 0x82, 0x01, 0x57, 0x90, 0x83, 0x08, 0xac, 0x03,
+    0x01, 0x57, 0x94, 0x16, 0xc1, 0x57, 0xa6, 0xc2, 0x00, 0xce, 0x08, 0xad,
+    0x71, 0x15, 0xc1, 0x57, 0xbb, 0x18, 0xc1, 0x57, 0xcb, 0xc2, 0x00, 0x89,
+    0x08, 0xad, 0x49, 0xc2, 0x00, 0x3b, 0x08, 0xad, 0x41, 0xc2, 0x1a, 0x18,
+    0x08, 0xad, 0x39, 0xc2, 0x00, 0xb6, 0x08, 0xad, 0x31, 0x04, 0xc1, 0x57,
+    0xd5, 0x12, 0xc1, 0x57, 0xdf, 0x10, 0xc1, 0x57, 0xe9, 0x06, 0xc1, 0x57,
+    0xff, 0x0c, 0xc1, 0x58, 0x0d, 0x05, 0xc1, 0x58, 0x17, 0x09, 0xc1, 0x58,
+    0x21, 0x0d, 0xc1, 0x58, 0x2b, 0x91, 0x08, 0xac, 0x61, 0x87, 0x08, 0xac,
+    0x51, 0x97, 0x08, 0xac, 0x23, 0x01, 0x58, 0x35, 0x8b, 0x08, 0xac, 0x12,
+    0x01, 0x58, 0x39, 0x07, 0xc1, 0x58, 0x3d, 0x44, 0x00, 0x8e, 0x41, 0x58,
+    0x49, 0xa2, 0x08, 0xae, 0x41, 0xa1, 0x08, 0xae, 0x39, 0xa0, 0x08, 0xae,
+    0x30, 0xcb, 0x8c, 0xe6, 0x08, 0xae, 0x19, 0xc4, 0x19, 0xf1, 0x08, 0xae,
+    0x10, 0xd3, 0x42, 0xdc, 0x0f, 0xad, 0x09, 0xd1, 0x51, 0xdf, 0x0f, 0xad,
+    0x01, 0xd4, 0x0a, 0xd5, 0x0f, 0xac, 0xd9, 0xd3, 0x41, 0x99, 0x0f, 0xac,
+    0xd0, 0xd3, 0x42, 0xdc, 0x0f, 0xac, 0xf9, 0xd1, 0x51, 0xdf, 0x0f, 0xac,
+    0xf1, 0xd4, 0x0a, 0xd5, 0x0f, 0xac, 0xc9, 0xd3, 0x41, 0x99, 0x0f, 0xac,
+    0xc0, 0x43, 0x00, 0x64, 0xc1, 0x58, 0x67, 0x0e, 0xc1, 0x58, 0x6d, 0xde,
+    0x0f, 0x42, 0x01, 0x00, 0xd9, 0x47, 0xc1, 0xf1, 0xc1, 0x58, 0x77, 0xd4,
+    0x39, 0x82, 0x00, 0x04, 0xd0, 0xa1, 0x00, 0x04, 0x71, 0xa2, 0x00, 0x04,
+    0x78, 0x47, 0x37, 0xb8, 0xc1, 0x58, 0x83, 0x46, 0x04, 0x99, 0x41, 0x58,
+    0xa1, 0xcb, 0x1f, 0xe9, 0x00, 0x6c, 0x09, 0x03, 0xc1, 0x58, 0xbf, 0xc9,
+    0xaa, 0xae, 0x00, 0x6c, 0x18, 0x46, 0x01, 0x93, 0xc1, 0x58, 0xcb, 0x4a,
+    0xa3, 0x44, 0x41, 0x59, 0x19, 0xca, 0x60, 0x61, 0x00, 0x6e, 0x79, 0x0d,
+    0xc1, 0x59, 0x3d, 0x45, 0x60, 0x5c, 0xc1, 0x59, 0x49, 0x42, 0x00, 0xeb,
+    0x41, 0x59, 0x67, 0xd1, 0x4f, 0x59, 0x01, 0x3e, 0x49, 0xc2, 0x02, 0xd5,
+    0x01, 0x14, 0x1b, 0x01, 0x59, 0x73, 0x46, 0x00, 0xd2, 0xc1, 0x59, 0x77,
+    0x45, 0x00, 0x92, 0xc1, 0x59, 0x83, 0x47, 0x14, 0x87, 0x41, 0x59, 0x95,
+    0x0e, 0xc1, 0x59, 0xa1, 0xd1, 0x1a, 0x32, 0x01, 0x03, 0xf1, 0x07, 0xc1,
+    0x59, 0xad, 0xc5, 0x19, 0x43, 0x01, 0x03, 0xd9, 0xc9, 0x64, 0xb2, 0x01,
+    0x03, 0xd1, 0xc4, 0x28, 0x74, 0x01, 0x03, 0xc9, 0x15, 0xc1, 0x59, 0xb9,
+    0x08, 0xc1, 0x59, 0xc5, 0xc4, 0x18, 0xa7, 0x01, 0x03, 0x81, 0x16, 0xc1,
+    0x59, 0xd1, 0xc3, 0x05, 0x16, 0x00, 0x05, 0xc8, 0xca, 0x9d, 0x4a, 0x00,
+    0xe6, 0x39, 0xca, 0xa6, 0x28, 0x00, 0xe6, 0x31, 0xca, 0xa2, 0x04, 0x00,
+    0xe6, 0x29, 0xcb, 0x93, 0xa5, 0x00, 0xe6, 0x21, 0xc5, 0xd4, 0xd1, 0x00,
+    0xe6, 0x19, 0x12, 0xc1, 0x59, 0xdd, 0xc5, 0xdd, 0xcd, 0x00, 0xe6, 0x00,
+    0x08, 0xc1, 0x59, 0xe9, 0x04, 0xc1, 0x59, 0xf3, 0x0e, 0xc1, 0x59, 0xfd,
+    0x14, 0xc1, 0x5a, 0x07, 0x15, 0xc1, 0x5a, 0x11, 0x0d, 0xc1, 0x5a, 0x1b,
+    0xc2, 0x00, 0xce, 0x00, 0xdd, 0x01, 0xc2, 0x66, 0x73, 0x00, 0xdc, 0xf9,
+    0xc2, 0x00, 0x71, 0x00, 0xdc, 0xe9, 0xc2, 0x1a, 0x18, 0x00, 0xdc, 0xd1,
+    0xc2, 0x00, 0xb6, 0x00, 0xdc, 0xc9, 0xc2, 0x02, 0x63, 0x00, 0xdc, 0xb9,
+    0xc2, 0x04, 0xf2, 0x00, 0xdc, 0xa9, 0x10, 0xc1, 0x5a, 0x25, 0xc2, 0x0e,
+    0x60, 0x00, 0xdc, 0x99, 0xc2, 0x00, 0x51, 0x00, 0xdc, 0x91, 0xc2, 0x01,
+    0x16, 0x00, 0xdc, 0x81, 0xc2, 0x21, 0x7d, 0x00, 0xdc, 0x79, 0xc2, 0x03,
+    0xc6, 0x00, 0xdc, 0x71, 0xc2, 0x00, 0xeb, 0x00, 0xdc, 0x61, 0xc2, 0x0f,
+    0xba, 0x00, 0xdc, 0x59, 0x87, 0x00, 0xdc, 0x43, 0x01, 0x5a, 0x35, 0x91,
+    0x00, 0xdc, 0x39, 0x83, 0x00, 0xdc, 0x1b, 0x01, 0x5a, 0x39, 0x97, 0x00,
+    0xdc, 0x29, 0x8b, 0x00, 0xdc, 0x20, 0xc4, 0x28, 0x74, 0x00, 0xdd, 0xc9,
+    0xc5, 0x0a, 0xfd, 0x00, 0xdd, 0xc1, 0x15, 0xc1, 0x5a, 0x3d, 0x08, 0xc1,
+    0x5a, 0x49, 0x16, 0xc1, 0x5a, 0x55, 0xc3, 0x05, 0x16, 0x00, 0xdd, 0x89,
+    0xc4, 0x18, 0xa7, 0x00, 0xdd, 0x80, 0x47, 0xc2, 0xd1, 0xc1, 0x5a, 0x61,
+    0x42, 0x16, 0xc7, 0xc1, 0x5a, 0x6d, 0xc7, 0xc5, 0x94, 0x00, 0xdd, 0x08,
+    0xc6, 0x1f, 0xf5, 0x00, 0xdd, 0x59, 0x42, 0x04, 0xf2, 0x41, 0x5a, 0x79,
+    0x10, 0xc1, 0x5a, 0x83, 0xc5, 0xdb, 0xde, 0x00, 0xdd, 0x40, 0xca, 0x34,
+    0x32, 0x01, 0x13, 0xf9, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0xe8, 0x4c, 0x23,
+    0x4d, 0xc1, 0x5a, 0xa1, 0xcb, 0x0f, 0xaf, 0x01, 0x55, 0xa1, 0x44, 0x1d,
+    0x75, 0xc1, 0x5a, 0xad, 0xcf, 0x66, 0x0b, 0x01, 0x55, 0xc0, 0x01, 0x41,
+    0x5a, 0xb9, 0xd0, 0x02, 0xf9, 0x01, 0x4b, 0xc9, 0x42, 0x02, 0x0b, 0x41,
+    0x5a, 0xce, 0xc3, 0x01, 0xa5, 0x01, 0x55, 0xe9, 0xcf, 0x64, 0xb2, 0x01,
+    0x55, 0xf9, 0xd9, 0x1d, 0xa3, 0x01, 0x56, 0x08, 0xca, 0x0f, 0xb0, 0x01,
+    0x04, 0x61, 0xc4, 0x00, 0x65, 0x01, 0x04, 0x40, 0xc4, 0x17, 0xf7, 0x01,
+    0x04, 0x39, 0xc2, 0x24, 0x36, 0x01, 0x04, 0x30, 0xc3, 0x0c, 0xf7, 0x01,
+    0x04, 0x29, 0xc3, 0x04, 0xa0, 0x01, 0x04, 0x20, 0xc4, 0x03, 0xe0, 0x01,
+    0x04, 0x19, 0xc2, 0x01, 0xa2, 0x01, 0x04, 0x10, 0x4a, 0x07, 0xe9, 0xc1,
+    0x5a, 0xda, 0x4e, 0x1a, 0xe8, 0x41, 0x5a, 0xf1, 0x42, 0x00, 0xaa, 0xc1,
+    0x5a, 0xfd, 0x07, 0xc1, 0x5b, 0x0f, 0x14, 0xc1, 0x5b, 0x2a, 0x16, 0xc1,
+    0x5b, 0x3c, 0xcc, 0x89, 0x40, 0x0f, 0xa9, 0xc9, 0xce, 0x74, 0xae, 0x0f,
+    0xa9, 0xc1, 0xd1, 0x54, 0x21, 0x01, 0x53, 0x09, 0x03, 0xc1, 0x5b, 0x48,
+    0xd1, 0x53, 0x77, 0x07, 0xf2, 0x89, 0xc9, 0x11, 0xa1, 0x07, 0xf2, 0x91,
+    0xc9, 0xa9, 0xd6, 0x07, 0xf2, 0xa1, 0xcd, 0x30, 0xea, 0x07, 0xf2, 0xb1,
+    0x42, 0x00, 0x2f, 0xc1, 0x5b, 0x5a, 0xcb, 0x8f, 0xb1, 0x07, 0xf2, 0xf9,
+    0x12, 0xc1, 0x5b, 0x66, 0xcc, 0x8a, 0x54, 0x07, 0xf3, 0x19, 0xd1, 0x51,
+    0x79, 0x07, 0xf3, 0x29, 0xcb, 0x94, 0xe4, 0x07, 0xf3, 0x48, 0xcc, 0x24,
+    0x61, 0x01, 0x55, 0x60, 0xca, 0x02, 0xf9, 0x01, 0x49, 0xb9, 0xc9, 0x02,
+    0xaa, 0x01, 0x49, 0xb0, 0xc9, 0x05, 0xca, 0x01, 0x49, 0xa9, 0xc7, 0x00,
+    0x6f, 0x01, 0x49, 0xa1, 0xca, 0x3c, 0x42, 0x0f, 0xc5, 0x88, 0x48, 0x1b,
+    0xd9, 0xc1, 0x5b, 0x72, 0x07, 0xc1, 0x5b, 0xd0, 0x45, 0x16, 0x71, 0x41,
+    0x5b, 0xdc, 0x43, 0x01, 0x6b, 0xc1, 0x5b, 0xe8, 0x43, 0x31, 0x93, 0xc1,
+    0x5b, 0xf4, 0x4b, 0x4a, 0x1f, 0x41, 0x5c, 0x00, 0x03, 0xc1, 0x5c, 0x6c,
+    0x45, 0x00, 0xd9, 0xc1, 0x5c, 0x7b, 0xd3, 0x40, 0x0a, 0x00, 0x47, 0x11,
+    0xd0, 0x5e, 0x62, 0x00, 0x33, 0x58, 0x4f, 0x2d, 0x3a, 0xc1, 0x5c, 0x8a,
+    0x03, 0xc1, 0x5c, 0x99, 0x43, 0x0d, 0xd1, 0xc1, 0x5c, 0xa3, 0xcd, 0x78,
+    0xba, 0x00, 0x32, 0xe8, 0x01, 0xc1, 0x5c, 0xa9, 0xc3, 0x0c, 0x85, 0x00,
+    0x32, 0x6a, 0x01, 0x5c, 0xbb, 0xc4, 0x03, 0x49, 0x00, 0x32, 0x73, 0x01,
+    0x5c, 0xc1, 0xc8, 0x11, 0xa2, 0x00, 0x36, 0xa1, 0xd0, 0x5e, 0xb2, 0x00,
+    0x33, 0x69, 0xce, 0x6d, 0xe6, 0x00, 0x30, 0x10, 0x45, 0x00, 0xb6, 0xc1,
+    0x5c, 0xce, 0x17, 0xc1, 0x5c, 0xf8, 0x46, 0x12, 0x2e, 0xc1, 0x5d, 0x0d,
+    0x44, 0x00, 0x8e, 0xc1, 0x5d, 0x2f, 0xd3, 0x40, 0x56, 0x00, 0x36, 0xf1,
+    0xc5, 0xdc, 0xc9, 0x00, 0x32, 0x8b, 0x01, 0x5d, 0x4b, 0xc8, 0x50, 0x47,
+    0x00, 0x30, 0xd8, 0xc8, 0xba, 0x88, 0x00, 0x47, 0x91, 0xc8, 0xba, 0x00,
+    0x00, 0x47, 0x89, 0xc8, 0x70, 0xb0, 0x00, 0x47, 0x80, 0x44, 0x05, 0x16,
+    0xc1, 0x5d, 0x4f, 0xd1, 0x4e, 0xd1, 0x00, 0x47, 0x19, 0x03, 0xc1, 0x5d,
+    0x61, 0xd2, 0x4d, 0xa1, 0x00, 0x33, 0x61, 0xda, 0x1b, 0x6a, 0x00, 0x30,
+    0xf0, 0x45, 0x00, 0x35, 0xc1, 0x5d, 0x70, 0xc4, 0x04, 0x0d, 0x00, 0x30,
+    0x60, 0xd3, 0x3f, 0xf7, 0x00, 0x44, 0xf9, 0x44, 0x07, 0x2d, 0x41, 0x5d,
+    0x8b, 0xd1, 0x52, 0x78, 0x00, 0x44, 0x89, 0x11, 0xc1, 0x5d, 0x97, 0xce,
+    0x6d, 0x76, 0x00, 0x37, 0x49, 0xcb, 0x8f, 0xfe, 0x00, 0x33, 0x50, 0xcc,
+    0x45, 0x56, 0x00, 0x44, 0x71, 0x4a, 0x6e, 0xbc, 0x41, 0x5d, 0xa3, 0x4c,
+    0x85, 0x20, 0xc1, 0x5d, 0xb5, 0x46, 0x02, 0xd2, 0x41, 0x5d, 0xc1, 0xca,
+    0x42, 0x27, 0x00, 0x30, 0x29, 0xc4, 0x00, 0x8d, 0x00, 0x30, 0x00, 0xc4,
+    0x28, 0x74, 0x00, 0x33, 0x49, 0xc5, 0x0a, 0xfd, 0x00, 0x33, 0x41, 0x15,
+    0xc1, 0x5d, 0xcd, 0x08, 0xc1, 0x5d, 0xd9, 0x16, 0xc1, 0x5d, 0xe5, 0xc3,
+    0x05, 0x16, 0x00, 0x33, 0x09, 0xc4, 0x18, 0xa7, 0x00, 0x33, 0x00, 0xd1,
+    0x53, 0xcc, 0x00, 0x30, 0x51, 0xca, 0x9e, 0xc6, 0x00, 0x30, 0x48, 0x44,
+    0x42, 0x92, 0xc1, 0x5d, 0xf1, 0xc7, 0xc2, 0x22, 0x07, 0xd8, 0xb1, 0xc8,
+    0xb9, 0xa8, 0x00, 0x2c, 0x38, 0xc2, 0x13, 0x1a, 0x00, 0x2b, 0xab, 0x01,
+    0x5e, 0x09, 0xc3, 0xb3, 0x1e, 0x00, 0x2c, 0x31, 0xc2, 0x31, 0xdb, 0x00,
+    0x2c, 0x29, 0x42, 0x00, 0x3e, 0xc1, 0x5e, 0x15, 0x12, 0xc1, 0x5e, 0x1d,
+    0x05, 0xc1, 0x5e, 0x29, 0x14, 0xc1, 0x5e, 0x35, 0x16, 0xc1, 0x5e, 0x3f,
+    0x18, 0xc1, 0x5e, 0x4f, 0x15, 0xc1, 0x5e, 0x59, 0x0c, 0xc1, 0x5e, 0x65,
+    0xc3, 0x07, 0xa8, 0x00, 0x2b, 0xb1, 0xc3, 0x03, 0x85, 0x00, 0x2b, 0xa1,
+    0x09, 0xc1, 0x5e, 0x6f, 0xc2, 0x00, 0x4a, 0x00, 0x2b, 0x81, 0xc3, 0x60,
+    0x2e, 0x00, 0x2b, 0x69, 0xc4, 0xdf, 0xe4, 0x00, 0x2b, 0x61, 0xc3, 0x00,
+    0xaf, 0x00, 0x2b, 0x59, 0x1c, 0xc1, 0x5e, 0x7b, 0x07, 0xc1, 0x5e, 0x85,
+    0xc2, 0x0e, 0x60, 0x00, 0x2b, 0x21, 0xc3, 0x18, 0x6d, 0x00, 0x2b, 0x11,
+    0xc3, 0x1d, 0x6f, 0x00, 0x2b, 0x08, 0xc3, 0xb3, 0x1e, 0x00, 0x2a, 0xb1,
+    0xc2, 0x31, 0xdb, 0x00, 0x2a, 0xa9, 0x42, 0x00, 0x3e, 0xc1, 0x5e, 0x93,
+    0x12, 0xc1, 0x5e, 0x9b, 0xc2, 0x13, 0x1a, 0x00, 0x2a, 0x2b, 0x01, 0x5e,
+    0xa7, 0x05, 0xc1, 0x5e, 0xad, 0x14, 0xc1, 0x5e, 0xb9, 0x16, 0xc1, 0x5e,
+    0xc3, 0x18, 0xc1, 0x5e, 0xcd, 0x15, 0xc1, 0x5e, 0xd7, 0x0c, 0xc1, 0x5e,
+    0xe3, 0xc3, 0x07, 0xa8, 0x00, 0x2a, 0x31, 0xc3, 0x03, 0x85, 0x00, 0x2a,
+    0x21, 0x09, 0xc1, 0x5e, 0xed, 0xc2, 0x00, 0x4a, 0x00, 0x2a, 0x01, 0xc3,
+    0x60, 0x2e, 0x00, 0x29, 0xe9, 0xc4, 0xdf, 0xe4, 0x00, 0x29, 0xe1, 0xc3,
+    0x00, 0xaf, 0x00, 0x29, 0xd9, 0x1c, 0xc1, 0x5e, 0xf9, 0x07, 0xc1, 0x5f,
+    0x03, 0xc2, 0x0e, 0x60, 0x00, 0x29, 0xa1, 0xc3, 0x1d, 0x6f, 0x00, 0x29,
+    0x89, 0xc3, 0x18, 0x6d, 0x00, 0x29, 0x90, 0xc4, 0x66, 0x74, 0x0f, 0x48,
+    0x01, 0x06, 0xc1, 0x5f, 0x11, 0xc4, 0x7a, 0xcb, 0x0f, 0x48, 0x11, 0xc4,
+    0xe4, 0x54, 0x0f, 0x48, 0x19, 0x04, 0xc1, 0x5f, 0x1d, 0x15, 0xc1, 0x5f,
+    0x27, 0xc2, 0x00, 0x78, 0x0f, 0x48, 0x31, 0xc2, 0x00, 0x3b, 0x0f, 0x48,
+    0x41, 0x87, 0x0f, 0x48, 0x49, 0xc2, 0x04, 0x70, 0x0f, 0x48, 0x51, 0x8b,
+    0x0f, 0x48, 0x59, 0x91, 0x0f, 0x48, 0x61, 0x1b, 0xc1, 0x5f, 0x33, 0xc3,
+    0x76, 0xe6, 0x0f, 0x48, 0x79, 0x10, 0xc1, 0x5f, 0x3d, 0x0d, 0xc1, 0x5f,
+    0x4f, 0x97, 0x0f, 0x48, 0x99, 0xc4, 0xe0, 0x18, 0x0f, 0x48, 0xa1, 0xc3,
+    0x11, 0x99, 0x0f, 0x48, 0xa9, 0xc2, 0x00, 0xce, 0x0f, 0x48, 0xb1, 0xc4,
+    0xd3, 0x82, 0x0f, 0x48, 0xb9, 0x09, 0xc1, 0x5f, 0x61, 0xc2, 0x00, 0x16,
+    0x0f, 0x48, 0xd1, 0xc2, 0x02, 0x63, 0x0f, 0x48, 0xe1, 0xc3, 0xa7, 0xcc,
+    0x0f, 0x48, 0xf8, 0xc4, 0x12, 0x9a, 0x0f, 0x49, 0x19, 0xc2, 0x00, 0xce,
+    0x0f, 0x49, 0x78, 0x83, 0x0f, 0x49, 0x31, 0xc2, 0x00, 0x61, 0x0f, 0x49,
+    0x48, 0xc9, 0xad, 0xab, 0x0f, 0x49, 0x39, 0xc2, 0x00, 0xce, 0x0f, 0x4a,
+    0x18, 0xc2, 0x00, 0x61, 0x0f, 0x49, 0x81, 0x83, 0x0f, 0x49, 0xa0, 0xc2,
+    0x05, 0x1f, 0x0f, 0x49, 0x91, 0xc2, 0x1a, 0x18, 0x0f, 0x49, 0xd9, 0xc2,
+    0x00, 0xce, 0x0f, 0x49, 0xe8, 0xc2, 0x0f, 0xbb, 0x0f, 0x49, 0x99, 0xc2,
+    0x00, 0xce, 0x0f, 0x49, 0xf9, 0xc2, 0x01, 0x4c, 0x0f, 0x4a, 0x10, 0x83,
+    0x0f, 0x49, 0xd1, 0xc2, 0x01, 0x24, 0x0f, 0x4a, 0x00, 0xc2, 0x01, 0xa2,
+    0x0f, 0x4a, 0x91, 0xc4, 0x03, 0xe0, 0x0f, 0x4a, 0x98, 0xc3, 0x04, 0xa0,
+    0x0f, 0x4a, 0xa1, 0xc3, 0x0c, 0xf7, 0x0f, 0x4a, 0xa8, 0xc2, 0x24, 0x36,
+    0x0f, 0x4a, 0xb1, 0xc4, 0x17, 0xf7, 0x0f, 0x4a, 0xb8, 0xc7, 0xc9, 0x5a,
+    0x0f, 0xbb, 0x61, 0xc4, 0xe3, 0xf0, 0x0f, 0xbb, 0x58, 0x1e, 0x41, 0x5f,
+    0x6b, 0xc6, 0xcf, 0x3e, 0x0f, 0xbb, 0x2b, 0x01, 0x5f, 0x73, 0x48, 0xb6,
+    0xe0, 0x41, 0x5f, 0x77, 0xc3, 0x07, 0x23, 0x0f, 0xb9, 0x01, 0xcb, 0x48,
+    0xf2, 0x0f, 0xb9, 0x28, 0xc2, 0xa9, 0x06, 0x0f, 0xba, 0x61, 0xcb, 0x94,
+    0x97, 0x0f, 0xba, 0x71, 0xc6, 0xcb, 0xd8, 0x0f, 0xba, 0x80, 0xc5, 0xda,
+    0x6c, 0x0f, 0xbb, 0x0b, 0x01, 0x5f, 0x86, 0xc4, 0x2f, 0x7d, 0x0f, 0xbb,
+    0x00, 0xc4, 0xde, 0xa8, 0x0f, 0xba, 0x5b, 0x01, 0x5f, 0x8c, 0xc7, 0xc2,
+    0x0d, 0x0f, 0xba, 0xc0, 0xc4, 0xde, 0xd4, 0x0f, 0xbb, 0x19, 0xca, 0xa6,
+    0x78, 0x0f, 0xbb, 0x20, 0xc2, 0xe4, 0xe8, 0x0f, 0xba, 0x00, 0xc4, 0x8e,
+    0xd1, 0x0f, 0xb9, 0x49, 0xc5, 0x80, 0xbf, 0x0f, 0xba, 0x40, 0xc5, 0xdc,
+    0xe2, 0x0f, 0xb9, 0x93, 0x01, 0x5f, 0x92, 0xc5, 0xd9, 0x27, 0x0f, 0xb9,
+    0xdb, 0x01, 0x5f, 0x9c, 0xc4, 0x06, 0xea, 0x0f, 0xbb, 0x68, 0xc2, 0xe4,
+    0xe8, 0x0f, 0xb8, 0xc8, 0xc5, 0xda, 0x71, 0x0f, 0xb8, 0x53, 0x01, 0x5f,
+    0xa2, 0xc5, 0xd6, 0x89, 0x0f, 0xb8, 0xb2, 0x01, 0x5f, 0xac, 0x46, 0x5b,
+    0xab, 0xc1, 0x5f, 0xb2, 0xc4, 0x47, 0x91, 0x0f, 0xb8, 0x68, 0x96, 0x0f,
+    0xb8, 0xa3, 0x01, 0x5f, 0xbe, 0xc9, 0xa9, 0xfa, 0x0f, 0xb9, 0xc8, 0xcd,
+    0x7a, 0x81, 0x0f, 0xba, 0x91, 0xd3, 0x40, 0x30, 0x0f, 0xba, 0xe2, 0x01,
+    0x5f, 0xc4, 0x01, 0xc1, 0x5f, 0xca, 0xc6, 0xcc, 0x7a, 0x0f, 0xb8, 0x28,
+    0xc4, 0x81, 0x8d, 0x0f, 0xb9, 0xb3, 0x01, 0x5f, 0xdc, 0xc2, 0x04, 0x41,
+    0x0f, 0xba, 0x29, 0xc5, 0xd5, 0xfd, 0x0f, 0xbb, 0x50, 0x1e, 0x41, 0x5f,
+    0xe2, 0xc2, 0xe4, 0xe8, 0x0f, 0xb8, 0xe8, 0xc8, 0xb7, 0xa0, 0x0f, 0xba,
+    0xb1, 0xc2, 0x00, 0x35, 0x0f, 0xbb, 0x70, 0xc4, 0xb3, 0x30, 0x0f, 0xbb,
+    0x91, 0xc5, 0xd3, 0xc3, 0x0f, 0xbb, 0x98, 0x24, 0xc1, 0x5f, 0xea, 0x23,
+    0xc1, 0x60, 0x12, 0x22, 0xc1, 0x60, 0x43, 0x21, 0xc1, 0x60, 0x6e, 0x20,
+    0xc1, 0x60, 0x99, 0x1f, 0xc1, 0x60, 0xc4, 0x25, 0xc1, 0x60, 0xe8, 0x26,
+    0xc1, 0x61, 0x13, 0x27, 0xc1, 0x61, 0x3b, 0x28, 0x41, 0x61, 0x63, 0x1f,
+    0xc1, 0x61, 0x91, 0x20, 0xc1, 0x61, 0xcb, 0x21, 0xc1, 0x61, 0xf9, 0x22,
+    0xc1, 0x62, 0x24, 0x23, 0xc1, 0x62, 0x4f, 0x24, 0xc1, 0x62, 0x77, 0x25,
+    0xc1, 0x62, 0x9f, 0x26, 0xc1, 0x62, 0xc7, 0x27, 0xc1, 0x62, 0xef, 0x28,
+    0x41, 0x63, 0x17, 0x1f, 0xc1, 0x63, 0x3f, 0x20, 0xc1, 0x63, 0x70, 0x21,
+    0xc1, 0x63, 0x9e, 0x22, 0xc1, 0x63, 0xc9, 0x23, 0xc1, 0x63, 0xf1, 0x24,
+    0xc1, 0x64, 0x19, 0x25, 0xc1, 0x64, 0x41, 0x26, 0xc1, 0x64, 0x6c, 0x27,
+    0xc1, 0x64, 0x94, 0x28, 0x41, 0x64, 0xbf, 0x1f, 0xc1, 0x64, 0xed, 0x20,
+    0xc1, 0x65, 0x18, 0x21, 0xc1, 0x65, 0x40, 0x22, 0xc1, 0x65, 0x6b, 0x23,
+    0xc1, 0x65, 0x96, 0x24, 0xc1, 0x65, 0xbe, 0x25, 0xc1, 0x65, 0xe9, 0x26,
+    0xc1, 0x66, 0x17, 0x27, 0xc1, 0x66, 0x42, 0x28, 0x41, 0x66, 0x70, 0x1f,
+    0xc1, 0x66, 0x9a, 0x20, 0xc1, 0x66, 0xc2, 0x21, 0xc1, 0x66, 0xea, 0x22,
+    0xc1, 0x67, 0x12, 0x23, 0xc1, 0x67, 0x3a, 0x24, 0xc1, 0x67, 0x62, 0x25,
+    0xc1, 0x67, 0x90, 0x26, 0xc1, 0x67, 0xb8, 0x27, 0xc1, 0x67, 0xe0, 0x28,
+    0x41, 0x68, 0x08, 0x1f, 0xc1, 0x68, 0x28, 0x20, 0xc1, 0x68, 0x4c, 0x21,
+    0xc1, 0x68, 0x74, 0xc2, 0xe4, 0x83, 0x0a, 0x32, 0x30, 0xcf, 0x65, 0x1b,
+    0x01, 0x11, 0x99, 0xd2, 0x4c, 0x81, 0x01, 0x4a, 0x00, 0xd3, 0x40, 0x69,
+    0x01, 0x0d, 0xb1, 0x4f, 0x02, 0xb5, 0x41, 0x68, 0x9c, 0xe0, 0x00, 0x69,
+    0x0f, 0xa8, 0x20, 0xc8, 0x50, 0x50, 0x01, 0x4d, 0x21, 0xc8, 0x48, 0x5b,
+    0x01, 0x4c, 0xf0, 0xc9, 0x16, 0x67, 0x01, 0x10, 0xb8, 0xc2, 0x00, 0xce,
+    0x08, 0xba, 0x21, 0x83, 0x08, 0xba, 0x18, 0xc2, 0x00, 0xce, 0x08, 0xba,
+    0x11, 0x83, 0x08, 0xba, 0x08, 0xc2, 0x00, 0xa0, 0x08, 0xb8, 0xd1, 0xc2,
+    0x00, 0xeb, 0x08, 0xb8, 0xb1, 0xc2, 0x00, 0x51, 0x08, 0xb8, 0x28, 0xc6,
+    0x00, 0x43, 0x08, 0xb9, 0xe9, 0xcc, 0x8a, 0xc0, 0x08, 0xb9, 0xe0, 0x01,
+    0x41, 0x68, 0xba, 0xc4, 0x06, 0x5b, 0x01, 0x1a, 0xf1, 0xc8, 0x50, 0x50,
+    0x01, 0x1a, 0xc0, 0xc9, 0x50, 0x4f, 0x01, 0x1b, 0xc0, 0xcb, 0x97, 0x83,
+    0x01, 0x1b, 0x91, 0x45, 0x94, 0xda, 0xc1, 0x68, 0xfe, 0xc8, 0xb9, 0xb0,
+    0x01, 0x1a, 0xe8, 0x01, 0xc1, 0x69, 0x10, 0xca, 0x73, 0xc4, 0x01, 0x1a,
+    0xb0, 0x01, 0xc1, 0x69, 0x22, 0x43, 0x02, 0x67, 0x41, 0x69, 0x34, 0xc9,
+    0xad, 0x3f, 0x01, 0x1b, 0x69, 0xcc, 0x83, 0x4c, 0x01, 0x1b, 0x18, 0xc9,
+    0x20, 0xc3, 0x01, 0x1b, 0x29, 0x42, 0x00, 0x15, 0xc1, 0x69, 0x40, 0xc8,
+    0x50, 0x50, 0x01, 0x1a, 0xe1, 0xc9, 0x00, 0xa0, 0x01, 0x1a, 0x49, 0xc3,
+    0xb9, 0xb5, 0x01, 0x19, 0xf0, 0x46, 0x02, 0x94, 0xc1, 0x69, 0x4c, 0xd9,
+    0x1d, 0x71, 0x01, 0x12, 0x30, 0x87, 0x08, 0x59, 0xa9, 0xc2, 0x00, 0xf1,
+    0x08, 0x59, 0x48, 0xc3, 0x06, 0xf3, 0x08, 0x59, 0xa1, 0x0a, 0xc1, 0x69,
+    0x5b, 0x87, 0x08, 0x59, 0x78, 0x87, 0x08, 0x59, 0x59, 0xc2, 0x0d, 0x1e,
+    0x08, 0x59, 0x50, 0xc2, 0x00, 0xe1, 0x08, 0x59, 0x39, 0xc2, 0x0d, 0x1e,
+    0x08, 0x59, 0x31, 0x87, 0x08, 0x59, 0x29, 0x09, 0x41, 0x69, 0x65, 0xc2,
+    0x00, 0x61, 0x08, 0x58, 0xe1, 0x87, 0x08, 0x58, 0xd8, 0xc2, 0x00, 0x61,
+    0x08, 0x58, 0xd1, 0x87, 0x08, 0x58, 0xc9, 0xc2, 0x00, 0xbe, 0x08, 0x58,
+    0xe8, 0xc2, 0x00, 0x61, 0x08, 0x58, 0xb1, 0xc2, 0x01, 0x3d, 0x08, 0x58,
+    0xa9, 0x87, 0x08, 0x58, 0xa0, 0xc2, 0x00, 0x98, 0x08, 0x58, 0x99, 0x87,
+    0x08, 0x58, 0x89, 0xc2, 0x0d, 0x1e, 0x08, 0x58, 0x90, 0x97, 0x08, 0x58,
+    0x78, 0x8b, 0x08, 0x58, 0x68, 0x91, 0x08, 0x58, 0x58, 0x87, 0x08, 0x58,
+    0x48, 0x87, 0x08, 0x58, 0x33, 0x01, 0x69, 0x75, 0x83, 0x08, 0x58, 0x0b,
+    0x01, 0x69, 0x79, 0x90, 0x08, 0x58, 0x21, 0x91, 0x08, 0x58, 0x10, 0x87,
+    0x08, 0x59, 0x01, 0xc2, 0x00, 0x61, 0x08, 0x59, 0x08, 0x87, 0x08, 0x59,
+    0x81, 0xc2, 0x00, 0x61, 0x08, 0x59, 0x90, 0x01, 0x41, 0x69, 0x81, 0x0a,
+    0xc1, 0x69, 0x8d, 0xc2, 0x00, 0x79, 0x08, 0x08, 0x83, 0x01, 0x69, 0x9f,
+    0x19, 0x41, 0x69, 0xa5, 0x0b, 0xc1, 0x69, 0xb5, 0x11, 0x41, 0x69, 0xc7,
+    0xc2, 0x24, 0x36, 0x08, 0x08, 0x63, 0x01, 0x69, 0xd9, 0xc4, 0x17, 0xf7,
+    0x08, 0x08, 0x6a, 0x01, 0x69, 0xe6, 0x01, 0xc1, 0x69, 0xf3, 0x9b, 0x08,
+    0x08, 0xba, 0x01, 0x69, 0xff, 0x01, 0xc1, 0x6a, 0x05, 0xc2, 0x0c, 0xf3,
+    0x08, 0x08, 0xc2, 0x01, 0x6a, 0x11, 0xc9, 0xaa, 0xe4, 0x08, 0x09, 0xb9,
+    0x08, 0xc1, 0x6a, 0x17, 0xce, 0x71, 0xc8, 0x08, 0x09, 0xc9, 0xcd, 0x7a,
+    0xf6, 0x08, 0x09, 0xd0, 0xc4, 0x00, 0xdf, 0x08, 0x08, 0x01, 0xc3, 0x01,
+    0xa5, 0x08, 0x08, 0x08, 0x45, 0x01, 0x79, 0xc1, 0x6a, 0x23, 0x44, 0x00,
+    0x30, 0x41, 0x6a, 0x63, 0xc2, 0x00, 0x6f, 0x01, 0x2b, 0xcb, 0x01, 0x6a,
+    0x7b, 0xc4, 0x00, 0x2f, 0x01, 0x2b, 0xc3, 0x01, 0x6a, 0x81, 0x42, 0x00,
+    0xd8, 0xc1, 0x6a, 0x87, 0xc5, 0x00, 0x64, 0x01, 0x2b, 0xd1, 0xc8, 0x03,
+    0xc1, 0x01, 0x28, 0x1b, 0x01, 0x6a, 0x96, 0x4f, 0x66, 0xec, 0xc1, 0x6a,
+    0x9c, 0x4c, 0x50, 0xcf, 0xc1, 0x6a, 0xa8, 0xca, 0x00, 0x4a, 0x01, 0x28,
+    0x08, 0x45, 0x03, 0x7c, 0xc1, 0x6a, 0xb4, 0x43, 0x10, 0xc4, 0x41, 0x6a,
+    0xcf, 0x4b, 0x99, 0x67, 0xc1, 0x6a, 0xe7, 0x4b, 0x8f, 0xc7, 0xc1, 0x6a,
+    0xf9, 0x4a, 0x10, 0xe4, 0xc1, 0x6b, 0x0b, 0x4a, 0x5b, 0x32, 0x41, 0x6b,
+    0x1d, 0x4b, 0x99, 0x67, 0xc1, 0x6b, 0x2f, 0x4b, 0x8f, 0xc7, 0xc1, 0x6b,
+    0x41, 0x4a, 0x5b, 0x32, 0xc1, 0x6b, 0x53, 0x4a, 0x10, 0xe4, 0x41, 0x6b,
+    0x6b, 0x4f, 0x64, 0xfd, 0xc1, 0x6b, 0x83, 0xdc, 0x14, 0x33, 0x01, 0x2a,
+    0x31, 0xdc, 0x13, 0x53, 0x01, 0x2a, 0x21, 0x4f, 0x13, 0x56, 0x41, 0x6b,
+    0x95, 0xd8, 0x22, 0x2d, 0x01, 0x1d, 0xb0, 0xc8, 0x1e, 0x5a, 0x01, 0x19,
+    0x09, 0xcc, 0x89, 0x94, 0x01, 0x5e, 0x59, 0xd0, 0x1e, 0xb6, 0x01, 0x72,
+    0xd9, 0xd1, 0x1a, 0x32, 0x01, 0x72, 0xe0, 0x05, 0xc1, 0x6b, 0xa7, 0xcc,
+    0x8a, 0x30, 0x01, 0x71, 0x28, 0x05, 0xc1, 0x6b, 0xb3, 0xcc, 0x8a, 0x30,
+    0x01, 0x71, 0x20, 0xd0, 0x59, 0x82, 0x01, 0x4e, 0x91, 0xcf, 0x66, 0x47,
+    0x01, 0x4e, 0x88, 0xca, 0xa0, 0x9c, 0x0f, 0xaa, 0x79, 0xca, 0xa0, 0xa6,
+    0x0f, 0xcb, 0x18, 0xc5, 0x5f, 0x0e, 0x0f, 0xa6, 0x88, 0x97, 0x01, 0x8d,
+    0x00, 0x89, 0x01, 0x89, 0x5b, 0x01, 0x6b, 0xbf, 0x90, 0x01, 0x89, 0x78,
+    0x8a, 0x01, 0x8d, 0xc8, 0x90, 0x01, 0x89, 0x61, 0x97, 0x01, 0x8d, 0x19,
+    0x8a, 0x01, 0x8d, 0xc1, 0x99, 0x01, 0x8d, 0xe0, 0x99, 0x01, 0x8d, 0xe8,
+    0x8b, 0x01, 0x8d, 0x10, 0x8a, 0x01, 0x88, 0x99, 0x8b, 0x01, 0x8d, 0x09,
+    0x9b, 0x01, 0x8d, 0xd0, 0x8a, 0x01, 0x88, 0xa0, 0x8a, 0x01, 0x88, 0xa8,
+    0x8b, 0x01, 0x88, 0xf3, 0x01, 0x6b, 0xc3, 0x97, 0x01, 0x89, 0x03, 0x01,
+    0x6b, 0xc9, 0x90, 0x01, 0x89, 0x13, 0x01, 0x6b, 0xcf, 0x8f, 0x01, 0x8d,
+    0x81, 0x8a, 0x01, 0x8d, 0xf8, 0x97, 0x01, 0x89, 0x09, 0xcf, 0x33, 0x31,
+    0x01, 0x89, 0x71, 0x91, 0x01, 0x8d, 0x31, 0x10, 0xc1, 0x6b, 0xd7, 0x8f,
+    0x01, 0x8d, 0x89, 0x87, 0x01, 0x8d, 0xf0, 0x8a, 0x01, 0x88, 0xe9, 0x8b,
+    0x01, 0x88, 0xf9, 0x90, 0x01, 0x89, 0x1b, 0x01, 0x6b, 0xdf, 0x94, 0x01,
+    0x89, 0x31, 0x87, 0x01, 0x8d, 0x20, 0x97, 0x01, 0x89, 0x49, 0x8a, 0x01,
+    0x89, 0x69, 0x94, 0x01, 0x8d, 0x41, 0xc2, 0x1b, 0xf2, 0x01, 0x8d, 0x53,
+    0x01, 0x6b, 0xe7, 0x8f, 0x01, 0x8d, 0x60, 0xc2, 0x1b, 0xf2, 0x01, 0x8d,
+    0x58, 0xa3, 0x0f, 0xd8, 0x43, 0x01, 0x6b, 0xeb, 0xa1, 0x0f, 0xd8, 0x13,
+    0x01, 0x6b, 0xf6, 0xa4, 0x0f, 0xd8, 0x83, 0x01, 0x6c, 0x0f, 0xa2, 0x0f,
+    0xd8, 0x23, 0x01, 0x6c, 0x13, 0xa5, 0x0f, 0xd8, 0xf8, 0xa4, 0x0f, 0xd8,
+    0x9b, 0x01, 0x6c, 0x24, 0xa3, 0x0f, 0xd8, 0x5b, 0x01, 0x6c, 0x28, 0xa5,
+    0x0f, 0xd9, 0x10, 0xa4, 0x0f, 0xd8, 0x8b, 0x01, 0x6c, 0x33, 0xa2, 0x0f,
+    0xd8, 0x2b, 0x01, 0x6c, 0x37, 0xa5, 0x0f, 0xd9, 0x01, 0xa3, 0x0f, 0xd8,
+    0x4a, 0x01, 0x6c, 0x49, 0xa5, 0x0f, 0xd9, 0x68, 0xa5, 0x0f, 0xd9, 0x31,
+    0xa4, 0x0f, 0xd8, 0xb2, 0x01, 0x6c, 0x50, 0x05, 0xc1, 0x6c, 0x54, 0x15,
+    0xc1, 0x6c, 0x7b, 0x16, 0xc1, 0x6c, 0xbe, 0x06, 0xc1, 0x6c, 0xdc, 0x14,
+    0xc1, 0x6c, 0xef, 0x0e, 0xc1, 0x6d, 0x01, 0xd6, 0x30, 0xea, 0x01, 0x3a,
+    0x99, 0x08, 0xc1, 0x6d, 0x11, 0xc3, 0xe5, 0xa7, 0x01, 0x38, 0x91, 0x0f,
+    0xc1, 0x6d, 0x19, 0x17, 0xc1, 0x6d, 0x25, 0x0a, 0xc1, 0x6d, 0x2f, 0x12,
+    0xc1, 0x6d, 0x3d, 0x43, 0x00, 0x98, 0xc1, 0x6d, 0x4f, 0xc6, 0xcb, 0xc6,
+    0x01, 0x4e, 0x99, 0xc7, 0xc1, 0x96, 0x01, 0x5e, 0x20, 0x4a, 0x15, 0x48,
+    0xc1, 0x6d, 0x5b, 0x4f, 0x66, 0xb0, 0x41, 0x6d, 0x6d, 0xca, 0x9c, 0x5a,
+    0x0f, 0xa5, 0xb9, 0xc9, 0xa9, 0x10, 0x0f, 0xa5, 0xb1, 0xcb, 0x94, 0xe4,
+    0x0f, 0xa5, 0xa9, 0xc8, 0x7f, 0xa7, 0x0f, 0xa5, 0xa0, 0xc2, 0x00, 0x47,
+    0x0f, 0x9c, 0x43, 0x01, 0x6d, 0x81, 0x42, 0x00, 0x32, 0x41, 0x6d, 0x87,
+    0x0f, 0xc1, 0x6d, 0x97, 0xc3, 0x01, 0x4f, 0x00, 0xda, 0xd2, 0x01, 0x6d,
+    0xa6, 0x4a, 0xa5, 0x56, 0xc1, 0x6d, 0xac, 0x4b, 0x97, 0x4c, 0xc1, 0x6d,
+    0xb8, 0x4a, 0x57, 0x0d, 0xc1, 0x6d, 0xc4, 0x06, 0x41, 0x6d, 0xe8, 0x42,
+    0x04, 0xf2, 0xc1, 0x6e, 0x02, 0xc4, 0xdf, 0x04, 0x00, 0xda, 0xf0, 0xc4,
+    0x28, 0x74, 0x00, 0xda, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0xda, 0xc1, 0x15,
+    0xc1, 0x6e, 0x0e, 0x08, 0xc1, 0x6e, 0x1a, 0x16, 0xc1, 0x6e, 0x26, 0xc3,
+    0x05, 0x16, 0x00, 0xda, 0x89, 0xc4, 0x18, 0xa7, 0x00, 0xda, 0x80, 0x03,
+    0xc1, 0x6e, 0x32, 0xc9, 0xa7, 0xcc, 0x00, 0xda, 0x51, 0xc8, 0xb8, 0x30,
+    0x00, 0xda, 0x49, 0x07, 0xc1, 0x6e, 0x4d, 0x16, 0xc1, 0x6e, 0x59, 0x0d,
+    0xc1, 0x6e, 0x66, 0xc2, 0x00, 0xce, 0x00, 0xd9, 0x99, 0xc2, 0x0d, 0x01,
+    0x00, 0xd9, 0x93, 0x01, 0x6e, 0x73, 0xc2, 0x00, 0x71, 0x00, 0xd9, 0x79,
+    0xc2, 0x00, 0x89, 0x00, 0xd9, 0x73, 0x01, 0x6e, 0x79, 0xc2, 0x00, 0x3b,
+    0x00, 0xd9, 0x6b, 0x01, 0x6e, 0x82, 0xc2, 0x1a, 0x18, 0x00, 0xd9, 0x61,
+    0xc2, 0x00, 0xb6, 0x00, 0xd9, 0x59, 0xc2, 0x00, 0xa0, 0x00, 0xd9, 0x4b,
+    0x01, 0x6e, 0x8b, 0xc2, 0x04, 0xf2, 0x00, 0xd9, 0x3b, 0x01, 0x6e, 0x91,
+    0x10, 0xc1, 0x6e, 0x97, 0xc2, 0x0e, 0x60, 0x00, 0xd9, 0x23, 0x01, 0x6e,
+    0xaa, 0xc2, 0x21, 0x7d, 0x00, 0xd8, 0xd3, 0x01, 0x6e, 0xb0, 0xc2, 0x03,
+    0xc6, 0x00, 0xd8, 0xc3, 0x01, 0x6e, 0xb6, 0xc2, 0x00, 0xeb, 0x00, 0xd8,
+    0xab, 0x01, 0x6e, 0xbc, 0xc5, 0xd3, 0x9b, 0x00, 0xd8, 0x8b, 0x01, 0x6e,
+    0xc2, 0xc5, 0xd5, 0x71, 0x00, 0xd8, 0x4b, 0x01, 0x6e, 0xc8, 0xc5, 0xdb,
+    0x02, 0x00, 0xd8, 0x3a, 0x01, 0x6e, 0xce, 0xc5, 0xd4, 0x8b, 0x00, 0xda,
+    0x13, 0x01, 0x6e, 0xd4, 0x16, 0xc1, 0x6e, 0xda, 0xc8, 0xbb, 0x70, 0x00,
+    0xd9, 0xe3, 0x01, 0x6e, 0xe9, 0xc7, 0xc7, 0x69, 0x00, 0xd9, 0xd3, 0x01,
+    0x6e, 0xef, 0xc4, 0xc6, 0x82, 0x00, 0xd9, 0xc3, 0x01, 0x6e, 0xf5, 0xc3,
+    0x98, 0x0e, 0x00, 0xd9, 0xb2, 0x01, 0x6e, 0xfb, 0xc7, 0xc5, 0xda, 0x00,
+    0xd9, 0xa1, 0xc5, 0xd5, 0xb2, 0x00, 0xd8, 0x21, 0xc6, 0xd0, 0xd0, 0x00,
+    0xd8, 0x19, 0xc5, 0xd4, 0xa4, 0x00, 0xd8, 0x11, 0x44, 0xde, 0xe4, 0x41,
+    0x6f, 0x01, 0x44, 0x08, 0xad, 0xc1, 0x6f, 0x0d, 0x43, 0x00, 0x29, 0xc1,
+    0x6f, 0x19, 0xc8, 0xa9, 0x3e, 0x0b, 0x57, 0x90, 0x8b, 0x0b, 0x57, 0x69,
+    0x87, 0x0b, 0x57, 0x63, 0x01, 0x6f, 0x25, 0x97, 0x0b, 0x57, 0x53, 0x01,
+    0x6f, 0x2f, 0x91, 0x0b, 0x57, 0x43, 0x01, 0x6f, 0x35, 0x83, 0x0b, 0x57,
+    0x39, 0xc2, 0x00, 0x71, 0x0b, 0x56, 0xdb, 0x01, 0x6f, 0x39, 0xc2, 0x04,
+    0xf2, 0x0b, 0x57, 0x29, 0x1b, 0xc1, 0x6f, 0x3f, 0xc2, 0x57, 0xe3, 0x0b,
+    0x57, 0x19, 0xc2, 0x00, 0xa0, 0x0b, 0x57, 0x11, 0xc2, 0x00, 0x5d, 0x0b,
+    0x57, 0x09, 0xc2, 0x01, 0x0e, 0x0b, 0x56, 0xf9, 0x06, 0xc1, 0x6f, 0x4b,
+    0x09, 0xc1, 0x6f, 0x55, 0xc2, 0x00, 0x4e, 0x0b, 0x56, 0xe1, 0xc4, 0xdf,
+    0x78, 0x0b, 0x56, 0xd1, 0xc2, 0x07, 0xd1, 0x0b, 0x56, 0xc9, 0x0d, 0xc1,
+    0x6f, 0x61, 0xc3, 0x03, 0xb2, 0x0b, 0x56, 0xa1, 0xc2, 0x04, 0x70, 0x0b,
+    0x56, 0x99, 0xc2, 0x00, 0x42, 0x0b, 0x56, 0x90, 0x45, 0xde, 0x04, 0xc1,
+    0x6f, 0x6b, 0x83, 0x05, 0x35, 0x59, 0x07, 0xc1, 0x6f, 0x8f, 0x17, 0xc1,
+    0x6f, 0x99, 0x8b, 0x05, 0x36, 0xe8, 0x83, 0x05, 0x35, 0x09, 0x97, 0x05,
+    0x35, 0x19, 0xc3, 0xa7, 0xa2, 0x05, 0x35, 0xd1, 0x07, 0xc1, 0x6f, 0xa3,
+    0x91, 0x05, 0x36, 0xfb, 0x01, 0x6f, 0xb1, 0x8b, 0x05, 0x37, 0x29, 0xc2,
+    0x04, 0xf2, 0x05, 0x37, 0x48, 0x07, 0xc1, 0x6f, 0xbd, 0x0b, 0xc1, 0x6f,
+    0xcb, 0x97, 0x05, 0x36, 0x61, 0xc2, 0x20, 0xc5, 0x05, 0x36, 0x88, 0x03,
+    0xc1, 0x6f, 0xd5, 0x8b, 0x05, 0x37, 0x21, 0x07, 0x41, 0x6f, 0xdd, 0xc2,
+    0x13, 0x1a, 0x05, 0x35, 0x41, 0xc3, 0x51, 0x11, 0x05, 0x35, 0x89, 0x0c,
+    0xc1, 0x6f, 0xe5, 0x97, 0x05, 0x35, 0xeb, 0x01, 0x6f, 0xf7, 0xc3, 0x02,
+    0xea, 0x05, 0x36, 0x19, 0x16, 0xc1, 0x6f, 0xfd, 0x8b, 0x05, 0x36, 0x79,
+    0x09, 0xc1, 0x70, 0x09, 0x83, 0x05, 0x36, 0xd8, 0x83, 0x05, 0x35, 0x51,
+    0xc4, 0xe0, 0xd0, 0x05, 0x35, 0x71, 0x97, 0x05, 0x36, 0x69, 0x8b, 0x05,
+    0x36, 0xe1, 0xc2, 0x88, 0xb0, 0x05, 0x36, 0xf0, 0x07, 0xc1, 0x70, 0x19,
+    0x97, 0x05, 0x35, 0xa9, 0x8b, 0x05, 0x36, 0x71, 0x04, 0xc1, 0x70, 0x23,
+    0x83, 0x05, 0x37, 0x19, 0x91, 0x05, 0x37, 0x30, 0xc2, 0x74, 0x8f, 0x05,
+    0x35, 0xa1, 0x0a, 0xc1, 0x70, 0x2f, 0x8b, 0x05, 0x35, 0xb9, 0xc3, 0xd9,
+    0x3d, 0x05, 0x35, 0xc9, 0xc4, 0xc3, 0x89, 0x05, 0x37, 0x60, 0xc2, 0x88,
+    0xb0, 0x05, 0x35, 0xf9, 0xc2, 0x59, 0x41, 0x05, 0x36, 0x09, 0x83, 0x05,
+    0x36, 0x10, 0xc2, 0x0e, 0x21, 0x05, 0x36, 0x49, 0x83, 0x05, 0x36, 0xd0,
+    0xc2, 0x00, 0xc8, 0x05, 0x36, 0x59, 0x97, 0x05, 0x36, 0xc1, 0xc2, 0x04,
+    0x0d, 0x05, 0x36, 0xc9, 0xc5, 0xd8, 0x9b, 0x05, 0x37, 0x68, 0x4c, 0x89,
+    0xe8, 0xc1, 0x70, 0x43, 0xc2, 0x00, 0xb6, 0x05, 0x37, 0xa8, 0xe0, 0x02,
+    0xe9, 0x01, 0x3d, 0x58, 0xcb, 0x8d, 0xd8, 0x0f, 0xac, 0x11, 0xda, 0x1c,
+    0x06, 0x0f, 0xa8, 0xc8, 0xc4, 0x40, 0x52, 0x00, 0x00, 0x41, 0x5a, 0x1c,
+    0x20, 0x41, 0x70, 0x4f, 0x4c, 0x8c, 0x1c, 0xc1, 0x70, 0x5b, 0xc9, 0xab,
+    0xb3, 0x00, 0xdf, 0x30, 0xc7, 0xc0, 0x0e, 0x00, 0xdf, 0x99, 0xc5, 0xc6,
+    0xfb, 0x00, 0xdf, 0x90, 0x8a, 0x00, 0xdf, 0x89, 0xc2, 0x00, 0xb2, 0x00,
+    0xdf, 0x80, 0x97, 0x00, 0xdf, 0x73, 0x01, 0x70, 0x6b, 0x45, 0xc8, 0x57,
+    0xc1, 0x70, 0x71, 0x91, 0x00, 0xdf, 0x61, 0x8b, 0x00, 0xdf, 0x51, 0x87,
+    0x00, 0xdf, 0x3b, 0x01, 0x70, 0x79, 0xc8, 0xb7, 0x38, 0x00, 0xdf, 0x40,
+    0x97, 0x00, 0xdf, 0x29, 0x8b, 0x00, 0xdf, 0x21, 0x0f, 0xc1, 0x70, 0x7d,
+    0x10, 0xc1, 0x70, 0x8a, 0xc2, 0x03, 0xc6, 0x00, 0xdf, 0x09, 0x15, 0xc1,
+    0x70, 0xa6, 0xc2, 0x00, 0x89, 0x00, 0xde, 0xf1, 0xc2, 0x1a, 0x18, 0x00,
+    0xde, 0xd9, 0xc2, 0x00, 0x3b, 0x00, 0xde, 0x91, 0xc2, 0x0e, 0x60, 0x00,
+    0xde, 0x89, 0xc2, 0x21, 0x7d, 0x00, 0xde, 0x81, 0xc2, 0x00, 0xeb, 0x00,
+    0xde, 0x71, 0xc2, 0x04, 0xf2, 0x00, 0xde, 0x3b, 0x01, 0x70, 0xb6, 0xc2,
+    0x00, 0x71, 0x00, 0xde, 0x59, 0xc7, 0xc8, 0x57, 0x00, 0xde, 0x31, 0xc2,
+    0x00, 0xa0, 0x00, 0xde, 0x29, 0xc2, 0x00, 0xce, 0x00, 0xde, 0x11, 0x83,
+    0x00, 0xde, 0x00, 0xe0, 0x08, 0x89, 0x01, 0x5a, 0xf0, 0xc3, 0x7a, 0x77,
+    0x00, 0x4c, 0x01, 0xcd, 0x73, 0x89, 0x00, 0x4e, 0xb9, 0xd0, 0x4f, 0x8d,
+    0x00, 0x4f, 0xe8, 0x44, 0x00, 0x8e, 0xc1, 0x70, 0xbc, 0xca, 0x9a, 0x16,
+    0x00, 0x4f, 0xf0, 0x83, 0x00, 0x4c, 0x2b, 0x01, 0x70, 0xd2, 0x8b, 0x00,
+    0x4c, 0x3b, 0x01, 0x70, 0xde, 0x97, 0x00, 0x4c, 0x4b, 0x01, 0x70, 0xe2,
+    0x18, 0xc1, 0x70, 0xe6, 0x87, 0x00, 0x4c, 0x79, 0x91, 0x00, 0x4c, 0x99,
+    0x0d, 0xc1, 0x70, 0xf2, 0x09, 0xc1, 0x70, 0xff, 0x10, 0xc1, 0x71, 0x09,
+    0x05, 0xc1, 0x71, 0x1f, 0x0c, 0xc1, 0x71, 0x29, 0x16, 0xc1, 0x71, 0x33,
+    0x06, 0xc1, 0x71, 0x41, 0x12, 0xc1, 0x71, 0x4f, 0x04, 0xc1, 0x71, 0x59,
+    0xc2, 0x00, 0xb6, 0x00, 0x4d, 0x71, 0x1b, 0xc1, 0x71, 0x63, 0x14, 0xc1,
+    0x71, 0x6d, 0xc2, 0x00, 0x89, 0x00, 0x4d, 0x91, 0x15, 0xc1, 0x71, 0x80,
+    0xc2, 0x00, 0xce, 0x00, 0x4d, 0xc8, 0x03, 0xc1, 0x71, 0x90, 0x8b, 0x00,
+    0x4d, 0xfb, 0x01, 0x71, 0x9c, 0x97, 0x00, 0x4e, 0x0b, 0x01, 0x71, 0xa0,
+    0x48, 0xaa, 0xd2, 0xc1, 0x71, 0xa4, 0x87, 0x00, 0x4e, 0x39, 0x91, 0x00,
+    0x4e, 0x58, 0xc4, 0x18, 0xa7, 0x00, 0x4f, 0x31, 0xc3, 0x05, 0x16, 0x00,
+    0x4f, 0x39, 0x16, 0xc1, 0x71, 0xb2, 0x08, 0xc1, 0x71, 0xbe, 0x15, 0xc1,
+    0x71, 0xca, 0xc5, 0x0a, 0xfd, 0x00, 0x4f, 0x71, 0xc4, 0x28, 0x74, 0x00,
+    0x4f, 0x78, 0xc4, 0x01, 0x65, 0x00, 0x4f, 0x91, 0xc4, 0x00, 0x8d, 0x00,
+    0x4f, 0x98, 0x4a, 0x7b, 0xc6, 0xc1, 0x71, 0xd6, 0xd3, 0x43, 0xc0, 0x00,
+    0x4f, 0xc8, 0xc2, 0x20, 0xc5, 0x00, 0xd0, 0xd9, 0x91, 0x00, 0xd0, 0xd1,
+    0x87, 0x00, 0xd0, 0xc9, 0x97, 0x00, 0xd0, 0xc1, 0x8b, 0x00, 0xd0, 0xb8,
+    0xc2, 0x00, 0xce, 0x00, 0xd0, 0xb1, 0x83, 0x00, 0xd0, 0xa9, 0xc2, 0x0d,
+    0x01, 0x00, 0xd0, 0xa1, 0xc2, 0x02, 0x63, 0x00, 0xd0, 0x99, 0xc2, 0x00,
+    0x89, 0x00, 0xd0, 0x91, 0xc2, 0x00, 0x3b, 0x00, 0xd0, 0x89, 0xc2, 0x1a,
+    0x18, 0x00, 0xd0, 0x81, 0x10, 0xc1, 0x71, 0xe9, 0xc2, 0x21, 0x7d, 0x00,
+    0xd0, 0x69, 0xc2, 0x03, 0xc6, 0x00, 0xd0, 0x61, 0xc2, 0x0e, 0x60, 0x00,
+    0xd0, 0x49, 0xc2, 0x00, 0x51, 0x00, 0xd0, 0x41, 0x0f, 0xc1, 0x71, 0xfb,
+    0xc2, 0x00, 0xa0, 0x00, 0xd0, 0x29, 0xc2, 0x04, 0xf2, 0x00, 0xd0, 0x21,
+    0xc2, 0x00, 0xeb, 0x00, 0xd0, 0x09, 0xc2, 0x02, 0x4d, 0x00, 0xd0, 0x00,
+    0x83, 0x00, 0xba, 0x41, 0xc2, 0x00, 0xeb, 0x00, 0xba, 0x28, 0x45, 0xd6,
+    0xfc, 0xc1, 0x72, 0x05, 0xc5, 0xd5, 0xa8, 0x01, 0x40, 0x00, 0xc6, 0x58,
+    0xbc, 0x08, 0x83, 0xf9, 0xc3, 0x05, 0x16, 0x08, 0x82, 0x93, 0x01, 0x72,
+    0x3a, 0xc4, 0x28, 0x74, 0x08, 0x82, 0xd3, 0x01, 0x72, 0x3e, 0xc5, 0x0a,
+    0xfd, 0x08, 0x82, 0xcb, 0x01, 0x72, 0x44, 0x15, 0xc1, 0x72, 0x48, 0x08,
+    0xc1, 0x72, 0x5a, 0x16, 0x41, 0x72, 0x62, 0x91, 0x08, 0x80, 0x8b, 0x01,
+    0x72, 0x70, 0x0e, 0xc1, 0x72, 0x76, 0xc2, 0x00, 0xce, 0x08, 0x81, 0x99,
+    0xc2, 0x00, 0x3b, 0x08, 0x81, 0x69, 0xc2, 0x1a, 0x18, 0x08, 0x81, 0x61,
+    0xc2, 0x00, 0xb6, 0x08, 0x81, 0x59, 0x04, 0xc1, 0x72, 0x80, 0x12, 0xc1,
+    0x72, 0x8a, 0x10, 0xc1, 0x72, 0x94, 0x06, 0xc1, 0x72, 0xaa, 0x16, 0xc1,
+    0x72, 0xb8, 0x0c, 0xc1, 0x72, 0xc6, 0x05, 0xc1, 0x72, 0xd0, 0x09, 0xc1,
+    0x72, 0xda, 0x0d, 0xc1, 0x72, 0xe4, 0x83, 0x08, 0x80, 0x2b, 0x01, 0x72,
+    0xee, 0x87, 0x08, 0x80, 0x79, 0x18, 0xc1, 0x72, 0xfa, 0x97, 0x08, 0x80,
+    0x4b, 0x01, 0x73, 0x04, 0x8b, 0x08, 0x80, 0x3b, 0x01, 0x73, 0x08, 0x15,
+    0x41, 0x73, 0x0c, 0x4a, 0x6e, 0xbc, 0xc1, 0x73, 0x1c, 0xc5, 0x1f, 0xf6,
+    0x08, 0x82, 0x30, 0xd0, 0x5c, 0x82, 0x08, 0x83, 0x81, 0xcb, 0x98, 0x33,
+    0x08, 0x80, 0x21, 0xcb, 0x92, 0xf5, 0x08, 0x80, 0x19, 0xcb, 0x1f, 0xe9,
+    0x08, 0x80, 0x01, 0xc8, 0x14, 0x02, 0x08, 0x80, 0x09, 0xc7, 0x40, 0xae,
+    0x08, 0x80, 0x10, 0x45, 0x04, 0x9a, 0xc1, 0x73, 0x45, 0xcb, 0x8c, 0xe6,
+    0x08, 0x82, 0x41, 0xc4, 0x19, 0xf1, 0x08, 0x82, 0x38, 0x0e, 0xc1, 0x73,
+    0x69, 0xcc, 0x80, 0xa0, 0x08, 0x82, 0x61, 0x42, 0x00, 0xd8, 0x41, 0x73,
+    0x75, 0x42, 0x14, 0x10, 0xc1, 0x73, 0x7f, 0x4a, 0xa5, 0xec, 0x41, 0x73,
+    0x8b, 0xc6, 0x2f, 0x8c, 0x0e, 0x86, 0xc9, 0xc6, 0xcf, 0x6e, 0x0e, 0x86,
+    0xc0, 0x01, 0x41, 0x73, 0x97, 0x01, 0xc1, 0x73, 0xa3, 0xc2, 0x00, 0x51,
+    0x0e, 0x80, 0x82, 0x01, 0x73, 0xaf, 0xc5, 0x5c, 0xcd, 0x0e, 0x84, 0x49,
+    0xc6, 0xb0, 0xb4, 0x0e, 0x82, 0x51, 0xc6, 0xcb, 0xde, 0x0e, 0x81, 0xd2,
+    0x01, 0x73, 0xb3, 0x44, 0xae, 0xd3, 0xc1, 0x73, 0xb9, 0xc6, 0xd0, 0x94,
+    0x0e, 0x80, 0x60, 0x43, 0x0f, 0x28, 0xc1, 0x73, 0xc1, 0xc5, 0xdd, 0x8c,
+    0x0e, 0x80, 0x38, 0x46, 0xcf, 0xe6, 0xc1, 0x73, 0xcd, 0x42, 0x14, 0x10,
+    0x41, 0x73, 0xf7, 0x11, 0xc1, 0x74, 0x01, 0xc2, 0x00, 0xdf, 0x0e, 0x84,
+    0x29, 0x45, 0xd6, 0x4d, 0x41, 0x74, 0x13, 0x45, 0xd4, 0x2c, 0xc1, 0x74,
+    0x1f, 0x44, 0xcb, 0xa2, 0xc1, 0x74, 0x2b, 0x42, 0x00, 0xf1, 0xc1, 0x74,
+    0x35, 0x43, 0x14, 0x0e, 0x41, 0x74, 0x41, 0x46, 0xd1, 0xc6, 0xc1, 0x74,
+    0x4b, 0xca, 0x9d, 0x9a, 0x0e, 0x81, 0x40, 0xc4, 0x1d, 0x4d, 0x0e, 0x87,
+    0x41, 0xc5, 0xd5, 0x58, 0x0e, 0x83, 0xf3, 0x01, 0x74, 0x57, 0xca, 0xa2,
+    0xe0, 0x0e, 0x82, 0x20, 0xc6, 0xd2, 0xf2, 0x0e, 0x87, 0x13, 0x01, 0x74,
+    0x5d, 0xc7, 0xc4, 0xfa, 0x0e, 0x86, 0xf2, 0x01, 0x74, 0x61, 0xc4, 0x7c,
+    0x10, 0x0e, 0x83, 0x48, 0xc3, 0x04, 0x6b, 0x0e, 0x83, 0x33, 0x01, 0x74,
+    0x65, 0x10, 0x41, 0x74, 0x6b, 0xca, 0x9c, 0xf0, 0x0e, 0x87, 0x39, 0x09,
+    0xc1, 0x74, 0x77, 0x03, 0xc1, 0x74, 0x86, 0x45, 0x1a, 0x3f, 0xc1, 0x74,
+    0x92, 0xc3, 0x1d, 0xa8, 0x0e, 0x84, 0x32, 0x01, 0x74, 0xa8, 0x44, 0x1a,
+    0x40, 0xc1, 0x74, 0xae, 0x42, 0x00, 0x48, 0x41, 0x74, 0xc6, 0x11, 0xc1,
+    0x74, 0xd2, 0xc4, 0x7c, 0xca, 0x0e, 0x82, 0x80, 0xd4, 0x3e, 0xaa, 0x0e,
+    0x86, 0x61, 0xd6, 0x2f, 0x8a, 0x0e, 0x86, 0x59, 0x10, 0xc1, 0x74, 0xe1,
+    0x48, 0x19, 0x68, 0xc1, 0x74, 0xed, 0x4f, 0x66, 0xfb, 0xc1, 0x74, 0xf9,
+    0x4a, 0xa7, 0x04, 0xc1, 0x75, 0x05, 0xc8, 0x9d, 0xec, 0x0e, 0x81, 0xa2,
+    0x01, 0x75, 0x21, 0xc8, 0xb6, 0x48, 0x0e, 0x85, 0x81, 0xca, 0x9f, 0x0c,
+    0x0e, 0x85, 0x79, 0xcb, 0x90, 0x4b, 0x0e, 0x85, 0x70, 0xc6, 0xcb, 0x78,
+    0x0e, 0x86, 0x51, 0xc6, 0xd2, 0xe6, 0x0e, 0x86, 0x49, 0xc5, 0xd8, 0x3c,
+    0x0e, 0x86, 0x40, 0xc3, 0x55, 0xc8, 0x0e, 0x83, 0x39, 0xc8, 0x9d, 0xec,
+    0x0e, 0x81, 0xd8, 0x8b, 0x0e, 0x82, 0xb1, 0xc2, 0x00, 0x47, 0x0e, 0x80,
+    0xc0, 0x08, 0xc1, 0x75, 0x27, 0xc7, 0xc0, 0x1c, 0x0e, 0x84, 0xc0, 0xd5,
+    0x33, 0x6a, 0x0e, 0x85, 0x61, 0x43, 0x00, 0x47, 0x41, 0x75, 0x33, 0xd4,
+    0x3a, 0x9a, 0x0e, 0x85, 0xb1, 0xc7, 0xc6, 0x19, 0x0e, 0x83, 0xd8, 0xcd,
+    0x75, 0x53, 0x0e, 0x83, 0xa1, 0xcb, 0x90, 0x35, 0x0e, 0x83, 0x00, 0x12,
+    0xc1, 0x75, 0x3f, 0xcb, 0x95, 0xaa, 0x0e, 0x85, 0x89, 0xcd, 0x7e, 0x1c,
+    0x0e, 0x85, 0x51, 0x16, 0xc1, 0x75, 0x4b, 0x45, 0xd9, 0x1d, 0xc1, 0x75,
+    0x57, 0xce, 0x6e, 0x9c, 0x0e, 0x85, 0x20, 0x0b, 0xc1, 0x75, 0x63, 0x45,
+    0xb3, 0xcc, 0x41, 0x75, 0x73, 0xc6, 0xd2, 0x7a, 0x0e, 0x84, 0x41, 0xc5,
+    0x13, 0x7d, 0x0e, 0x81, 0x89, 0xc4, 0xb2, 0xf6, 0x0e, 0x80, 0x78, 0x07,
+    0xc1, 0x75, 0x89, 0xc3, 0x02, 0x66, 0x0e, 0x80, 0xa0, 0x45, 0xda, 0xd5,
+    0xc1, 0x75, 0x98, 0xc3, 0xbc, 0x9a, 0x0e, 0x81, 0x70, 0xc3, 0x55, 0xc8,
+    0x0e, 0x83, 0xa9, 0xc8, 0x9d, 0xec, 0x0e, 0x81, 0x60, 0x01, 0xc1, 0x75,
+    0xae, 0xca, 0x9d, 0xea, 0x0e, 0x81, 0x00, 0xc3, 0x55, 0xc8, 0x0e, 0x82,
+    0x39, 0xc8, 0x9d, 0xec, 0x0e, 0x80, 0xa8, 0x45, 0xba, 0xda, 0xc1, 0x75,
+    0xc0, 0x0e, 0x41, 0x75, 0xd9, 0x42, 0x07, 0x42, 0xc1, 0x75, 0xe3, 0xc5,
+    0xdd, 0xaa, 0x0e, 0x80, 0xf0, 0xc3, 0x55, 0xc8, 0x0e, 0x82, 0xc9, 0xc8,
+    0x9d, 0xec, 0x0e, 0x81, 0x30, 0xc6, 0xd1, 0x2a, 0x0e, 0x81, 0xc3, 0x01,
+    0x75, 0xf2, 0x43, 0x03, 0x67, 0xc1, 0x75, 0xf8, 0xc9, 0x95, 0xd8, 0x0e,
+    0x80, 0x10, 0x01, 0xc1, 0x76, 0x02, 0xca, 0x9d, 0xea, 0x0e, 0x81, 0x08,
+    0xc2, 0x0c, 0xf3, 0x08, 0xe3, 0x48, 0xc2, 0x0c, 0xf3, 0x08, 0xe3, 0x40,
+    0xc3, 0x43, 0x20, 0x08, 0xe3, 0x39, 0xc2, 0x00, 0x98, 0x08, 0xe2, 0xf0,
+    0xc3, 0x0c, 0xf2, 0x08, 0xe3, 0x31, 0xc2, 0x00, 0x35, 0x08, 0xe2, 0xe8,
+    0xc4, 0x0c, 0xf1, 0x08, 0xe3, 0x29, 0xc3, 0x03, 0xe1, 0x08, 0xe2, 0xe0,
+    0xc4, 0x17, 0xf9, 0x08, 0xe3, 0x21, 0x91, 0x08, 0xe2, 0xd8, 0xc4, 0x17,
+    0xf7, 0x08, 0xe2, 0xb9, 0xc2, 0x24, 0x36, 0x08, 0xe2, 0xb0, 0xc3, 0x0c,
+    0xf7, 0x08, 0xe2, 0xa9, 0xc3, 0x04, 0xa0, 0x08, 0xe2, 0xa0, 0xc4, 0x03,
+    0xe0, 0x08, 0xe2, 0x99, 0xc2, 0x01, 0xa2, 0x08, 0xe2, 0x90, 0x94, 0x08,
+    0xe1, 0xa8, 0x8e, 0x08, 0xe0, 0x41, 0x94, 0x08, 0xe0, 0x32, 0x01, 0x76,
+    0x14, 0xc2, 0x00, 0xce, 0x08, 0xe0, 0xd9, 0x83, 0x08, 0xe0, 0xd0, 0xc2,
+    0x00, 0xce, 0x08, 0xe0, 0xc9, 0x83, 0x08, 0xe0, 0xc0, 0x46, 0x00, 0xc1,
+    0xc1, 0x76, 0x18, 0x04, 0xc1, 0x76, 0x24, 0xd5, 0x35, 0xf5, 0x01, 0x2e,
+    0xf9, 0xc6, 0xcf, 0x14, 0x0f, 0xac, 0x69, 0x12, 0xc1, 0x76, 0x30, 0xcc,
+    0x8c, 0x10, 0x0f, 0xac, 0x59, 0xe0, 0x04, 0x49, 0x01, 0x49, 0xf8, 0x46,
+    0x00, 0xc1, 0xc1, 0x76, 0x3c, 0xcf, 0x63, 0xe0, 0x01, 0x3e, 0x99, 0x15,
+    0xc1, 0x76, 0x48, 0xda, 0x1d, 0x24, 0x01, 0x3a, 0x79, 0xc6, 0xcc, 0xe6,
+    0x01, 0x38, 0x71, 0xd5, 0x35, 0xf5, 0x01, 0x2e, 0xf1, 0x4f, 0x60, 0xd4,
+    0x41, 0x76, 0x54, 0xdb, 0x15, 0xce, 0x0f, 0xdb, 0x79, 0x45, 0x03, 0xe0,
+    0x41, 0x76, 0x60, 0xc6, 0x00, 0x7c, 0x01, 0x2f, 0x09, 0xd4, 0x39, 0x46,
+    0x01, 0x2e, 0xd9, 0xc5, 0x06, 0x84, 0x01, 0x2c, 0x21, 0xcc, 0x04, 0x3d,
+    0x0f, 0xdc, 0x78, 0xcd, 0x15, 0xdc, 0x01, 0x2c, 0x11, 0xcc, 0x0a, 0xfd,
+    0x01, 0x2c, 0x08, 0xc6, 0xd0, 0xb2, 0x0f, 0xd5, 0x59, 0xd0, 0x53, 0xef,
+    0x0f, 0xa8, 0x28, 0xc9, 0x33, 0x31, 0x01, 0x72, 0x40, 0xce, 0x74, 0x68,
+    0x01, 0x3f, 0xf9, 0xcc, 0x84, 0x84, 0x01, 0x3f, 0xcb, 0x01, 0x76, 0x6c,
+    0xc5, 0x00, 0x83, 0x01, 0x3f, 0xb2, 0x01, 0x76, 0x72, 0xcc, 0x84, 0x84,
+    0x01, 0x3f, 0xc3, 0x01, 0x76, 0x78, 0xc5, 0x00, 0x83, 0x01, 0x3f, 0xab,
+    0x01, 0x76, 0x7e, 0xce, 0x74, 0x68, 0x01, 0x59, 0x98, 0x46, 0x01, 0x78,
+    0xc1, 0x76, 0x84, 0xc4, 0x32, 0xbe, 0x01, 0x3e, 0xf0, 0xe0, 0x03, 0xa9,
+    0x01, 0x57, 0x30, 0x45, 0x00, 0x92, 0xc1, 0x76, 0x90, 0xd7, 0x29, 0x70,
+    0x01, 0x52, 0xc8, 0x42, 0x00, 0xd8, 0xc1, 0x76, 0xa2, 0xcb, 0x92, 0xdf,
+    0x01, 0x52, 0xd1, 0xcf, 0x62, 0xa5, 0x01, 0x52, 0xe1, 0xc8, 0x50, 0x50,
+    0x01, 0x52, 0xf8, 0x10, 0xc1, 0x76, 0xae, 0x14, 0x41, 0x76, 0xb8, 0x43,
+    0x04, 0x32, 0xc1, 0x76, 0xc4, 0xd5, 0x35, 0x0e, 0x0f, 0xab, 0xd8, 0x45,
+    0x01, 0x79, 0xc1, 0x76, 0xeb, 0xd6, 0x26, 0xd6, 0x01, 0x70, 0x60, 0xc9,
+    0x9c, 0x29, 0x01, 0x3e, 0xa9, 0x43, 0x00, 0xe1, 0x41, 0x77, 0x19, 0xd5,
+    0x32, 0xec, 0x01, 0x3e, 0x29, 0x07, 0xc1, 0x77, 0x25, 0xcd, 0x22, 0x38,
+    0x00, 0x02, 0xdb, 0x01, 0x77, 0x31, 0x0b, 0xc1, 0x77, 0x35, 0xcc, 0x74,
+    0x4d, 0x0f, 0xaf, 0x41, 0xd3, 0x1d, 0xf4, 0x01, 0x70, 0x10, 0xcb, 0x91,
+    0x27, 0x01, 0x36, 0xe1, 0xcc, 0x00, 0x35, 0x00, 0x03, 0xdb, 0x01, 0x77,
+    0x41, 0xc6, 0xbe, 0xd9, 0x01, 0x18, 0x41, 0xcd, 0x69, 0xfa, 0x01, 0x80,
+    0x60, 0x0a, 0xc1, 0x77, 0x45, 0xc3, 0x00, 0x3c, 0x01, 0x15, 0x19, 0x14,
+    0xc1, 0x77, 0x57, 0xd5, 0x06, 0xeb, 0x01, 0x80, 0xa0, 0x0b, 0xc1, 0x77,
+    0x63, 0xc4, 0x1f, 0x8a, 0x01, 0x18, 0x50, 0xc7, 0xc5, 0x86, 0x01, 0x1d,
+    0xc1, 0xcd, 0x7e, 0xd2, 0x01, 0x71, 0x00, 0x01, 0x41, 0x77, 0x6f, 0x45,
+    0x03, 0x7c, 0xc1, 0x77, 0x81, 0xd9, 0x1d, 0xee, 0x01, 0x70, 0x20, 0xcb,
+    0x8e, 0xa9, 0x0f, 0xac, 0x71, 0xcb, 0x87, 0x79, 0x01, 0x4e, 0xc1, 0x45,
+    0x00, 0xbc, 0x41, 0x77, 0x99, 0x45, 0x06, 0x65, 0xc1, 0x77, 0xb5, 0x44,
+    0x05, 0x41, 0x41, 0x77, 0xc1, 0xc6, 0xd1, 0x30, 0x0f, 0xb6, 0x29, 0xd5,
+    0x2d, 0x23, 0x01, 0x70, 0xe0, 0xca, 0x03, 0x3f, 0x01, 0x0f, 0x33, 0x01,
+    0x77, 0xcd, 0xc9, 0xa8, 0xda, 0x01, 0x0c, 0xe0, 0x42, 0x00, 0x4c, 0xc1,
+    0x77, 0xd3, 0x42, 0x01, 0xa2, 0xc1, 0x77, 0xdf, 0xd5, 0x38, 0x17, 0x0f,
+    0xc5, 0x10, 0x01, 0xc1, 0x77, 0xeb, 0xc5, 0x14, 0xc3, 0x01, 0x48, 0xc8,
+    0xc5, 0xd0, 0x59, 0x0f, 0xb3, 0x61, 0xd7, 0x28, 0xb8, 0x0f, 0xc5, 0x30,
+    0xcb, 0x84, 0xcd, 0x01, 0x0f, 0x01, 0x46, 0x03, 0x7b, 0x41, 0x78, 0x08,
+    0x42, 0x00, 0xe5, 0xc1, 0x78, 0x17, 0xcf, 0x5b, 0xf3, 0x0f, 0xc2, 0x80,
+    0x03, 0xc1, 0x78, 0x23, 0x45, 0x10, 0xe5, 0x41, 0x78, 0x2f, 0x45, 0x06,
+    0x65, 0xc1, 0x78, 0x3b, 0xd8, 0x20, 0xf5, 0x0f, 0xc5, 0x01, 0xdf, 0x0c,
+    0xa5, 0x0f, 0xc5, 0x40, 0xd0, 0x51, 0x9c, 0x0f, 0xc1, 0xa1, 0xe0, 0x03,
+    0x29, 0x0f, 0xc5, 0x50, 0xd0, 0x5a, 0x62, 0x0f, 0xa8, 0x69, 0xcd, 0x08,
+    0x53, 0x01, 0x19, 0x49, 0xd4, 0x3b, 0x8a, 0x01, 0x4f, 0xe1, 0xdb, 0x15,
+    0x62, 0x00, 0x05, 0x58, 0xdc, 0x14, 0x17, 0x01, 0x3d, 0x51, 0xdb, 0x16,
+    0x04, 0x01, 0x49, 0xc8, 0xc7, 0x02, 0x1c, 0x01, 0x03, 0x31, 0xc8, 0xbf,
+    0x08, 0x01, 0x01, 0x69, 0xc9, 0xa8, 0xb6, 0x01, 0x01, 0x51, 0xc4, 0x01,
+    0x65, 0x01, 0x00, 0x70, 0xd6, 0x31, 0x16, 0x00, 0x2c, 0x71, 0xc4, 0xba,
+    0xda, 0x0f, 0xc8, 0xd9, 0xcb, 0x93, 0x8f, 0x00, 0x7e, 0xb2, 0x01, 0x78,
+    0x47, 0xcc, 0x06, 0x09, 0x01, 0x13, 0xb1, 0x43, 0x00, 0xe4, 0xc1, 0x78,
+    0x4d, 0xd0, 0x5d, 0xd2, 0x01, 0x53, 0xeb, 0x01, 0x78, 0x59, 0xcb, 0x1c,
+    0x8c, 0x01, 0x54, 0x28, 0xcf, 0x09, 0x5a, 0x01, 0x4b, 0xb1, 0x44, 0x00,
+    0xd8, 0xc1, 0x78, 0x5f, 0x15, 0xc1, 0x78, 0x65, 0x44, 0x06, 0x09, 0x41,
+    0x78, 0x71, 0xd8, 0x23, 0x4d, 0x01, 0x54, 0x39, 0xcf, 0x6a, 0x16, 0x01,
+    0x54, 0x48, 0xc2, 0x0e, 0x60, 0x00, 0xe2, 0x79, 0xc2, 0x01, 0x16, 0x00,
+    0xe0, 0xc9, 0x83, 0x00, 0xe0, 0x60, 0x16, 0xc1, 0x78, 0x77, 0x15, 0xc1,
+    0x78, 0x81, 0xc2, 0x00, 0xce, 0x00, 0xe0, 0x59, 0x83, 0x00, 0xe0, 0x50,
+    0xc2, 0x00, 0xce, 0x00, 0xe1, 0x09, 0x83, 0x00, 0xe1, 0x00, 0xc2, 0x00,
+    0x89, 0x00, 0xe0, 0xf1, 0x83, 0x00, 0xe0, 0xe8, 0xc2, 0x00, 0x89, 0x00,
+    0xe0, 0xb1, 0x83, 0x00, 0xe0, 0xa8, 0xc2, 0x00, 0x89, 0x00, 0xe0, 0xa1,
+    0x83, 0x00, 0xe0, 0x98, 0xc2, 0x00, 0x89, 0x00, 0xe0, 0x91, 0x83, 0x00,
+    0xe0, 0x88, 0xc2, 0x00, 0xce, 0x00, 0xe0, 0x81, 0xc2, 0x00, 0x89, 0x00,
+    0xe0, 0x79, 0x83, 0x00, 0xe0, 0x70, 0x83, 0x00, 0xe0, 0x69, 0xc2, 0x1a,
+    0x18, 0x00, 0xe0, 0x49, 0xc2, 0x00, 0xeb, 0x00, 0xe0, 0x28, 0xc2, 0x00,
+    0xce, 0x00, 0xe0, 0x39, 0x83, 0x00, 0xe0, 0x30, 0xc2, 0x00, 0x89, 0x00,
+    0xe0, 0x21, 0x83, 0x00, 0xe0, 0x18, 0xc2, 0x00, 0xce, 0x00, 0xe0, 0x11,
+    0xc2, 0x00, 0x89, 0x00, 0xe0, 0x09, 0x83, 0x00, 0xe0, 0x00, 0xc4, 0x17,
+    0xf7, 0x00, 0xe2, 0x39, 0xc2, 0x24, 0x36, 0x00, 0xe2, 0x30, 0xc3, 0x0c,
+    0xf7, 0x00, 0xe2, 0x29, 0xc3, 0x04, 0xa0, 0x00, 0xe2, 0x20, 0xc4, 0x03,
+    0xe0, 0x00, 0xe2, 0x19, 0xc2, 0x01, 0xa2, 0x00, 0xe2, 0x10, 0xc5, 0xdc,
+    0x5b, 0x00, 0xe1, 0xfb, 0x01, 0x78, 0x8b, 0xc5, 0x4c, 0xa0, 0x00, 0xe1,
+    0xd8, 0xc5, 0x34, 0xd9, 0x00, 0xe1, 0xb9, 0xc3, 0x06, 0x5f, 0x00, 0xe1,
+    0xb0, 0xc2, 0x00, 0x3b, 0x00, 0xe1, 0x29, 0xc2, 0x1a, 0x18, 0x00, 0xe1,
+    0x20, 0xc3, 0x00, 0xc4, 0x00, 0xe1, 0xa8, 0xc6, 0xcf, 0x98, 0x00, 0xe1,
+    0xa0, 0x97, 0x00, 0xe1, 0x58, 0x91, 0x00, 0xe1, 0x48, 0x15, 0xc1, 0x78,
+    0x91, 0xcc, 0x1d, 0x32, 0x0f, 0xbc, 0x71, 0x14, 0xc1, 0x78, 0xa3, 0x44,
+    0x00, 0x2f, 0xc1, 0x78, 0xaf, 0xcc, 0x06, 0xbd, 0x01, 0x3a, 0xc1, 0xca,
+    0x9c, 0xb4, 0x0f, 0xaf, 0xc1, 0xcb, 0x57, 0x87, 0x0f, 0xbd, 0x11, 0x08,
+    0xc1, 0x78, 0xb5, 0xd5, 0x33, 0x94, 0x0f, 0xbd, 0xd9, 0x16, 0x41, 0x78,
+    0xc1, 0xc5, 0xd8, 0x96, 0x0f, 0xaf, 0x92, 0x01, 0x78, 0xcd, 0xc2, 0x00,
+    0xce, 0x08, 0xfd, 0x81, 0x83, 0x05, 0x27, 0x60, 0x83, 0x05, 0x26, 0x89,
+    0xc2, 0x00, 0xce, 0x05, 0x26, 0x90, 0x83, 0x05, 0x26, 0x99, 0xc2, 0x01,
+    0x16, 0x05, 0x26, 0xe0, 0x83, 0x05, 0x26, 0xa1, 0xc2, 0x00, 0xce, 0x05,
+    0x26, 0xa9, 0x15, 0xc1, 0x78, 0xd3, 0x44, 0x05, 0x16, 0x41, 0x78, 0xdd,
+    0x83, 0x05, 0x26, 0xb1, 0xc2, 0x00, 0xce, 0x05, 0x27, 0x68, 0x83, 0x05,
+    0x26, 0xb9, 0xc2, 0x00, 0xce, 0x05, 0x26, 0xc0, 0x83, 0x05, 0x26, 0xd1,
+    0xc2, 0x00, 0xce, 0x05, 0x26, 0xd8, 0x83, 0x05, 0x27, 0x01, 0xc2, 0x00,
+    0xeb, 0x05, 0x27, 0x28, 0x83, 0x05, 0x27, 0x11, 0xc2, 0x00, 0xce, 0x05,
+    0x27, 0x58, 0xc2, 0x00, 0xce, 0x05, 0x27, 0x19, 0x83, 0x05, 0x27, 0x20,
+    0x83, 0x05, 0x27, 0x31, 0xc2, 0x00, 0xce, 0x05, 0x27, 0x40, 0x87, 0x05,
+    0x27, 0x78, 0x97, 0x05, 0x27, 0x88, 0x87, 0x05, 0x27, 0xb8, 0x87, 0x05,
+    0x27, 0xa9, 0x8a, 0x05, 0x27, 0xb0, 0xc9, 0x1b, 0x40, 0x01, 0x01, 0x41,
+    0x4c, 0x82, 0xc8, 0xc1, 0x78, 0xe9, 0xc4, 0x1b, 0x3b, 0x00, 0x00, 0x51,
+    0xca, 0x37, 0x11, 0x00, 0x00, 0x5a, 0x01, 0x78, 0xf5, 0x48, 0xba, 0x30,
+    0xc1, 0x78, 0xfb, 0x42, 0x00, 0xed, 0x41, 0x79, 0x23, 0xc4, 0x28, 0x74,
+    0x00, 0xca, 0x79, 0xc5, 0x0a, 0xfd, 0x00, 0xca, 0x71, 0x15, 0xc1, 0x79,
+    0x35, 0x08, 0xc1, 0x79, 0x41, 0x16, 0xc1, 0x79, 0x4d, 0xc3, 0x05, 0x16,
+    0x00, 0xca, 0x39, 0xc4, 0x18, 0xa7, 0x00, 0xca, 0x30, 0x44, 0x00, 0x8e,
+    0xc1, 0x79, 0x59, 0x4c, 0x28, 0xa8, 0xc1, 0x79, 0x71, 0x50, 0x5e, 0x22,
+    0x41, 0x79, 0x9f, 0x46, 0x00, 0x8c, 0xc1, 0x79, 0xb1, 0xcf, 0x68, 0x72,
+    0x00, 0xc8, 0x00, 0x16, 0xc1, 0x79, 0xce, 0x09, 0xc1, 0x79, 0xde, 0xc2,
+    0x00, 0xce, 0x00, 0xc8, 0xe1, 0x15, 0xc1, 0x79, 0xee, 0xc2, 0x00, 0x71,
+    0x00, 0xc8, 0xc1, 0xc2, 0x00, 0x89, 0x00, 0xc8, 0xb9, 0xc2, 0x00, 0x3b,
+    0x00, 0xc8, 0xb1, 0xc2, 0x1a, 0x18, 0x00, 0xc8, 0xab, 0x01, 0x79, 0xfe,
+    0xc2, 0x00, 0xb6, 0x00, 0xc8, 0xa1, 0x04, 0xc1, 0x7a, 0x02, 0x12, 0xc1,
+    0x7a, 0x0c, 0x10, 0xc1, 0x7a, 0x16, 0x06, 0xc1, 0x7a, 0x20, 0x0c, 0xc1,
+    0x7a, 0x2a, 0x05, 0xc1, 0x7a, 0x34, 0x0d, 0x41, 0x7a, 0x3e, 0x95, 0x08,
+    0x49, 0x70, 0x90, 0x08, 0x49, 0xc0, 0x9b, 0x08, 0x49, 0xb8, 0x90, 0x08,
+    0x49, 0xb0, 0x90, 0x08, 0x49, 0xa8, 0x96, 0x08, 0x49, 0xa0, 0x04, 0xc1,
+    0x7a, 0x48, 0x44, 0x09, 0x2f, 0xc1, 0x7a, 0x54, 0x46, 0x75, 0xff, 0xc1,
+    0x7a, 0x60, 0xc9, 0x32, 0xb9, 0x01, 0x3e, 0xc9, 0xc7, 0xc8, 0x26, 0x01,
+    0x3e, 0xc1, 0xc6, 0x00, 0x7c, 0x01, 0x2f, 0x79, 0x11, 0xc1, 0x7a, 0x6c,
+    0x16, 0xc1, 0x7a, 0x78, 0xd6, 0x2b, 0x96, 0x01, 0x50, 0xf1, 0x47, 0xc6,
+    0xc8, 0xc1, 0x7a, 0x84, 0x47, 0xc9, 0x7d, 0x41, 0x7a, 0x90, 0xcc, 0x24,
+    0x61, 0x01, 0x55, 0x68, 0x0e, 0xc1, 0x7a, 0x9c, 0x4f, 0x09, 0x39, 0x41,
+    0x7a, 0xa8, 0x96, 0x01, 0x04, 0xe1, 0x95, 0x01, 0x04, 0xdb, 0x01, 0x7a,
+    0xb4, 0x92, 0x01, 0x04, 0xd1, 0x90, 0x01, 0x04, 0xc9, 0x8f, 0x01, 0x04,
+    0xc1, 0x8e, 0x01, 0x04, 0xb9, 0x8d, 0x01, 0x04, 0xb1, 0x8a, 0x01, 0x04,
+    0xa9, 0x9a, 0x01, 0x04, 0x99, 0x91, 0x01, 0x04, 0x91, 0x87, 0x01, 0x04,
+    0x89, 0x83, 0x01, 0x04, 0x81, 0x98, 0x00, 0xeb, 0x29, 0x97, 0x00, 0xeb,
+    0x21, 0x94, 0x00, 0xeb, 0x19, 0x8b, 0x00, 0xeb, 0x11, 0x8c, 0x01, 0x63,
+    0xe0, 0x4d, 0x36, 0x7b, 0xc1, 0x7a, 0xba, 0xca, 0xa7, 0x5e, 0x00, 0x14,
+    0xbb, 0x01, 0x7b, 0x39, 0xce, 0x73, 0x5e, 0x05, 0x3c, 0x78, 0x46, 0x00,
+    0x91, 0x41, 0x7b, 0x3f, 0xcd, 0x76, 0x30, 0x00, 0x0e, 0x1b, 0x01, 0x7b,
+    0x4b, 0x47, 0x10, 0xad, 0x41, 0x7b, 0x51, 0xc2, 0x00, 0xaf, 0x00, 0xe9,
+    0x29, 0xcd, 0x79, 0xb1, 0x00, 0x0e, 0x10, 0xcc, 0x22, 0xc9, 0x00, 0x15,
+    0x08, 0x47, 0x7b, 0xee, 0xc1, 0x7b, 0x5d, 0xd1, 0x50, 0x58, 0x00, 0x15,
+    0x68, 0x46, 0x01, 0x93, 0xc1, 0x7b, 0x69, 0x48, 0x1b, 0xd9, 0x41, 0x7c,
+    0x1f, 0x88, 0x05, 0x3f, 0xd9, 0x92, 0x05, 0x3f, 0xe0, 0xc9, 0x51, 0x8b,
+    0x05, 0x3f, 0xe9, 0xc6, 0xcd, 0x6a, 0x05, 0x3f, 0xf0, 0x91, 0x00, 0x74,
+    0x09, 0x0a, 0x41, 0x7c, 0x2b, 0x44, 0x61, 0x33, 0xc1, 0x7c, 0x37, 0x91,
+    0x00, 0x74, 0xd9, 0x43, 0x61, 0x7d, 0x41, 0x7c, 0x63, 0xc2, 0x14, 0x10,
+    0x00, 0x74, 0x39, 0xc2, 0x31, 0xda, 0x00, 0x74, 0x69, 0x91, 0x00, 0x74,
+    0xc8, 0x42, 0x00, 0x5e, 0xc1, 0x7c, 0x6f, 0x49, 0xad, 0x36, 0x41, 0x7c,
+    0x7b, 0x91, 0x00, 0x74, 0xa9, 0x43, 0x61, 0x7d, 0x41, 0x7c, 0x87, 0x08,
+    0xc1, 0x7c, 0x93, 0xc3, 0x31, 0x33, 0x00, 0x74, 0xe9, 0xc4, 0xde, 0x94,
+    0x00, 0x74, 0xf8, 0x42, 0x00, 0x2e, 0x41, 0x7c, 0x9f, 0xc4, 0xde, 0x94,
+    0x00, 0x75, 0x59, 0xc3, 0x31, 0x33, 0x00, 0x75, 0x70, 0x83, 0x00, 0x75,
+    0x91, 0x8f, 0x00, 0x75, 0x99, 0x9b, 0x00, 0x76, 0x19, 0x8b, 0x00, 0x76,
+    0x20, 0xc2, 0x00, 0x6b, 0x00, 0x75, 0x89, 0xc2, 0x00, 0x47, 0x00, 0x75,
+    0xd8, 0x8b, 0x00, 0x75, 0xa8, 0x9b, 0x00, 0x75, 0xb8, 0x97, 0x00, 0x75,
+    0xc8, 0x8b, 0x00, 0x76, 0x08, 0xc2, 0x00, 0x29, 0x00, 0x75, 0xe1, 0xc3,
+    0x4c, 0x6f, 0x00, 0x75, 0xe8, 0xc2, 0x00, 0x4a, 0x00, 0x76, 0x49, 0x8b,
+    0x00, 0x76, 0x50, 0xc2, 0x01, 0xa2, 0x00, 0x76, 0x91, 0xc4, 0x03, 0xe0,
+    0x00, 0x76, 0x98, 0xc3, 0x04, 0xa0, 0x00, 0x76, 0xa1, 0xc3, 0x0c, 0xf7,
+    0x00, 0x76, 0xa8, 0xc2, 0x24, 0x36, 0x00, 0x76, 0xb1, 0xc4, 0x17, 0xf7,
+    0x00, 0x76, 0xb8, 0x45, 0x00, 0xc2, 0xc1, 0x7c, 0xab, 0xd1, 0x49, 0xd6,
+    0x0f, 0xdc, 0xc8, 0x46, 0x06, 0x50, 0xc1, 0x7c, 0xb7, 0x5b, 0x18, 0x71,
+    0x41, 0x7c, 0xc9, 0xc6, 0x09, 0x2b, 0x01, 0x3a, 0x91, 0xc6, 0x00, 0x7c,
+    0x0f, 0xa9, 0xf8, 0xe0, 0x00, 0x29, 0x01, 0x1d, 0x88, 0x45, 0x00, 0xc2,
+    0xc1, 0x7c, 0xd5, 0xd2, 0x45, 0x63, 0x0f, 0xdc, 0xc0, 0x5b, 0x17, 0x12,
+    0xc1, 0x7c, 0xe1, 0x46, 0x00, 0x29, 0x41, 0x7c, 0xed, 0xe0, 0x09, 0xc9,
+    0x01, 0x1d, 0x80, 0x45, 0x00, 0x2a, 0xc1, 0x7c, 0xff, 0x4d, 0x3e, 0x0b,
+    0x41, 0x7d, 0x0b, 0xe0, 0x06, 0x69, 0x0f, 0xdb, 0x40, 0x0f, 0xc1, 0x7d,
+    0x11, 0xcc, 0x0d, 0xa0, 0x01, 0x2e, 0xd0, 0x44, 0x00, 0x6a, 0x41, 0x7d,
+    0x17, 0xcd, 0x46, 0x5f, 0x0f, 0xdc, 0x19, 0xce, 0x06, 0x7b, 0x0f, 0xdc,
+    0x28, 0x01, 0x41, 0x7d, 0x1d, 0xcc, 0x82, 0xe0, 0x01, 0x0f, 0x78, 0x45,
+    0x00, 0xc4, 0xc1, 0x7d, 0x35, 0xc9, 0x66, 0xe3, 0x01, 0x48, 0x50, 0xcd,
+    0x7d, 0x73, 0x01, 0x0c, 0xf9, 0x4e, 0x02, 0xbc, 0x41, 0x7d, 0x41, 0x01,
+    0x41, 0x7d, 0x4d, 0x44, 0x00, 0x2f, 0xc1, 0x7d, 0x6b, 0x45, 0x00, 0x64,
+    0x41, 0x7d, 0x75, 0xd0, 0x5c, 0xd2, 0x0f, 0xc2, 0x09, 0xc5, 0x00, 0x83,
+    0x0f, 0xc2, 0x28, 0x01, 0x41, 0x7d, 0x7f, 0xca, 0xa0, 0x06, 0x01, 0x0d,
+    0x40, 0xcc, 0x86, 0x70, 0x01, 0x4a, 0x89, 0xcd, 0x77, 0x00, 0x01, 0x4a,
+    0x68, 0xcd, 0x77, 0x00, 0x01, 0x4a, 0x79, 0xcc, 0x86, 0x70, 0x01, 0x4a,
+    0x60, 0x45, 0x00, 0x92, 0xc1, 0x7d, 0x8b, 0x46, 0x00, 0xd2, 0xc1, 0x7d,
+    0x9d, 0xdc, 0x14, 0x87, 0x01, 0x52, 0x50, 0xc3, 0x7a, 0xbd, 0x08, 0x1c,
+    0x91, 0xc2, 0x00, 0x06, 0x08, 0x1c, 0xa8, 0xce, 0x62, 0x88, 0x0f, 0xdc,
+    0xb9, 0xde, 0x0e, 0xe8, 0x01, 0x3b, 0x18, 0x45, 0x01, 0x79, 0xc1, 0x7d,
+    0xa9, 0x50, 0x0e, 0xee, 0xc1, 0x7d, 0xbb, 0xca, 0x0f, 0xb0, 0x0f, 0xbf,
+    0x80, 0x45, 0x00, 0xbc, 0xc1, 0x7d, 0xc7, 0xdc, 0x14, 0xbf, 0x01, 0x3d,
+    0xe9, 0xdb, 0x15, 0x98, 0x01, 0x3c, 0xa0, 0x03, 0xc1, 0x7d, 0xd9, 0x45,
+    0x1c, 0x28, 0xc1, 0x7d, 0xe5, 0x0b, 0xc1, 0x7d, 0xf1, 0xc6, 0xb4, 0xd0,
+    0x01, 0x3a, 0x41, 0xda, 0x1b, 0xd2, 0x0f, 0xb3, 0x88, 0x45, 0x1d, 0xe4,
+    0xc1, 0x7d, 0xfd, 0x4e, 0x4d, 0x6b, 0x41, 0x7e, 0x09, 0x03, 0xc1, 0x7e,
+    0x15, 0x42, 0x00, 0x2a, 0xc1, 0x7e, 0x21, 0x43, 0x00, 0x30, 0xc1, 0x7e,
+    0x2b, 0xd8, 0x25, 0xed, 0x0f, 0xb3, 0x98, 0x49, 0x25, 0x8e, 0xc1, 0x7e,
+    0x37, 0xdf, 0x0b, 0x6a, 0x01, 0x3c, 0xf1, 0x4e, 0x23, 0xc5, 0x41, 0x7e,
+    0x43, 0x44, 0x06, 0x65, 0xc1, 0x7e, 0x4f, 0xc7, 0xc7, 0x00, 0x01, 0x38,
+    0xc0, 0x49, 0x2b, 0xae, 0xc1, 0x7e, 0x59, 0x51, 0x05, 0x8b, 0x41, 0x7e,
+    0x5f, 0x45, 0x3f, 0x4a, 0xc1, 0x7e, 0x6b, 0x42, 0x00, 0x61, 0xc1, 0x7e,
+    0x71, 0xc5, 0x00, 0x7d, 0x01, 0x5a, 0xc2, 0x01, 0x7e, 0x7d, 0x46, 0x84,
+    0xcd, 0xc1, 0x7e, 0x89, 0xcc, 0x2c, 0xbe, 0x01, 0x3c, 0xb9, 0x11, 0x41,
+    0x7e, 0x8f, 0xdc, 0x14, 0xa3, 0x01, 0x3c, 0xe1, 0x44, 0x00, 0x65, 0x41,
+    0x7e, 0xa1, 0xc9, 0x66, 0xa1, 0x01, 0x3c, 0xb1, 0xcf, 0x60, 0x20, 0x01,
+    0x38, 0xb0, 0xc7, 0x09, 0x82, 0x01, 0x39, 0x89, 0xd1, 0x33, 0xd7, 0x0f,
+    0xb3, 0xa1, 0x51, 0x47, 0x60, 0x41, 0x7e, 0xb0, 0xd2, 0x47, 0xb9, 0x01,
+    0x39, 0x71, 0xd0, 0x58, 0x82, 0x01, 0x38, 0xe1, 0xd4, 0x3d, 0x42, 0x01,
+    0x5a, 0xb0, 0xdb, 0x17, 0x2d, 0x01, 0x39, 0x21, 0x44, 0x0c, 0xf7, 0x41,
+    0x7e, 0xbf, 0xd1, 0x53, 0x44, 0x01, 0x37, 0xe0, 0xca, 0x98, 0xce, 0x0f,
+    0xa4, 0xf9, 0x45, 0x00, 0x92, 0xc1, 0x7e, 0xcb, 0xc5, 0x07, 0x95, 0x0f,
+    0xd7, 0xb0, 0xa2, 0x0d, 0x87, 0xd1, 0xa1, 0x0d, 0x87, 0xc9, 0xa0, 0x0d,
+    0x87, 0xc1, 0xa5, 0x0d, 0x87, 0xe9, 0xa4, 0x0d, 0x87, 0xe1, 0xa3, 0x0d,
+    0x87, 0xd8, 0xa6, 0x0d, 0x87, 0xb9, 0xa5, 0x0d, 0x87, 0xb1, 0xa4, 0x0d,
+    0x87, 0xa9, 0xa3, 0x0d, 0x87, 0xa1, 0xa2, 0x0d, 0x87, 0x99, 0xa1, 0x0d,
+    0x87, 0x91, 0xa0, 0x0d, 0x87, 0x88, 0xa3, 0x0d, 0x87, 0x81, 0xa2, 0x0d,
+    0x87, 0x79, 0xa1, 0x0d, 0x87, 0x71, 0xa0, 0x0d, 0x87, 0x68, 0xa5, 0x0d,
+    0x88, 0x39, 0xa4, 0x0d, 0x88, 0x31, 0xa3, 0x0d, 0x88, 0x29, 0xa2, 0x0d,
+    0x88, 0x21, 0xa1, 0x0d, 0x88, 0x19, 0xa0, 0x0d, 0x88, 0x10, 0xa3, 0x0d,
+    0x88, 0x09, 0xa2, 0x0d, 0x88, 0x01, 0xa1, 0x0d, 0x87, 0xf9, 0xa0, 0x0d,
+    0x87, 0xf0, 0xa0, 0x0d, 0x85, 0xd1, 0xa7, 0x0d, 0x86, 0x09, 0xa6, 0x0d,
+    0x86, 0x01, 0xa5, 0x0d, 0x85, 0xf9, 0xa4, 0x0d, 0x85, 0xf1, 0xa3, 0x0d,
+    0x85, 0xe9, 0xa2, 0x0d, 0x85, 0xe1, 0xa1, 0x0d, 0x85, 0xd8, 0xa6, 0x0d,
+    0x85, 0xc9, 0xa5, 0x0d, 0x85, 0xc1, 0xa4, 0x0d, 0x85, 0xb9, 0xa3, 0x0d,
+    0x85, 0xb1, 0xa2, 0x0d, 0x85, 0xa9, 0xa1, 0x0d, 0x85, 0xa1, 0xa0, 0x0d,
+    0x85, 0x98, 0xa2, 0x0d, 0x85, 0x91, 0xa1, 0x0d, 0x85, 0x89, 0xa0, 0x0d,
+    0x85, 0x80, 0xa6, 0x0d, 0x85, 0x79, 0xa5, 0x0d, 0x85, 0x71, 0xa4, 0x0d,
+    0x85, 0x69, 0xa3, 0x0d, 0x85, 0x61, 0xa2, 0x0d, 0x85, 0x59, 0xa1, 0x0d,
+    0x85, 0x51, 0xa0, 0x0d, 0x85, 0x48, 0xa0, 0x0d, 0x84, 0xf3, 0x01, 0x7e,
+    0xdd, 0xa8, 0x0d, 0x85, 0x31, 0xa7, 0x0d, 0x85, 0x29, 0xa6, 0x0d, 0x85,
+    0x21, 0xa5, 0x0d, 0x85, 0x19, 0xa4, 0x0d, 0x85, 0x11, 0xa3, 0x0d, 0x85,
+    0x09, 0xa2, 0x0d, 0x85, 0x01, 0xa1, 0x0d, 0x84, 0xf8, 0xa4, 0x0d, 0x84,
+    0xe9, 0xa3, 0x0d, 0x84, 0xe1, 0xa2, 0x0d, 0x84, 0xd9, 0xa1, 0x0d, 0x84,
+    0xd1, 0xa0, 0x0d, 0x84, 0xc8, 0xc2, 0x08, 0x6a, 0x0d, 0x84, 0xc1, 0xa5,
+    0x0d, 0x84, 0xb9, 0xa4, 0x0d, 0x84, 0xb1, 0xa3, 0x0d, 0x84, 0xa9, 0xa2,
+    0x0d, 0x84, 0xa1, 0xa1, 0x0d, 0x84, 0x99, 0xa0, 0x0d, 0x84, 0x90, 0xa2,
+    0x0d, 0x84, 0x89, 0xa1, 0x0d, 0x84, 0x81, 0xa0, 0x0d, 0x84, 0x78, 0xc2,
+    0x00, 0xbe, 0x0d, 0x84, 0x71, 0xa6, 0x0d, 0x84, 0x69, 0xa5, 0x0d, 0x84,
+    0x61, 0xa4, 0x0d, 0x84, 0x59, 0xa3, 0x0d, 0x84, 0x51, 0xa2, 0x0d, 0x84,
+    0x49, 0xa1, 0x0d, 0x84, 0x41, 0xa0, 0x0d, 0x84, 0x38, 0xa8, 0x0d, 0x84,
+    0x31, 0xa7, 0x0d, 0x84, 0x29, 0xa6, 0x0d, 0x84, 0x21, 0xa5, 0x0d, 0x84,
+    0x19, 0xa4, 0x0d, 0x84, 0x11, 0xa3, 0x0d, 0x84, 0x09, 0xa2, 0x0d, 0x84,
+    0x01, 0xa1, 0x0d, 0x83, 0xf9, 0xa0, 0x0d, 0x83, 0xf0, 0xa1, 0x0d, 0x88,
+    0xf1, 0xa0, 0x0d, 0x88, 0xe8, 0xa2, 0x0d, 0x81, 0xd1, 0xa1, 0x0d, 0x81,
+    0xc9, 0xa0, 0x0d, 0x81, 0xc1, 0xc2, 0x0b, 0xd4, 0x0d, 0x81, 0xd8, 0xa5,
+    0x0d, 0x81, 0xb9, 0xa4, 0x0d, 0x81, 0xb1, 0xa3, 0x0d, 0x81, 0xa9, 0xa2,
+    0x0d, 0x81, 0xa1, 0xa1, 0x0d, 0x81, 0x99, 0xa0, 0x0d, 0x81, 0x90, 0xa6,
+    0x0d, 0x81, 0x89, 0xa5, 0x0d, 0x81, 0x81, 0xa4, 0x0d, 0x81, 0x79, 0xa3,
+    0x0d, 0x81, 0x71, 0xa2, 0x0d, 0x81, 0x69, 0xa1, 0x0d, 0x81, 0x61, 0xa0,
+    0x0d, 0x81, 0x58, 0xa7, 0x0d, 0x81, 0x51, 0xa6, 0x0d, 0x81, 0x49, 0xa5,
+    0x0d, 0x81, 0x41, 0xa4, 0x0d, 0x81, 0x39, 0xa3, 0x0d, 0x81, 0x31, 0xa2,
+    0x0d, 0x81, 0x29, 0xa1, 0x0d, 0x81, 0x21, 0xa0, 0x0d, 0x81, 0x18, 0xc2,
+    0x00, 0x3e, 0x0d, 0x81, 0x11, 0xa0, 0x0d, 0x80, 0xbb, 0x01, 0x7e, 0xe5,
+    0xa8, 0x0d, 0x80, 0xf9, 0xa7, 0x0d, 0x80, 0xf1, 0xa6, 0x0d, 0x80, 0xe9,
+    0xa5, 0x0d, 0x80, 0xe1, 0xa4, 0x0d, 0x80, 0xd9, 0xa3, 0x0d, 0x80, 0xd1,
+    0xa2, 0x0d, 0x80, 0xc9, 0xa1, 0x0d, 0x80, 0xc0, 0xa3, 0x0d, 0x88, 0xc9,
+    0xa2, 0x0d, 0x88, 0xc1, 0xa1, 0x0d, 0x88, 0xb9, 0xa0, 0x0d, 0x88, 0xb1,
+    0xa4, 0x0d, 0x88, 0xd1, 0xa5, 0x0d, 0x88, 0xd9, 0xa6, 0x0d, 0x88, 0xe0,
+    0xa3, 0x0d, 0x88, 0xa9, 0xa2, 0x0d, 0x88, 0xa1, 0xa1, 0x0d, 0x88, 0x99,
+    0xa0, 0x0d, 0x88, 0x90, 0xa4, 0x0d, 0x88, 0x89, 0xa3, 0x0d, 0x88, 0x81,
+    0xa2, 0x0d, 0x88, 0x79, 0xa1, 0x0d, 0x88, 0x71, 0xa0, 0x0d, 0x88, 0x68,
+    0xa4, 0x0d, 0x88, 0x61, 0xa3, 0x0d, 0x88, 0x59, 0xa2, 0x0d, 0x88, 0x51,
+    0xa1, 0x0d, 0x88, 0x49, 0xa0, 0x0d, 0x88, 0x40, 0xc2, 0x31, 0xda, 0x0d,
+    0x87, 0x11, 0xa4, 0x0d, 0x87, 0x09, 0xa3, 0x0d, 0x87, 0x01, 0xa2, 0x0d,
+    0x86, 0xf9, 0xa1, 0x0d, 0x86, 0xf1, 0xa0, 0x0d, 0x86, 0xe8, 0xa0, 0x0d,
+    0x87, 0x19, 0xa1, 0x0d, 0x87, 0x21, 0xa2, 0x0d, 0x87, 0x29, 0xa3, 0x0d,
+    0x87, 0x30, 0xa0, 0x0d, 0x87, 0x39, 0xa1, 0x0d, 0x87, 0x41, 0xa2, 0x0d,
+    0x87, 0x49, 0xa3, 0x0d, 0x87, 0x51, 0xa4, 0x0d, 0x87, 0x59, 0xa5, 0x0d,
+    0x87, 0x60, 0xa4, 0x0d, 0x86, 0xd9, 0xa3, 0x0d, 0x86, 0xd1, 0xa2, 0x0d,
+    0x86, 0xc9, 0xa1, 0x0d, 0x86, 0xc1, 0xa0, 0x0d, 0x86, 0xb9, 0xa5, 0x0d,
+    0x86, 0xe0, 0xc2, 0x00, 0xb6, 0x0d, 0x86, 0xb1, 0xa1, 0x0d, 0x86, 0xa9,
+    0xa0, 0x0d, 0x86, 0xa0, 0xa3, 0x0d, 0x86, 0x99, 0xa2, 0x0d, 0x86, 0x91,
+    0xa1, 0x0d, 0x86, 0x89, 0xa0, 0x0d, 0x86, 0x80, 0xa6, 0x0d, 0x86, 0x79,
+    0xa5, 0x0d, 0x86, 0x71, 0xa4, 0x0d, 0x86, 0x69, 0xa3, 0x0d, 0x86, 0x61,
+    0xa2, 0x0d, 0x86, 0x59, 0xa1, 0x0d, 0x86, 0x51, 0xa0, 0x0d, 0x86, 0x48,
+    0xa6, 0x0d, 0x86, 0x41, 0xa5, 0x0d, 0x86, 0x39, 0xa4, 0x0d, 0x86, 0x31,
+    0xa3, 0x0d, 0x86, 0x29, 0xa2, 0x0d, 0x86, 0x21, 0xa1, 0x0d, 0x86, 0x19,
+    0xa0, 0x0d, 0x86, 0x10, 0xc2, 0x00, 0x3b, 0x0d, 0x83, 0xe9, 0xa5, 0x0d,
+    0x83, 0xe1, 0xa4, 0x0d, 0x83, 0xd9, 0xa3, 0x0d, 0x83, 0xd1, 0xa2, 0x0d,
+    0x83, 0xc9, 0xa1, 0x0d, 0x83, 0xc1, 0xa0, 0x0d, 0x83, 0xb8, 0xa8, 0x0d,
+    0x83, 0xb1, 0xa7, 0x0d, 0x83, 0xa9, 0xa6, 0x0d, 0x83, 0xa1, 0xa5, 0x0d,
+    0x83, 0x99, 0xa4, 0x0d, 0x83, 0x91, 0xa3, 0x0d, 0x83, 0x89, 0xa2, 0x0d,
+    0x83, 0x81, 0xa1, 0x0d, 0x83, 0x79, 0xa0, 0x0d, 0x83, 0x70, 0xa1, 0x0d,
+    0x83, 0x19, 0xa0, 0x0d, 0x83, 0x11, 0xa2, 0x0d, 0x83, 0x21, 0xa3, 0x0d,
+    0x83, 0x29, 0xa4, 0x0d, 0x83, 0x31, 0xa5, 0x0d, 0x83, 0x39, 0xa6, 0x0d,
+    0x83, 0x40, 0xa3, 0x0d, 0x83, 0x09, 0xa2, 0x0d, 0x83, 0x01, 0xa1, 0x0d,
+    0x82, 0xf9, 0xa0, 0x0d, 0x82, 0xf0, 0xa0, 0x0d, 0x83, 0x49, 0xa1, 0x0d,
+    0x83, 0x51, 0xa2, 0x0d, 0x83, 0x59, 0xa3, 0x0d, 0x83, 0x61, 0xc2, 0x00,
+    0x5d, 0x0d, 0x83, 0x68, 0xa6, 0x0d, 0x82, 0xe9, 0xa5, 0x0d, 0x82, 0xe1,
+    0xa4, 0x0d, 0x82, 0xd9, 0xa3, 0x0d, 0x82, 0xd1, 0xa2, 0x0d, 0x82, 0xc9,
+    0xa1, 0x0d, 0x82, 0xc1, 0xa0, 0x0d, 0x82, 0xb8, 0xa4, 0x0d, 0x82, 0xb1,
+    0xa3, 0x0d, 0x82, 0xa9, 0xa2, 0x0d, 0x82, 0xa1, 0xa1, 0x0d, 0x82, 0x99,
+    0xa0, 0x0d, 0x82, 0x90, 0xa7, 0x0d, 0x82, 0x89, 0xa6, 0x0d, 0x82, 0x81,
+    0xa5, 0x0d, 0x82, 0x79, 0xa4, 0x0d, 0x82, 0x71, 0xa3, 0x0d, 0x82, 0x69,
+    0xa2, 0x0d, 0x82, 0x61, 0xa1, 0x0d, 0x82, 0x59, 0xa0, 0x0d, 0x82, 0x50,
+    0xa5, 0x0d, 0x82, 0x49, 0xa4, 0x0d, 0x82, 0x41, 0xa3, 0x0d, 0x82, 0x39,
+    0xa2, 0x0d, 0x82, 0x31, 0xa1, 0x0d, 0x82, 0x29, 0xa0, 0x0d, 0x82, 0x20,
+    0xa7, 0x0d, 0x82, 0x19, 0xa6, 0x0d, 0x82, 0x11, 0xa5, 0x0d, 0x82, 0x09,
+    0xa4, 0x0d, 0x82, 0x01, 0xa3, 0x0d, 0x81, 0xf9, 0xa2, 0x0d, 0x81, 0xf1,
+    0xa1, 0x0d, 0x81, 0xe9, 0xa0, 0x0d, 0x81, 0xe0, 0xca, 0x9a, 0x3e, 0x07,
+    0xda, 0x79, 0x48, 0xbc, 0xc0, 0x41, 0x7e, 0xed, 0xc2, 0x00, 0x78, 0x00,
+    0x2f, 0x23, 0x01, 0x7e, 0xff, 0xc3, 0xb8, 0x25, 0x00, 0x2e, 0xdb, 0x01,
+    0x7f, 0x05, 0xc3, 0x02, 0x6a, 0x00, 0x2e, 0x8b, 0x01, 0x7f, 0x0b, 0xc3,
+    0x03, 0x4e, 0x00, 0x2e, 0xab, 0x01, 0x7f, 0x11, 0x16, 0xc1, 0x7f, 0x17,
+    0x15, 0xc1, 0x7f, 0x32, 0xc4, 0x5a, 0xd2, 0x00, 0x2f, 0x43, 0x01, 0x7f,
+    0x44, 0xc3, 0xe5, 0x95, 0x00, 0x2f, 0x3b, 0x01, 0x7f, 0x4a, 0x46, 0x28,
+    0x97, 0xc1, 0x7f, 0x50, 0xc3, 0x20, 0xb0, 0x00, 0x2f, 0x03, 0x01, 0x7f,
+    0x74, 0xc3, 0x03, 0xb0, 0x00, 0x2e, 0xf3, 0x01, 0x7f, 0x7a, 0xc5, 0x9a,
+    0x43, 0x00, 0x2e, 0xe3, 0x01, 0x7f, 0x80, 0xc3, 0x4e, 0x09, 0x00, 0x2e,
+    0xcb, 0x01, 0x7f, 0x86, 0xc5, 0x4e, 0x03, 0x00, 0x2e, 0xb3, 0x01, 0x7f,
+    0x8c, 0xc2, 0x00, 0x61, 0x00, 0x2e, 0xa3, 0x01, 0x7f, 0x92, 0xc5, 0x46,
+    0x53, 0x00, 0x2e, 0x9b, 0x01, 0x7f, 0x9c, 0xc5, 0x9b, 0xd8, 0x00, 0x2e,
+    0x93, 0x01, 0x7f, 0xa2, 0x03, 0xc1, 0x7f, 0xa8, 0x45, 0xd3, 0xb4, 0x41,
+    0x7f, 0xb2, 0xd4, 0x3c, 0xb6, 0x07, 0xd8, 0xf1, 0x13, 0xc1, 0x7f, 0xe2,
+    0x15, 0xc1, 0x7f, 0xf1, 0xc4, 0xe2, 0xd8, 0x00, 0x2d, 0xf9, 0xc5, 0xdb,
+    0x4d, 0x00, 0x2d, 0xe9, 0xcf, 0x62, 0x96, 0x00, 0x2d, 0xe1, 0x0a, 0xc1,
+    0x80, 0x01, 0xc5, 0x7a, 0x6f, 0x00, 0x2d, 0xb9, 0xc5, 0xd6, 0xbb, 0x00,
+    0x2d, 0xa8, 0x43, 0x01, 0x3d, 0xc1, 0x80, 0x16, 0xcb, 0x8f, 0x64, 0x00,
+    0x2e, 0x31, 0xc9, 0xaf, 0x7f, 0x00, 0x2e, 0x19, 0xc5, 0xd3, 0xd2, 0x00,
+    0x2e, 0x01, 0xc5, 0xdb, 0xb1, 0x00, 0x2d, 0xf0, 0xc4, 0xdf, 0x44, 0x00,
+    0x2d, 0x71, 0x03, 0x41, 0x80, 0x22, 0xc3, 0x51, 0x62, 0x00, 0x2d, 0x69,
+    0xc4, 0x40, 0xb1, 0x00, 0x2d, 0x38, 0xcc, 0x89, 0xd0, 0x00, 0x2d, 0x51,
+    0xc3, 0x14, 0xf2, 0x00, 0x2c, 0xd0, 0x07, 0xc1, 0x80, 0x2e, 0xc5, 0xdb,
+    0x39, 0x00, 0x2c, 0xb0, 0xc3, 0xaa, 0x0b, 0x00, 0x2d, 0x41, 0xc9, 0xae,
+    0xcb, 0x00, 0x2c, 0xf8, 0xc3, 0x18, 0xa7, 0x00, 0x2d, 0x09, 0xc4, 0xde,
+    0xbc, 0x00, 0x2c, 0xc8, 0xc9, 0xa9, 0xcd, 0x00, 0x2c, 0x99, 0xc4, 0xc3,
+    0x71, 0x00, 0x2c, 0x90, 0xc3, 0x22, 0xeb, 0x00, 0x2c, 0xe3, 0x01, 0x80,
+    0x3a, 0xc6, 0xce, 0x90, 0x00, 0x2c, 0xf0, 0xc4, 0xde, 0xe0, 0x00, 0x2d,
+    0x19, 0xc7, 0xc7, 0xaf, 0x00, 0x2d, 0x21, 0xc5, 0xd6, 0x5c, 0x00, 0x2d,
+    0x2a, 0x01, 0x80, 0x40, 0x05, 0xc1, 0x80, 0x46, 0xcf, 0x67, 0x37, 0x02,
+    0x6e, 0x09, 0x03, 0xc1, 0x80, 0x58, 0xc6, 0xcd, 0xb2, 0x02, 0x6f, 0x21,
+    0x19, 0xc1, 0x80, 0x62, 0xd6, 0x2f, 0x74, 0x02, 0x6f, 0x99, 0xcf, 0x67,
+    0xaf, 0x02, 0x6f, 0xa9, 0xcb, 0x90, 0x98, 0x02, 0x6f, 0xc1, 0xcb, 0x92,
+    0x9d, 0x02, 0x6f, 0xc8, 0xd9, 0x1f, 0x1a, 0x02, 0x6e, 0x11, 0xc8, 0xb5,
+    0x10, 0x02, 0x6f, 0xd0, 0xc9, 0xaa, 0xff, 0x02, 0x6f, 0x39, 0xc6, 0xd1,
+    0x8a, 0x02, 0x6f, 0x41, 0xc9, 0xa8, 0x92, 0x02, 0x6f, 0xa0, 0xc5, 0xdd,
+    0x64, 0x02, 0x6e, 0x29, 0xca, 0x9b, 0xe2, 0x02, 0x6e, 0x98, 0xc6, 0xd2,
+    0x38, 0x02, 0x6e, 0x41, 0xcd, 0x7c, 0xe4, 0x02, 0x6f, 0xe8, 0x44, 0x3c,
+    0xfc, 0xc1, 0x80, 0x6e, 0xc3, 0x07, 0xea, 0x02, 0x6e, 0xa8, 0xc3, 0x05,
+    0x81, 0x02, 0x6e, 0xb9, 0xc4, 0x06, 0x0a, 0x02, 0x6f, 0x00, 0xc6, 0xcc,
+    0xc2, 0x02, 0x6e, 0xc1, 0xc8, 0xb7, 0xa8, 0x02, 0x6f, 0xe0, 0xc7, 0x12,
+    0x82, 0x02, 0x6f, 0x29, 0xc7, 0x50, 0xe1, 0x02, 0x6f, 0x70, 0xa3, 0x0f,
+    0xdb, 0xc1, 0xa1, 0x0f, 0xdb, 0xb1, 0xa2, 0x0f, 0xdb, 0xb9, 0xa4, 0x0f,
+    0xdb, 0xc9, 0xa5, 0x0f, 0xdb, 0xd1, 0xa6, 0x0f, 0xdb, 0xd9, 0xc4, 0xe1,
+    0x98, 0x0f, 0xdc, 0x08, 0xa8, 0x01, 0x1d, 0xe9, 0xa6, 0x01, 0x1d, 0xe1,
+    0xa2, 0x01, 0x1d, 0xd9, 0xa0, 0x01, 0x1d, 0xd0, 0xc2, 0x00, 0x72, 0x01,
+    0x00, 0xa9, 0x45, 0x06, 0x65, 0x41, 0x80, 0x78, 0x42, 0x00, 0x03, 0xc1,
+    0x80, 0x84, 0xcc, 0x8a, 0x3c, 0x0f, 0xb5, 0x28, 0xc6, 0xcf, 0x02, 0x0f,
+    0x9e, 0x39, 0xc4, 0x07, 0xe9, 0x0f, 0xa1, 0xa0, 0xcb, 0x8f, 0xa6, 0x0f,
+    0x9f, 0x09, 0xc8, 0x32, 0x7b, 0x0f, 0x9f, 0x02, 0x01, 0x80, 0x93, 0xc4,
+    0xcc, 0x08, 0x01, 0x34, 0x91, 0xc6, 0xd0, 0x2e, 0x01, 0x31, 0x69, 0xc6,
+    0xcf, 0xf8, 0x0f, 0xb7, 0x00, 0xc2, 0x00, 0xb8, 0x0f, 0xc9, 0xf1, 0x89,
+    0x0f, 0xa2, 0xe0, 0xda, 0x19, 0x96, 0x0f, 0xc8, 0xf1, 0xd8, 0x24, 0x85,
+    0x0f, 0xd7, 0x80, 0xc4, 0x28, 0x74, 0x08, 0x69, 0xc9, 0xc5, 0x0a, 0xfd,
+    0x08, 0x69, 0xc1, 0x15, 0xc1, 0x80, 0x97, 0x08, 0xc1, 0x80, 0xa3, 0x16,
+    0xc1, 0x80, 0xaf, 0xc3, 0x05, 0x16, 0x08, 0x69, 0x89, 0xc4, 0x18, 0xa7,
+    0x08, 0x69, 0x80, 0x42, 0x00, 0x51, 0xc1, 0x80, 0xbb, 0xc8, 0xbd, 0xe0,
+    0x08, 0x69, 0x20, 0xc9, 0xb1, 0xec, 0x08, 0x69, 0x19, 0xc5, 0xda, 0x35,
+    0x08, 0x69, 0x10, 0x91, 0x08, 0x69, 0x09, 0x87, 0x08, 0x69, 0x01, 0x97,
+    0x08, 0x68, 0xf9, 0x8b, 0x08, 0x68, 0xf1, 0x83, 0x08, 0x68, 0xe8, 0xc2,
+    0x02, 0x63, 0x08, 0x68, 0xe1, 0x10, 0xc1, 0x80, 0xcd, 0x0d, 0xc1, 0x80,
+    0xdd, 0xc2, 0x1a, 0x18, 0x08, 0x68, 0xc1, 0xc2, 0x00, 0x71, 0x08, 0x68,
+    0xb1, 0xc2, 0x00, 0xb6, 0x08, 0x68, 0xa1, 0xc2, 0x00, 0x89, 0x08, 0x68,
+    0x99, 0xc2, 0x00, 0xeb, 0x08, 0x68, 0x91, 0x14, 0xc1, 0x80, 0xed, 0x06,
+    0xc1, 0x80, 0xf7, 0xc2, 0x04, 0x70, 0x08, 0x68, 0x49, 0xc2, 0x00, 0xce,
+    0x08, 0x68, 0x39, 0xc2, 0x03, 0xc6, 0x08, 0x68, 0x31, 0xc2, 0x21, 0x7d,
+    0x08, 0x68, 0x29, 0x16, 0xc1, 0x81, 0x01, 0x83, 0x08, 0x68, 0x01, 0xc2,
+    0x00, 0xa0, 0x08, 0x68, 0x09, 0xc2, 0x04, 0xf2, 0x08, 0x68, 0x11, 0xc2,
+    0x01, 0x16, 0x08, 0x68, 0x71, 0x15, 0x41, 0x81, 0x0b, 0x97, 0x00, 0xb9,
+    0x99, 0x8b, 0x00, 0xb9, 0x90, 0xc2, 0x00, 0xce, 0x00, 0xb9, 0x89, 0xc2,
+    0x0d, 0x01, 0x00, 0xb9, 0x81, 0xc2, 0x00, 0x71, 0x00, 0xb9, 0x79, 0xc2,
+    0x00, 0x89, 0x00, 0xb9, 0x71, 0xc2, 0x00, 0x3b, 0x00, 0xb9, 0x69, 0xc2,
+    0x1a, 0x18, 0x00, 0xb9, 0x61, 0xc2, 0x00, 0xb6, 0x00, 0xb9, 0x59, 0xc2,
+    0x00, 0xa0, 0x00, 0xb9, 0x51, 0xc2, 0x04, 0xf2, 0x00, 0xb9, 0x49, 0x10,
+    0xc1, 0x81, 0x15, 0xc2, 0x0e, 0x60, 0x00, 0xb9, 0x39, 0xc2, 0x00, 0x51,
+    0x00, 0xb9, 0x31, 0xc2, 0x00, 0xeb, 0x00, 0xb9, 0x21, 0xc2, 0x02, 0x4d,
+    0x00, 0xb9, 0x19, 0x97, 0x00, 0xb9, 0x11, 0x8b, 0x00, 0xb9, 0x09, 0x83,
+    0x00, 0xb9, 0x00, 0x49, 0xb2, 0xc4, 0xc1, 0x81, 0x1f, 0x0c, 0xc1, 0x81,
+    0x6c, 0xd4, 0x39, 0xe6, 0x01, 0x81, 0x71, 0xd4, 0x38, 0xce, 0x01, 0x81,
+    0x79, 0x47, 0x01, 0x92, 0xc1, 0x81, 0x78, 0xc6, 0x22, 0x0f, 0x01, 0x8b,
+    0x20, 0xc3, 0x05, 0x16, 0x01, 0x81, 0x09, 0x16, 0xc1, 0x81, 0xd5, 0x08,
+    0xc1, 0x81, 0xe3, 0x15, 0xc1, 0x81, 0xef, 0xc5, 0x0a, 0xfd, 0x01, 0x81,
+    0x41, 0xc4, 0x28, 0x74, 0x01, 0x81, 0x48, 0xc3, 0x05, 0x16, 0x08, 0x47,
+    0xdb, 0x01, 0x81, 0xfb, 0x16, 0xc1, 0x82, 0x01, 0xc4, 0x0c, 0xf6, 0x08,
+    0x47, 0xe0, 0x16, 0xc1, 0x82, 0x0d, 0x15, 0xc1, 0x82, 0x19, 0xc4, 0xb5,
+    0x0c, 0x08, 0x47, 0x91, 0xc2, 0x00, 0x78, 0x08, 0x47, 0x81, 0x03, 0xc1,
+    0x82, 0x23, 0xc3, 0x20, 0xb0, 0x08, 0x47, 0x69, 0xc3, 0x03, 0xb0, 0x08,
+    0x47, 0x61, 0xc6, 0xd0, 0xf4, 0x08, 0x47, 0x59, 0xc4, 0xe0, 0x58, 0x08,
+    0x47, 0x51, 0xc4, 0x4e, 0x09, 0x08, 0x47, 0x49, 0xc2, 0x00, 0x61, 0x08,
+    0x47, 0x23, 0x01, 0x82, 0x2f, 0xc4, 0xe2, 0x40, 0x08, 0x47, 0x31, 0xc3,
+    0x76, 0xe6, 0x08, 0x47, 0x29, 0xcb, 0x99, 0xb4, 0x08, 0x47, 0x19, 0xc5,
+    0x9b, 0xd8, 0x08, 0x47, 0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x47, 0x08, 0xca,
+    0x3e, 0x00, 0x07, 0xfb, 0x29, 0x47, 0x01, 0x92, 0xc1, 0x82, 0x35, 0xd1,
+    0x2f, 0x0b, 0x07, 0xfc, 0xf1, 0xd6, 0x31, 0x42, 0x07, 0xfc, 0xf8, 0x0d,
+    0xc1, 0x82, 0x70, 0x15, 0xc1, 0x82, 0x7f, 0xc5, 0xd4, 0x7c, 0x07, 0xfd,
+    0x4b, 0x01, 0x82, 0x8b, 0xc5, 0xdb, 0x5c, 0x07, 0xfd, 0x89, 0x12, 0xc1,
+    0x82, 0x8f, 0x8b, 0x07, 0xfe, 0xe3, 0x01, 0x82, 0x9e, 0x05, 0xc1, 0x82,
+    0xa4, 0x16, 0xc1, 0x82, 0xb0, 0xc5, 0x98, 0x2e, 0x07, 0xfd, 0xf1, 0x83,
+    0x07, 0xfe, 0x13, 0x01, 0x82, 0xbc, 0x1b, 0xc1, 0x82, 0xc0, 0x87, 0x07,
+    0xfe, 0x3b, 0x01, 0x82, 0xda, 0x91, 0x07, 0xfe, 0x63, 0x01, 0x82, 0xe2,
+    0x19, 0xc1, 0x82, 0xe6, 0x97, 0x07, 0xfe, 0x99, 0xc5, 0xda, 0xcb, 0x07,
+    0xfd, 0x22, 0x01, 0x82, 0xf8, 0xd1, 0x55, 0x97, 0x0f, 0xb4, 0x28, 0x47,
+    0x76, 0xda, 0x41, 0x82, 0xfc, 0x45, 0x00, 0xb6, 0xc1, 0x83, 0x08, 0x83,
+    0x01, 0x82, 0xa9, 0x8b, 0x01, 0x82, 0xb9, 0x97, 0x01, 0x82, 0xc9, 0x87,
+    0x01, 0x82, 0xd9, 0x91, 0x01, 0x82, 0xe8, 0x83, 0x01, 0x82, 0x59, 0x8b,
+    0x01, 0x82, 0x69, 0x97, 0x01, 0x82, 0x79, 0x87, 0x01, 0x82, 0x89, 0x91,
+    0x01, 0x82, 0x98, 0x83, 0x01, 0x82, 0x61, 0x8b, 0x01, 0x82, 0x71, 0x97,
+    0x01, 0x82, 0x81, 0x87, 0x01, 0x82, 0x91, 0x91, 0x01, 0x82, 0xa0, 0x83,
+    0x01, 0x82, 0xb1, 0x8b, 0x01, 0x82, 0xc1, 0x97, 0x01, 0x82, 0xd1, 0x87,
+    0x01, 0x82, 0xe1, 0x91, 0x01, 0x82, 0xf0, 0x83, 0x01, 0x82, 0xf9, 0x8b,
+    0x01, 0x83, 0x09, 0x97, 0x01, 0x83, 0x21, 0x87, 0x01, 0x83, 0x31, 0x91,
+    0x01, 0x83, 0x40, 0x83, 0x01, 0x83, 0x01, 0x8b, 0x01, 0x83, 0x11, 0x97,
+    0x01, 0x83, 0x29, 0x87, 0x01, 0x83, 0x39, 0x91, 0x01, 0x83, 0x48, 0x83,
+    0x01, 0x83, 0x51, 0x8b, 0x01, 0x83, 0x59, 0x97, 0x01, 0x83, 0x61, 0x87,
+    0x01, 0x83, 0x69, 0x91, 0x01, 0x83, 0x70, 0x83, 0x01, 0x83, 0x79, 0x8b,
+    0x01, 0x83, 0x91, 0x97, 0x01, 0x83, 0xa9, 0x87, 0x01, 0x83, 0xc1, 0x91,
+    0x01, 0x83, 0xd8, 0x83, 0x01, 0x83, 0x81, 0x8b, 0x01, 0x83, 0x99, 0x97,
+    0x01, 0x83, 0xb1, 0x87, 0x01, 0x83, 0xc9, 0x91, 0x01, 0x83, 0xe0, 0x83,
+    0x01, 0x83, 0x89, 0x8b, 0x01, 0x83, 0xa1, 0x97, 0x01, 0x83, 0xb9, 0x87,
+    0x01, 0x83, 0xd1, 0x91, 0x01, 0x83, 0xe8, 0x83, 0x01, 0x83, 0xf1, 0x8b,
+    0x01, 0x83, 0xf9, 0x97, 0x01, 0x84, 0x01, 0x87, 0x01, 0x84, 0x09, 0x91,
+    0x01, 0x84, 0x10, 0x83, 0x01, 0x84, 0x21, 0x97, 0x01, 0x84, 0x31, 0x91,
+    0x01, 0x84, 0x40, 0x83, 0x01, 0x84, 0x49, 0x8b, 0x01, 0x84, 0x51, 0x97,
+    0x01, 0x84, 0x59, 0x87, 0x01, 0x84, 0x61, 0x91, 0x01, 0x84, 0x68, 0x83,
+    0x01, 0x84, 0x79, 0x8b, 0x01, 0x84, 0x81, 0x87, 0x01, 0x84, 0x89, 0x91,
+    0x01, 0x84, 0x90, 0xc6, 0x19, 0xc4, 0x01, 0x02, 0x19, 0xce, 0x67, 0xdd,
+    0x01, 0x70, 0xd0, 0x45, 0x68, 0xe5, 0xc1, 0x83, 0x2e, 0xcc, 0x0d, 0xa0,
+    0x01, 0x2e, 0xc9, 0xc6, 0x19, 0xc4, 0x01, 0x2e, 0xc1, 0xcc, 0x04, 0x3d,
+    0x0f, 0xdc, 0x81, 0x42, 0x00, 0xd8, 0x41, 0x83, 0x3a, 0xc9, 0x17, 0x09,
+    0x01, 0x37, 0x39, 0x0e, 0xc1, 0x83, 0x40, 0xc8, 0xb5, 0x00, 0x01, 0x09,
+    0x39, 0xc8, 0xbe, 0xa8, 0x01, 0x02, 0xa1, 0xd0, 0x0e, 0xed, 0x00, 0x05,
+    0x09, 0xcd, 0x30, 0xea, 0x00, 0x05, 0xf9, 0xcb, 0x11, 0x79, 0x01, 0x70,
+    0xc0, 0xda, 0x1c, 0xd6, 0x01, 0x35, 0x21, 0x51, 0x55, 0xfd, 0x41, 0x83,
+    0x4f, 0x01, 0x41, 0x83, 0x61, 0xc9, 0x54, 0x6d, 0x01, 0x1d, 0x71, 0x45,
+    0x00, 0x92, 0xc1, 0x83, 0x73, 0x03, 0x41, 0x83, 0x97, 0x47, 0x37, 0xb8,
+    0xc1, 0x83, 0xa3, 0x47, 0x01, 0x92, 0x41, 0x83, 0xb6, 0x47, 0x37, 0xb8,
+    0xc1, 0x84, 0x0f, 0x47, 0x01, 0x92, 0x41, 0x84, 0x22, 0xc5, 0x4f, 0x54,
+    0x01, 0x09, 0xc9, 0x49, 0x1b, 0x41, 0x41, 0x84, 0x85, 0xd1, 0x2e, 0xb3,
+    0x0f, 0xae, 0xd1, 0xc4, 0x08, 0x0d, 0x01, 0x4f, 0x08, 0xca, 0xa1, 0xb4,
+    0x0f, 0x65, 0x81, 0x49, 0x54, 0x43, 0xc1, 0x84, 0x95, 0xcb, 0x5a, 0xb2,
+    0x0f, 0x65, 0x61, 0x47, 0x37, 0xb8, 0xc1, 0x84, 0xa1, 0xc9, 0x44, 0x3c,
+    0x0f, 0x65, 0x01, 0xd3, 0x44, 0x32, 0x0f, 0x65, 0xa0, 0xd5, 0x36, 0x49,
+    0x01, 0x4f, 0x28, 0x08, 0xc1, 0x84, 0xe6, 0x16, 0xc1, 0x84, 0xf2, 0xc3,
+    0x05, 0x16, 0x0e, 0x9b, 0x90, 0xda, 0x1b, 0x36, 0x01, 0x81, 0xb9, 0x4b,
+    0x1b, 0x25, 0x41, 0x84, 0xfe, 0x48, 0x07, 0x75, 0xc1, 0x85, 0x2e, 0x49,
+    0xaf, 0x6d, 0xc1, 0x85, 0x3a, 0xcd, 0x77, 0x0d, 0x01, 0x7f, 0xa1, 0x4e,
+    0x73, 0x6c, 0xc1, 0x85, 0x46, 0xc8, 0x00, 0x97, 0x01, 0x7f, 0xd8, 0xc7,
+    0xc8, 0xe3, 0x01, 0x8c, 0x99, 0x0a, 0xc1, 0x85, 0x5c, 0xc7, 0xc7, 0x7e,
+    0x01, 0x8c, 0xb0, 0x43, 0x04, 0xa0, 0xc1, 0x85, 0x68, 0xc9, 0xab, 0x86,
+    0x01, 0x8c, 0xc8, 0xca, 0x9a, 0xa2, 0x01, 0x8c, 0xb9, 0xc7, 0xc9, 0x84,
+    0x01, 0x8c, 0xf8, 0x16, 0xc1, 0x85, 0x74, 0xc3, 0x05, 0x16, 0x08, 0x42,
+    0xc2, 0x01, 0x85, 0x87, 0x16, 0xc1, 0x85, 0x8b, 0x15, 0xc1, 0x85, 0x97,
+    0xc4, 0x5a, 0xd2, 0x08, 0x42, 0x99, 0xc4, 0xb5, 0x0c, 0x08, 0x42, 0x91,
+    0xc2, 0x00, 0x78, 0x08, 0x42, 0x81, 0x03, 0xc1, 0x85, 0xa1, 0xc3, 0x20,
+    0xb0, 0x08, 0x42, 0x69, 0xc3, 0x03, 0xb0, 0x08, 0x42, 0x61, 0xc6, 0xd0,
+    0xf4, 0x08, 0x42, 0x59, 0xc4, 0xe0, 0x58, 0x08, 0x42, 0x51, 0xc4, 0x4e,
+    0x09, 0x08, 0x42, 0x49, 0xc2, 0x00, 0x61, 0x08, 0x42, 0x23, 0x01, 0x85,
+    0xad, 0xc5, 0x4e, 0x03, 0x08, 0x42, 0x31, 0xc3, 0x76, 0xe6, 0x08, 0x42,
+    0x29, 0xc6, 0x46, 0x53, 0x08, 0x42, 0x19, 0xc5, 0x9b, 0xd8, 0x08, 0x42,
+    0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x42, 0x08, 0xc5, 0x08, 0xbb, 0x0f, 0xdc,
+    0xa8, 0xc3, 0x8e, 0xd7, 0x0f, 0x9a, 0x91, 0xc9, 0xb3, 0x42, 0x0f, 0x99,
+    0xc0, 0x4d, 0x28, 0xa7, 0xc1, 0x85, 0xb3, 0x47, 0x01, 0x92, 0x41, 0x86,
+    0x02, 0xc2, 0x01, 0xac, 0x01, 0x02, 0x01, 0xc9, 0x37, 0x12, 0x00, 0x00,
+    0x4a, 0x01, 0x86, 0x51, 0xcf, 0x62, 0x69, 0x0f, 0xa6, 0x49, 0xcd, 0x77,
+    0x5b, 0x0f, 0xa6, 0x42, 0x01, 0x86, 0x55, 0xc3, 0x9d, 0xc0, 0x08, 0x8a,
+    0x39, 0x0e, 0xc1, 0x86, 0x5b, 0xc3, 0x3a, 0xec, 0x08, 0x89, 0x31, 0xc3,
+    0xcb, 0x84, 0x08, 0x89, 0x29, 0xc3, 0x12, 0x98, 0x08, 0x89, 0x21, 0xc3,
+    0x44, 0x1d, 0x08, 0x89, 0x11, 0x1b, 0xc1, 0x86, 0x67, 0xc3, 0xc0, 0x46,
+    0x08, 0x88, 0xf9, 0x04, 0xc1, 0x86, 0x73, 0x12, 0xc1, 0x86, 0x7f, 0x10,
+    0xc1, 0x86, 0x8b, 0x06, 0xc1, 0x86, 0xa3, 0x16, 0xc1, 0x86, 0xb3, 0x0c,
+    0xc1, 0x86, 0xc3, 0x05, 0xc1, 0x86, 0xcf, 0x09, 0xc1, 0x86, 0xdb, 0x0d,
+    0xc1, 0x86, 0xe7, 0x87, 0x08, 0x88, 0x31, 0x97, 0x08, 0x88, 0x29, 0x8b,
+    0x08, 0x88, 0x21, 0xc2, 0x12, 0x99, 0x08, 0x88, 0x18, 0x4a, 0x6e, 0xbc,
+    0xc1, 0x86, 0xf3, 0xc5, 0x1f, 0xf6, 0x08, 0x89, 0x98, 0xcb, 0x8c, 0xe6,
+    0x08, 0x8a, 0x11, 0xc4, 0x19, 0xf1, 0x08, 0x8a, 0x09, 0x45, 0x04, 0x9a,
+    0x41, 0x87, 0x16, 0xcb, 0x46, 0xd3, 0x08, 0x8a, 0x01, 0x44, 0x00, 0x8e,
+    0x41, 0x87, 0x3a, 0xc2, 0x00, 0x71, 0x05, 0x51, 0xb1, 0xc2, 0x00, 0x89,
+    0x05, 0x51, 0xa9, 0xc2, 0x00, 0x3b, 0x05, 0x51, 0xa1, 0xc2, 0x1a, 0x18,
+    0x05, 0x51, 0x99, 0x46, 0x28, 0x97, 0x41, 0x87, 0x4c, 0x97, 0x05, 0x51,
+    0x6b, 0x01, 0x87, 0x5a, 0x03, 0xc1, 0x87, 0x5e, 0x91, 0x05, 0x51, 0x7b,
+    0x01, 0x87, 0x6a, 0xc2, 0x0a, 0xfd, 0x05, 0x51, 0x61, 0x8b, 0x05, 0x51,
+    0x52, 0x01, 0x87, 0x6e, 0xc2, 0x00, 0xce, 0x05, 0x51, 0x41, 0x15, 0xc1,
+    0x87, 0x72, 0x10, 0xc1, 0x87, 0x7c, 0x09, 0xc1, 0x87, 0x8e, 0x0d, 0xc1,
+    0x87, 0x98, 0x91, 0x05, 0x50, 0x29, 0x83, 0x05, 0x50, 0x03, 0x01, 0x87,
+    0xa2, 0x87, 0x05, 0x50, 0x19, 0x46, 0x28, 0x97, 0xc1, 0x87, 0xa6, 0xc2,
+    0x02, 0x63, 0x05, 0x51, 0x29, 0xc2, 0x00, 0x89, 0x05, 0x51, 0x21, 0xc2,
+    0x00, 0x3b, 0x05, 0x51, 0x19, 0xc2, 0x1a, 0x18, 0x05, 0x51, 0x11, 0x04,
+    0xc1, 0x87, 0xd5, 0x0f, 0xc1, 0x87, 0xe5, 0x12, 0xc1, 0x87, 0xef, 0x06,
+    0xc1, 0x87, 0xff, 0x16, 0xc1, 0x88, 0x0f, 0x0c, 0xc1, 0x88, 0x19, 0x42,
+    0x11, 0x99, 0xc1, 0x88, 0x23, 0x97, 0x05, 0x50, 0x11, 0x8b, 0x05, 0x50,
+    0x08, 0xcc, 0x81, 0xf0, 0x05, 0x52, 0xf9, 0x06, 0xc1, 0x88, 0x2d, 0xc6,
+    0x96, 0x1c, 0x05, 0x52, 0xe0, 0xc4, 0x28, 0x74, 0x05, 0x52, 0xc9, 0xc5,
+    0x0a, 0xfd, 0x05, 0x52, 0xc1, 0x15, 0xc1, 0x88, 0x39, 0x08, 0xc1, 0x88,
+    0x45, 0x16, 0xc1, 0x88, 0x51, 0xc4, 0x18, 0xa7, 0x05, 0x52, 0x81, 0xc3,
+    0x05, 0x16, 0x05, 0x52, 0x88, 0xc3, 0x05, 0x16, 0x08, 0x7e, 0x2b, 0x01,
+    0x88, 0x5d, 0x16, 0xc1, 0x88, 0x63, 0xc4, 0x04, 0x9f, 0x08, 0x7e, 0x40,
+    0xc3, 0x6e, 0xe0, 0x08, 0x7e, 0x21, 0x15, 0xc1, 0x88, 0x73, 0xc4, 0xe0,
+    0x58, 0x08, 0x7d, 0xd9, 0xc4, 0x4e, 0x09, 0x08, 0x7d, 0xd1, 0xc2, 0x00,
+    0x61, 0x08, 0x7d, 0xab, 0x01, 0x88, 0x85, 0xc5, 0x4e, 0x03, 0x08, 0x7d,
+    0xc1, 0xca, 0xa7, 0x86, 0x08, 0x7d, 0xb9, 0xc3, 0x76, 0xe6, 0x08, 0x7d,
+    0xb1, 0xc6, 0x46, 0x53, 0x08, 0x7d, 0xa1, 0xc5, 0x9b, 0xd8, 0x08, 0x7d,
+    0x99, 0xc4, 0xe0, 0x9c, 0x08, 0x7d, 0x91, 0x03, 0xc1, 0x88, 0x8b, 0xc6,
+    0xd0, 0xf4, 0x08, 0x7d, 0xe1, 0xc3, 0x03, 0xb0, 0x08, 0x7d, 0xe9, 0xc3,
+    0x20, 0xb0, 0x08, 0x7d, 0xf1, 0xc2, 0x00, 0x78, 0x08, 0x7e, 0x09, 0xc4,
+    0x5a, 0xd2, 0x08, 0x7e, 0x10, 0xc4, 0x01, 0x65, 0x01, 0x3a, 0x61, 0x43,
+    0x02, 0xd5, 0xc1, 0x88, 0x97, 0x12, 0x41, 0x88, 0xa3, 0xc6, 0xd0, 0x8e,
+    0x01, 0x34, 0xa1, 0xc5, 0xdd, 0x6e, 0x0f, 0x9c, 0x61, 0x47, 0x4f, 0xbf,
+    0x41, 0x88, 0xb2, 0x01, 0xc1, 0x88, 0xb8, 0xc8, 0xb8, 0x70, 0x0f, 0xae,
+    0xc8, 0x12, 0xc1, 0x88, 0xc4, 0x83, 0x00, 0xa7, 0xa3, 0x01, 0x88, 0xd4,
+    0x8a, 0x00, 0xa9, 0x2b, 0x01, 0x88, 0xe2, 0x91, 0x00, 0xa7, 0x8b, 0x01,
+    0x88, 0xff, 0x99, 0x00, 0xa8, 0x3b, 0x01, 0x89, 0x0d, 0x8b, 0x00, 0xa7,
+    0x7b, 0x01, 0x89, 0x26, 0x87, 0x00, 0xa7, 0x68, 0x83, 0x00, 0xa6, 0x3b,
+    0x01, 0x89, 0x2a, 0x19, 0xc1, 0x89, 0x41, 0x91, 0x00, 0xa6, 0x23, 0x01,
+    0x89, 0x5a, 0xc2, 0x00, 0xb2, 0x00, 0xac, 0xb3, 0x01, 0x89, 0x62, 0x89,
+    0x00, 0xac, 0xab, 0x01, 0x89, 0x77, 0x44, 0xde, 0x2d, 0xc1, 0x89, 0x8c,
+    0x48, 0xb7, 0xd8, 0xc1, 0x89, 0x9b, 0x87, 0x00, 0xa6, 0x01, 0x8b, 0x00,
+    0xa6, 0x13, 0x01, 0x89, 0xa6, 0x8a, 0x00, 0xa6, 0x90, 0x83, 0x00, 0xa4,
+    0x83, 0x01, 0x89, 0xaa, 0xc7, 0xbf, 0xeb, 0x00, 0xb3, 0x69, 0x87, 0x00,
+    0xa4, 0x49, 0x8b, 0x00, 0xa4, 0x5b, 0x01, 0x89, 0xb7, 0x91, 0x00, 0xa4,
+    0x6b, 0x01, 0x89, 0xbb, 0x19, 0x41, 0x89, 0xbf, 0x4b, 0x8e, 0xbf, 0xc1,
+    0x89, 0xd8, 0x49, 0xad, 0xc6, 0xc1, 0x89, 0xe0, 0xcb, 0x8c, 0xdb, 0x00,
+    0xa9, 0xf8, 0x42, 0x2d, 0x72, 0xc1, 0x8a, 0x03, 0x16, 0xc1, 0x8a, 0x1c,
+    0x8a, 0x00, 0xab, 0x53, 0x01, 0x8a, 0x33, 0x83, 0x00, 0xa2, 0xab, 0x01,
+    0x8a, 0x59, 0x1b, 0xc1, 0x8a, 0x64, 0x19, 0xc1, 0x8a, 0x74, 0x91, 0x00,
+    0xa2, 0x83, 0x01, 0x8a, 0x8d, 0x8b, 0x00, 0xa2, 0x73, 0x01, 0x8a, 0x91,
+    0x87, 0x00, 0xa2, 0x60, 0x87, 0x00, 0xa0, 0x63, 0x01, 0x8a, 0x95, 0x83,
+    0x00, 0xa0, 0xbb, 0x01, 0x8a, 0x9b, 0x91, 0x00, 0xa0, 0x93, 0x01, 0x8a,
+    0xa3, 0x8b, 0x00, 0xa0, 0x72, 0x01, 0x8a, 0xaa, 0x47, 0xc5, 0x2b, 0xc1,
+    0x8a, 0xae, 0x19, 0xc1, 0x8a, 0xb8, 0x83, 0x00, 0xaa, 0x5b, 0x01, 0x8a,
+    0xd3, 0x91, 0x00, 0xaa, 0x43, 0x01, 0x8a, 0xde, 0x8b, 0x00, 0xaa, 0x33,
+    0x01, 0x8a, 0xe2, 0x87, 0x00, 0xaa, 0x10, 0x8b, 0x00, 0xaa, 0xab, 0x01,
+    0x8a, 0xe6, 0xc8, 0x11, 0xa2, 0x00, 0xb3, 0x71, 0xc3, 0x12, 0x98, 0x00,
+    0xaa, 0xd9, 0x83, 0x00, 0xaa, 0xcb, 0x01, 0x8a, 0xf0, 0x91, 0x00, 0xaa,
+    0xbb, 0x01, 0x8a, 0xf7, 0x87, 0x00, 0xaa, 0x98, 0xc8, 0xbc, 0xf0, 0x00,
+    0xc6, 0xe1, 0x90, 0x00, 0xa1, 0x58, 0x47, 0xc8, 0xce, 0xc1, 0x8a, 0xfb,
+    0x9b, 0x00, 0xc5, 0x81, 0x90, 0x00, 0xa1, 0x69, 0x91, 0x00, 0xa0, 0x30,
+    0x83, 0x00, 0xa9, 0x6b, 0x01, 0x8b, 0x1d, 0x91, 0x00, 0xa9, 0x53, 0x01,
+    0x8b, 0x28, 0x19, 0xc1, 0x8b, 0x30, 0x46, 0x8c, 0xdf, 0xc1, 0x8b, 0x49,
+    0x8b, 0x00, 0xa9, 0x43, 0x01, 0x8b, 0x87, 0x87, 0x00, 0xa9, 0x30, 0x83,
+    0x00, 0xa6, 0xd3, 0x01, 0x8b, 0x8b, 0x8a, 0x00, 0xad, 0x33, 0x01, 0x8b,
+    0x96, 0x19, 0xc1, 0x8b, 0xab, 0x87, 0x00, 0xa6, 0x99, 0x8b, 0x00, 0xa6,
+    0xab, 0x01, 0x8b, 0xc4, 0x91, 0x00, 0xa6, 0xba, 0x01, 0x8b, 0xc8, 0x83,
+    0x00, 0xa5, 0x53, 0x01, 0x8b, 0xcc, 0x87, 0x00, 0xa5, 0x1b, 0x01, 0x8b,
+    0xd7, 0x91, 0x00, 0xa5, 0x3b, 0x01, 0x8b, 0xdd, 0x8b, 0x00, 0xa5, 0x2b,
+    0x01, 0x8b, 0xe4, 0x19, 0xc1, 0x8b, 0xe8, 0x8a, 0x00, 0xa5, 0xe8, 0x99,
+    0x00, 0xa4, 0x23, 0x01, 0x8c, 0x01, 0x83, 0x00, 0xa3, 0x93, 0x01, 0x8c,
+    0x1a, 0x87, 0x00, 0xa3, 0x59, 0x8b, 0x00, 0xa3, 0x6b, 0x01, 0x8c, 0x25,
+    0x91, 0x00, 0xa3, 0x7a, 0x01, 0x8c, 0x29, 0x19, 0xc1, 0x8c, 0x2d, 0x83,
+    0x00, 0xa1, 0xc3, 0x01, 0x8c, 0x46, 0x91, 0x00, 0xa1, 0x9b, 0x01, 0x8c,
+    0x51, 0x8b, 0x00, 0xa1, 0x8b, 0x01, 0x8c, 0x59, 0x87, 0x00, 0xa1, 0x78,
+    0x83, 0x00, 0xa0, 0x5b, 0x01, 0x8c, 0x5d, 0x9b, 0x00, 0xc5, 0x89, 0x8b,
+    0x00, 0xa0, 0xe3, 0x01, 0x8c, 0x65, 0x4a, 0x9c, 0xfa, 0xc1, 0x8c, 0x6b,
+    0x90, 0x00, 0xa1, 0x70, 0x83, 0x00, 0xac, 0x1b, 0x01, 0x8c, 0x73, 0x91,
+    0x00, 0xac, 0x0b, 0x01, 0x8c, 0x7e, 0x8b, 0x00, 0xab, 0xfa, 0x01, 0x8c,
+    0x82, 0x8d, 0x00, 0xab, 0xe9, 0xc5, 0x58, 0x03, 0x00, 0xa0, 0x00, 0x90,
+    0x00, 0xa1, 0x61, 0x8b, 0x00, 0xa0, 0x20, 0xd0, 0x5a, 0x12, 0x01, 0x02,
+    0x08, 0xc9, 0xb2, 0xb2, 0x0f, 0xae, 0x10, 0x97, 0x08, 0x15, 0xfa, 0x01,
+    0x8c, 0x86, 0x94, 0x08, 0x16, 0x48, 0x86, 0x08, 0x15, 0x32, 0x01, 0x8c,
+    0x8d, 0xa1, 0x08, 0x15, 0x38, 0x84, 0x08, 0x16, 0x52, 0x01, 0x8c, 0x91,
+    0xa1, 0x08, 0x15, 0x60, 0x96, 0x08, 0x16, 0x3a, 0x01, 0x8c, 0x9d, 0x8a,
+    0x08, 0x15, 0x73, 0x01, 0x8c, 0xa1, 0x95, 0x08, 0x15, 0xc1, 0x96, 0x08,
+    0x16, 0x12, 0x01, 0x8c, 0xa5, 0xc2, 0xdb, 0x2d, 0x08, 0x15, 0x89, 0xc2,
+    0xe6, 0x2a, 0x08, 0x16, 0x30, 0x90, 0x08, 0x15, 0x99, 0x86, 0x08, 0x15,
+    0xf1, 0x89, 0x08, 0x16, 0x20, 0xa1, 0x08, 0x15, 0x08, 0x8b, 0x08, 0x16,
+    0x28, 0xa1, 0x08, 0x16, 0x78, 0xa1, 0x08, 0x15, 0xe8, 0xa1, 0x08, 0x16,
+    0x08, 0x03, 0xc1, 0x8c, 0xa9, 0xc3, 0x02, 0x6a, 0x08, 0x29, 0x89, 0x09,
+    0xc1, 0x8c, 0xb5, 0x06, 0xc1, 0x8c, 0xc1, 0x07, 0xc1, 0x8c, 0xd1, 0x1c,
+    0xc1, 0x8c, 0xdb, 0x16, 0xc1, 0x8c, 0xe5, 0x05, 0xc1, 0x8c, 0xf7, 0x1b,
+    0xc1, 0x8d, 0x05, 0x0b, 0xc1, 0x8d, 0x11, 0x15, 0xc1, 0x8d, 0x23, 0x0e,
+    0xc1, 0x8d, 0x2d, 0xc4, 0xdf, 0x60, 0x08, 0x2a, 0x01, 0x0c, 0xc1, 0x8d,
+    0x39, 0x0d, 0xc1, 0x8d, 0x45, 0xc4, 0xe1, 0x0c, 0x08, 0x2a, 0x31, 0x42,
+    0x0f, 0xba, 0xc1, 0x8d, 0x51, 0xc3, 0xdb, 0xb1, 0x08, 0x2a, 0x61, 0xc4,
+    0xe2, 0x38, 0x08, 0x2a, 0x71, 0xc2, 0x00, 0x47, 0x08, 0x2a, 0x91, 0xc3,
+    0xcd, 0xb2, 0x08, 0x2a, 0xa1, 0x12, 0xc1, 0x8d, 0x59, 0xc3, 0x07, 0xa3,
+    0x08, 0x2a, 0xc9, 0xc4, 0xde, 0x58, 0x08, 0x2a, 0xd8, 0xcc, 0x86, 0x34,
+    0x0f, 0xb1, 0xc9, 0xc9, 0xac, 0x82, 0x0f, 0xb1, 0xe0, 0x51, 0x57, 0x51,
+    0xc1, 0x8d, 0x65, 0x14, 0x41, 0x8d, 0xd6, 0x48, 0x58, 0xe2, 0xc1, 0x8d,
+    0xe0, 0x10, 0xc1, 0x8d, 0xec, 0x4f, 0x68, 0x9f, 0xc1, 0x8d, 0xf8, 0x44,
+    0x34, 0xfa, 0x41, 0x8e, 0x04, 0x0b, 0xc1, 0x8e, 0x0c, 0x07, 0x41, 0x8e,
+    0x18, 0x43, 0x00, 0x30, 0xc1, 0x8e, 0x24, 0x11, 0xc1, 0x8e, 0x2e, 0x45,
+    0x09, 0x34, 0xc1, 0x8e, 0x3a, 0x42, 0x00, 0x65, 0x41, 0x8e, 0x46, 0x43,
+    0x07, 0xca, 0xc1, 0x8e, 0x52, 0xcf, 0x64, 0x49, 0x00, 0xd5, 0xb0, 0x46,
+    0x16, 0x55, 0xc1, 0x8e, 0x5e, 0xcf, 0x0f, 0x8d, 0x01, 0x06, 0xd9, 0xc4,
+    0x20, 0x42, 0x00, 0x18, 0x1b, 0x01, 0x8e, 0x70, 0xd1, 0x4e, 0xe2, 0x00,
+    0x18, 0x90, 0x11, 0xc1, 0x8e, 0x74, 0x07, 0xc1, 0x8e, 0x84, 0xc8, 0x20,
+    0xc4, 0x00, 0x18, 0x42, 0x01, 0x8e, 0x90, 0x49, 0xb1, 0x80, 0xc1, 0x8e,
+    0x9c, 0xd0, 0x57, 0xd2, 0x00, 0x1a, 0x38, 0xce, 0x3c, 0xd0, 0x01, 0x06,
+    0xe1, 0xc6, 0xcd, 0x22, 0x00, 0x1a, 0x90, 0x49, 0x04, 0x5b, 0xc1, 0x8e,
+    0xbb, 0x48, 0xba, 0x70, 0xc1, 0x8e, 0xc7, 0xd0, 0x0a, 0x19, 0x00, 0x18,
+    0x13, 0x01, 0x8e, 0xf3, 0x03, 0xc1, 0x8e, 0xf9, 0x11, 0xc1, 0x8f, 0x08,
+    0xc6, 0xb7, 0x7a, 0x00, 0x19, 0x38, 0x45, 0x2c, 0x9f, 0xc1, 0x8f, 0x17,
+    0xce, 0x6d, 0x30, 0x00, 0xee, 0x19, 0xca, 0xa1, 0x14, 0x00, 0xee, 0x11,
+    0x47, 0x22, 0x38, 0xc1, 0x8f, 0x21, 0x16, 0xc1, 0x8f, 0x2d, 0xcc, 0x80,
+    0xac, 0x00, 0x19, 0xe0, 0xca, 0x9b, 0x6a, 0x08, 0x99, 0xd9, 0x14, 0x41,
+    0x8f, 0x33, 0x4b, 0x99, 0x72, 0xc1, 0x8f, 0x42, 0x50, 0x5e, 0x42, 0x41,
+    0x8f, 0x4e, 0x12, 0xc1, 0x8f, 0x5a, 0xc7, 0x03, 0x0f, 0x00, 0xee, 0x91,
+    0xc7, 0x04, 0xc2, 0x00, 0xee, 0x88, 0xc7, 0x03, 0x22, 0x00, 0xee, 0x81,
+    0x10, 0x41, 0x8f, 0x66, 0xc5, 0x01, 0x24, 0x00, 0xee, 0x79, 0xc5, 0x00,
+    0xd2, 0x00, 0x1a, 0xd8, 0xc5, 0xcc, 0x9f, 0x00, 0x19, 0x43, 0x01, 0x8f,
+    0x72, 0xce, 0x6f, 0xb4, 0x00, 0xd5, 0xb9, 0xc7, 0x7b, 0x64, 0x00, 0x18,
+    0x29, 0x51, 0x52, 0x45, 0x41, 0x8f, 0x78, 0xc5, 0x69, 0x7b, 0x00, 0x18,
+    0x23, 0x01, 0x8f, 0x96, 0xcf, 0x66, 0xa1, 0x00, 0x19, 0x00, 0x49, 0x64,
+    0xb3, 0xc1, 0x8f, 0x9e, 0x03, 0x41, 0x8f, 0xaa, 0xd0, 0x58, 0xd2, 0x00,
+    0xd6, 0x31, 0xce, 0x74, 0xa0, 0x00, 0x1a, 0x50, 0xc8, 0xb5, 0x68, 0x00,
+    0xd5, 0xa9, 0x01, 0x41, 0x8f, 0xb6, 0xc8, 0x9d, 0x7e, 0x00, 0x18, 0x49,
+    0xc2, 0x03, 0x82, 0x00, 0x18, 0xd9, 0xce, 0x6f, 0x52, 0x00, 0x1a, 0x58,
+    0x45, 0x00, 0xdf, 0xc1, 0x8f, 0xc2, 0xc5, 0x20, 0x41, 0x00, 0x19, 0xf0,
+    0xca, 0x94, 0xa3, 0x01, 0x02, 0x91, 0xc2, 0x01, 0x17, 0x00, 0x02, 0x00,
+    0x4b, 0x93, 0xbb, 0xc1, 0x8f, 0xce, 0x4b, 0x99, 0xeb, 0x41, 0x8f, 0xec,
+    0xc4, 0xdf, 0x00, 0x01, 0x19, 0xa9, 0xc4, 0xe0, 0xa0, 0x01, 0x19, 0xa0,
+    0x45, 0x00, 0x92, 0xc1, 0x90, 0x0a, 0x43, 0x43, 0x26, 0x41, 0x90, 0x1c,
+    0xc5, 0xda, 0x8a, 0x0f, 0x9c, 0xd9, 0xd3, 0x44, 0xa4, 0x00, 0x04, 0xd8,
+    0xc6, 0x0f, 0xaf, 0x01, 0x12, 0xa1, 0xc4, 0x00, 0x8d, 0x01, 0x05, 0x08,
+    0x4c, 0x28, 0xa8, 0xc1, 0x90, 0x2b, 0x46, 0x12, 0x2e, 0x41, 0x90, 0x98,
+    0x4e, 0x09, 0x3a, 0xc1, 0x90, 0xb2, 0x49, 0x2a, 0xe0, 0x41, 0x91, 0x1f,
+    0xce, 0x70, 0xa2, 0x08, 0x17, 0x01, 0x46, 0x04, 0x99, 0xc1, 0x91, 0x2b,
+    0x47, 0x37, 0xb8, 0x41, 0x91, 0x49, 0xc9, 0x11, 0xa1, 0x01, 0x67, 0xc9,
+    0xd4, 0x31, 0xb2, 0x01, 0x67, 0xd1, 0xd6, 0x31, 0xb0, 0x01, 0x67, 0xd9,
+    0xcd, 0x4d, 0x3a, 0x01, 0x67, 0xe0, 0xd0, 0x54, 0x44, 0x01, 0x67, 0xe9,
+    0xc8, 0x11, 0xa2, 0x01, 0x67, 0xf0, 0xcd, 0x77, 0x1a, 0x0f, 0xa8, 0x81,
+    0x4d, 0x7a, 0x5a, 0xc1, 0x91, 0x67, 0xc4, 0xcf, 0xbf, 0x0f, 0xa6, 0xa9,
+    0x17, 0xc1, 0x91, 0x73, 0xd8, 0x22, 0x8d, 0x01, 0x52, 0x69, 0x42, 0x02,
+    0x0b, 0x41, 0x91, 0x82, 0xd3, 0x46, 0xde, 0x01, 0x3f, 0x99, 0x05, 0xc1,
+    0x91, 0x94, 0xc8, 0x1e, 0x5a, 0x01, 0x11, 0x89, 0xd1, 0x00, 0x77, 0x01,
+    0x0d, 0xd9, 0x16, 0xc1, 0x91, 0xa0, 0x45, 0x00, 0x64, 0xc1, 0x91, 0xac,
+    0x48, 0x05, 0xca, 0x41, 0x91, 0xb8, 0x16, 0xc1, 0x91, 0xbe, 0x07, 0xc1,
+    0x91, 0xce, 0x44, 0x28, 0x74, 0xc1, 0x91, 0xda, 0x15, 0xc1, 0x91, 0xe6,
+    0x08, 0xc1, 0x91, 0xf2, 0x43, 0x05, 0x16, 0x41, 0x91, 0xfe, 0xc9, 0xa7,
+    0xd5, 0x0f, 0x99, 0x49, 0xc4, 0x2a, 0x64, 0x0f, 0x99, 0x41, 0xc4, 0x2b,
+    0x61, 0x0f, 0x99, 0x39, 0xc7, 0xc3, 0x5d, 0x0f, 0x99, 0x50, 0x05, 0xc1,
+    0x92, 0x0a, 0x0a, 0xc1, 0x92, 0x1e, 0xde, 0x0d, 0xda, 0x01, 0x3a, 0x11,
+    0x19, 0xc1, 0x92, 0x36, 0x06, 0xc1, 0x92, 0x40, 0x0e, 0xc1, 0x92, 0x4e,
+    0x47, 0x37, 0xb8, 0xc1, 0x92, 0x5a, 0x16, 0xc1, 0x92, 0x70, 0xc6, 0x0f,
+    0xaf, 0x01, 0x14, 0xe1, 0x03, 0xc1, 0x92, 0x7f, 0x14, 0xc1, 0x92, 0x8b,
+    0x0f, 0xc1, 0x92, 0x97, 0x12, 0xc1, 0x92, 0xa3, 0x0b, 0xc1, 0x92, 0xbb,
+    0xcc, 0x06, 0x09, 0x01, 0x4e, 0x09, 0x04, 0xc1, 0x92, 0xcd, 0xcc, 0x06,
+    0xbd, 0x01, 0x4d, 0xb1, 0xcf, 0x68, 0x63, 0x0f, 0x88, 0x69, 0x9a, 0x01,
+    0x5d, 0xf1, 0xc6, 0x09, 0x2b, 0x0f, 0xbe, 0xb9, 0x0d, 0x41, 0x92, 0xd9,
+    0x45, 0x00, 0x92, 0xc1, 0x92, 0xe5, 0x5e, 0x0f, 0xf6, 0x41, 0x93, 0x0f,
+    0x97, 0x09, 0x1b, 0x53, 0x01, 0x93, 0x15, 0x83, 0x09, 0x1a, 0xeb, 0x01,
+    0x93, 0x2c, 0x8b, 0x09, 0x1b, 0x1b, 0x01, 0x93, 0x3e, 0xc2, 0x8d, 0xb7,
+    0x09, 0x1b, 0x10, 0x94, 0x09, 0x19, 0x43, 0x01, 0x93, 0x59, 0x01, 0xc1,
+    0x93, 0x76, 0x8f, 0x09, 0x18, 0xeb, 0x01, 0x93, 0x89, 0x1c, 0xc1, 0x93,
+    0x9e, 0xc4, 0xde, 0xa4, 0x09, 0x1a, 0xc9, 0xc2, 0x00, 0xa7, 0x09, 0x1a,
+    0x8b, 0x01, 0x93, 0xa9, 0x90, 0x09, 0x19, 0x33, 0x01, 0x93, 0xbd, 0x86,
+    0x09, 0x18, 0x9b, 0x01, 0x93, 0xc3, 0x84, 0x09, 0x18, 0x91, 0xa1, 0x09,
+    0x18, 0x88, 0x97, 0x09, 0x18, 0x2b, 0x01, 0x93, 0xcd, 0x83, 0x09, 0x17,
+    0x5b, 0x01, 0x93, 0xe5, 0x8b, 0x09, 0x17, 0xf3, 0x01, 0x94, 0x04, 0x87,
+    0x09, 0x17, 0xe2, 0x01, 0x94, 0x19, 0x8b, 0x09, 0x16, 0xdb, 0x01, 0x94,
+    0x1f, 0x0a, 0xc1, 0x94, 0x36, 0x83, 0x09, 0x14, 0x9b, 0x01, 0x94, 0x4f,
+    0x97, 0x09, 0x17, 0x12, 0x01, 0x94, 0x67, 0x8b, 0x09, 0x12, 0x63, 0x01,
+    0x94, 0x88, 0x97, 0x09, 0x13, 0x0b, 0x01, 0x94, 0xa6, 0x83, 0x09, 0x11,
+    0xf3, 0x01, 0x94, 0xb6, 0x87, 0x09, 0x12, 0x42, 0x01, 0x94, 0xce, 0x97,
+    0x09, 0x11, 0x63, 0x01, 0x94, 0xd2, 0x8b, 0x09, 0x11, 0x53, 0x01, 0x94,
+    0xf4, 0x87, 0x09, 0x11, 0x43, 0x01, 0x94, 0xfe, 0x83, 0x09, 0x11, 0x02,
+    0x01, 0x95, 0x05, 0x97, 0x09, 0x0f, 0xdb, 0x01, 0x95, 0x1e, 0x83, 0x09,
+    0x0d, 0xbb, 0x01, 0x95, 0x47, 0x8b, 0x09, 0x0f, 0xba, 0x01, 0x95, 0x67,
+    0x83, 0x09, 0x0a, 0xbb, 0x01, 0x95, 0x77, 0xc5, 0xdb, 0x2a, 0x09, 0x0d,
+    0xb1, 0x97, 0x09, 0x0d, 0x53, 0x01, 0x95, 0xad, 0x8b, 0x09, 0x0d, 0x03,
+    0x01, 0x95, 0xda, 0xc4, 0x6f, 0xe8, 0x09, 0x0c, 0xf8, 0x8b, 0x09, 0x09,
+    0x6b, 0x01, 0x95, 0xec, 0x83, 0x09, 0x09, 0x4b, 0x01, 0x95, 0xf2, 0x97,
+    0x09, 0x09, 0xba, 0x01, 0x95, 0xfa, 0x97, 0x09, 0x08, 0xb3, 0x01, 0x96,
+    0x0f, 0x8b, 0x09, 0x08, 0x03, 0x01, 0x96, 0x35, 0x07, 0xc1, 0x96, 0x52,
+    0x83, 0x09, 0x05, 0xaa, 0x01, 0x96, 0x61, 0xc3, 0x0a, 0x44, 0x09, 0x05,
+    0x0b, 0x01, 0x96, 0x9d, 0xc3, 0x08, 0x10, 0x09, 0x05, 0x03, 0x01, 0x96,
+    0xa1, 0x14, 0xc1, 0x96, 0xa7, 0xa1, 0x09, 0x04, 0x6b, 0x01, 0x96, 0xb6,
+    0x90, 0x09, 0x04, 0xbb, 0x01, 0x96, 0xbc, 0x8e, 0x09, 0x04, 0xb1, 0xc3,
+    0xe1, 0x68, 0x09, 0x04, 0xa9, 0xc3, 0x09, 0x92, 0x09, 0x04, 0xa1, 0x01,
+    0x41, 0x96, 0xc0, 0x97, 0x09, 0x03, 0xd3, 0x01, 0x96, 0xcc, 0x8b, 0x09,
+    0x03, 0x93, 0x01, 0x96, 0xef, 0x83, 0x09, 0x02, 0xaa, 0x01, 0x97, 0x0a,
+    0x97, 0x09, 0x02, 0x6b, 0x01, 0x97, 0x22, 0x83, 0x09, 0x02, 0x03, 0x01,
+    0x97, 0x36, 0x8b, 0x09, 0x02, 0x4a, 0x01, 0x97, 0x5a, 0x86, 0x09, 0x00,
+    0xe3, 0x01, 0x97, 0x60, 0x84, 0x09, 0x00, 0x53, 0x01, 0x97, 0x66, 0xc3,
+    0x01, 0x65, 0x09, 0x01, 0x5b, 0x01, 0x97, 0x71, 0x15, 0xc1, 0x97, 0x77,
+    0x14, 0xc1, 0x97, 0x84, 0xc3, 0x0d, 0x9c, 0x09, 0x01, 0x99, 0x90, 0x09,
+    0x01, 0x6b, 0x01, 0x97, 0x93, 0x8e, 0x09, 0x01, 0x03, 0x01, 0x97, 0x9d,
+    0x8d, 0x09, 0x00, 0xeb, 0x01, 0x97, 0xaf, 0xa1, 0x09, 0x00, 0x49, 0x47,
+    0x00, 0xee, 0x41, 0x97, 0xb5, 0x8b, 0x09, 0x13, 0xfb, 0x01, 0x97, 0xe3,
+    0xc4, 0x6f, 0xe8, 0x09, 0x13, 0xf3, 0x01, 0x97, 0xeb, 0x83, 0x09, 0x13,
+    0xd2, 0x01, 0x97, 0xf1, 0x97, 0x09, 0x14, 0x91, 0x8b, 0x09, 0x14, 0x89,
+    0x83, 0x09, 0x14, 0x7a, 0x01, 0x97, 0xfd, 0xc2, 0x00, 0xa7, 0x09, 0x0a,
+    0xb1, 0x94, 0x09, 0x0a, 0xa9, 0x90, 0x09, 0x0a, 0xa1, 0x8f, 0x09, 0x0a,
+    0x73, 0x01, 0x98, 0x01, 0x8e, 0x09, 0x0a, 0x5b, 0x01, 0x98, 0x0b, 0x89,
+    0x09, 0x0a, 0x2b, 0x01, 0x98, 0x15, 0xc3, 0x7e, 0x6b, 0x09, 0x0a, 0x13,
+    0x01, 0x98, 0x1c, 0x84, 0x09, 0x0a, 0x09, 0xc2, 0x00, 0x6a, 0x09, 0x0a,
+    0x00, 0xc9, 0xab, 0x8f, 0x09, 0x23, 0xa1, 0xc8, 0xb9, 0x00, 0x09, 0x23,
+    0x99, 0xc5, 0x36, 0xec, 0x09, 0x23, 0x90, 0x43, 0x00, 0xe1, 0xc1, 0x98,
+    0x22, 0x44, 0xe1, 0x70, 0x41, 0x98, 0x4a, 0x45, 0x01, 0x79, 0xc1, 0x98,
+    0x56, 0x47, 0xca, 0x10, 0x41, 0x98, 0x7e, 0x45, 0x19, 0xcc, 0xc1, 0x98,
+    0x8e, 0x43, 0x4c, 0xa5, 0xc1, 0x98, 0xb3, 0x54, 0x3b, 0x26, 0x41, 0x98,
+    0xdb, 0x44, 0x0c, 0xf7, 0xc1, 0x98, 0xe7, 0x44, 0x04, 0xa0, 0x41, 0x99,
+    0x0b, 0x43, 0x00, 0xe1, 0xc1, 0x99, 0x3a, 0x50, 0x5f, 0xc2, 0x41, 0x99,
+    0x60, 0x43, 0x01, 0xa2, 0xc1, 0x99, 0x6c, 0x45, 0x03, 0xe0, 0x41, 0x99,
+    0x91, 0x42, 0x00, 0x29, 0xc1, 0x99, 0xb6, 0xd1, 0x54, 0x65, 0x01, 0x1d,
+    0x50, 0xc8, 0xbe, 0x18, 0x0f, 0xa5, 0x89, 0xc4, 0x00, 0x8d, 0x00, 0x05,
+    0x20, 0xc8, 0x7b, 0x63, 0x07, 0xf2, 0x51, 0xc8, 0x7f, 0x4c, 0x07, 0xf2,
+    0x70, 0xa1, 0x09, 0x7f, 0x91, 0xa0, 0x09, 0x7f, 0x88, 0x20, 0xc1, 0x99,
+    0xc2, 0x1f, 0x41, 0x99, 0xce, 0x28, 0xc1, 0x99, 0xf2, 0x27, 0xc1, 0x9a,
+    0x16, 0x26, 0xc1, 0x9a, 0x3e, 0x25, 0xc1, 0x9a, 0x65, 0x24, 0xc1, 0x9a,
+    0x89, 0x23, 0xc1, 0x9a, 0xad, 0x22, 0xc1, 0x9a, 0xc5, 0x21, 0xc1, 0x9a,
+    0xe5, 0x20, 0xc1, 0x9b, 0x05, 0x1f, 0x41, 0x9b, 0x24, 0x91, 0x08, 0x41,
+    0xf9, 0x83, 0x08, 0x41, 0xe0, 0x87, 0x08, 0x41, 0xc1, 0x83, 0x08, 0x41,
+    0xb8, 0x91, 0x08, 0x41, 0xa9, 0x8b, 0x08, 0x41, 0xa1, 0x87, 0x08, 0x41,
+    0x99, 0x83, 0x08, 0x41, 0x90, 0x97, 0x08, 0x41, 0x89, 0x91, 0x08, 0x41,
+    0x81, 0x8b, 0x08, 0x41, 0x79, 0x87, 0x08, 0x41, 0x71, 0x83, 0x08, 0x41,
+    0x68, 0x97, 0x08, 0x41, 0x61, 0x91, 0x08, 0x41, 0x59, 0x8b, 0x08, 0x41,
+    0x51, 0x87, 0x08, 0x41, 0x49, 0x83, 0x08, 0x41, 0x40, 0x97, 0x08, 0x41,
+    0x39, 0x91, 0x08, 0x41, 0x31, 0x8b, 0x08, 0x41, 0x29, 0x87, 0x08, 0x41,
+    0x21, 0x83, 0x08, 0x41, 0x18, 0x97, 0x08, 0x41, 0x11, 0x91, 0x08, 0x41,
+    0x09, 0x8b, 0x08, 0x41, 0x01, 0x87, 0x08, 0x40, 0xf9, 0x83, 0x08, 0x40,
+    0xf0, 0x97, 0x08, 0x40, 0xe9, 0x91, 0x08, 0x40, 0xe1, 0x8b, 0x08, 0x40,
+    0xd9, 0x87, 0x08, 0x40, 0xd1, 0x83, 0x08, 0x40, 0xc8, 0x97, 0x08, 0x40,
+    0xc1, 0x91, 0x08, 0x40, 0xb9, 0x8b, 0x08, 0x40, 0xb1, 0x87, 0x08, 0x40,
+    0xa9, 0x83, 0x08, 0x40, 0xa0, 0x97, 0x08, 0x40, 0x99, 0x83, 0x08, 0x40,
+    0x79, 0x87, 0x08, 0x40, 0x81, 0x8b, 0x08, 0x40, 0x89, 0x91, 0x08, 0x40,
+    0x90, 0x83, 0x08, 0x40, 0x29, 0x91, 0x08, 0x40, 0x40, 0x83, 0x08, 0x40,
+    0x51, 0x87, 0x08, 0x40, 0x59, 0x8b, 0x08, 0x40, 0x61, 0x91, 0x08, 0x40,
+    0x69, 0x97, 0x08, 0x40, 0x70, 0x97, 0x00, 0x22, 0x1b, 0x01, 0x9b, 0x44,
+    0x16, 0xc1, 0x9b, 0x57, 0x19, 0xc1, 0x9b, 0x7a, 0x10, 0xc1, 0x9b, 0x84,
+    0x0e, 0xc1, 0x9b, 0x96, 0x14, 0xc1, 0x9b, 0xae, 0x87, 0x00, 0x22, 0x6b,
+    0x01, 0x9b, 0xc0, 0x06, 0xc1, 0x9b, 0xed, 0x15, 0xc1, 0x9c, 0x10, 0x12,
+    0xc1, 0x9c, 0x32, 0x83, 0x00, 0x21, 0x83, 0x01, 0x9c, 0x45, 0xc2, 0x0f,
+    0xba, 0x00, 0x28, 0xd9, 0x1b, 0xc1, 0x9c, 0x57, 0x0d, 0xc1, 0x9c, 0x73,
+    0x0a, 0xc1, 0x9c, 0x90, 0x09, 0xc1, 0x9c, 0x9d, 0x04, 0xc1, 0x9c, 0xac,
+    0x91, 0x00, 0x21, 0xf3, 0x01, 0x9c, 0xca, 0x8b, 0x00, 0x21, 0xc3, 0x01,
+    0x9c, 0xdd, 0x1c, 0xc1, 0x9c, 0xfa, 0x05, 0xc1, 0x9d, 0x05, 0xc4, 0xe1,
+    0x30, 0x00, 0x23, 0x99, 0xc2, 0x19, 0x48, 0x00, 0x22, 0xc1, 0x44, 0x13,
+    0x6f, 0xc1, 0x9d, 0x20, 0xc2, 0x00, 0x98, 0x00, 0x21, 0x90, 0xc4, 0xdf,
+    0xd4, 0x00, 0x26, 0xa9, 0xc6, 0xd2, 0x86, 0x00, 0x25, 0xa9, 0xc6, 0xd1,
+    0x66, 0x00, 0x25, 0x28, 0x87, 0x00, 0x21, 0x6b, 0x01, 0x9d, 0x2c, 0x06,
+    0xc1, 0x9d, 0x59, 0x15, 0xc1, 0x9d, 0x7c, 0x12, 0xc1, 0x9d, 0x9e, 0x83,
+    0x00, 0x20, 0x83, 0x01, 0x9d, 0xab, 0xc2, 0x00, 0x2b, 0x00, 0x28, 0xe1,
+    0xc2, 0x0f, 0xba, 0x00, 0x28, 0xd1, 0x1b, 0xc1, 0x9d, 0xbd, 0x14, 0xc1,
+    0x9d, 0xd9, 0x0e, 0xc1, 0x9d, 0xeb, 0x0d, 0xc1, 0x9d, 0xfd, 0x0a, 0xc1,
+    0x9e, 0x1a, 0x09, 0xc1, 0x9e, 0x27, 0x05, 0xc1, 0x9e, 0x36, 0x97, 0x00,
+    0x21, 0x1b, 0x01, 0x9e, 0x51, 0x04, 0xc1, 0x9e, 0x5e, 0x91, 0x00, 0x20,
+    0xf3, 0x01, 0x9e, 0x7c, 0x8b, 0x00, 0x20, 0xc3, 0x01, 0x9e, 0x8f, 0x1c,
+    0xc1, 0x9e, 0xac, 0x16, 0xc1, 0x9e, 0xb7, 0xc4, 0xe1, 0x30, 0x00, 0x23,
+    0x91, 0xc2, 0x19, 0x48, 0x00, 0x20, 0x41, 0x10, 0xc1, 0x9e, 0xce, 0xc2,
+    0x00, 0x98, 0x00, 0x20, 0x91, 0x44, 0x13, 0x6f, 0x41, 0x9e, 0xda, 0xc4,
+    0xdf, 0xd4, 0x00, 0x26, 0xa1, 0xc6, 0xd2, 0x86, 0x00, 0x25, 0xa1, 0xc6,
+    0xd1, 0x66, 0x00, 0x25, 0x20, 0x92, 0x01, 0x74, 0xc9, 0x8f, 0x01, 0x75,
+    0xb9, 0xc2, 0x00, 0xaf, 0x01, 0x76, 0xb8, 0xc3, 0x41, 0x09, 0x01, 0x74,
+    0x09, 0xc5, 0x7f, 0x01, 0x01, 0x76, 0x10, 0xc6, 0xce, 0xd2, 0x01, 0x75,
+    0x01, 0xc2, 0x0c, 0xf3, 0x01, 0x76, 0x78, 0x15, 0xc1, 0x9e, 0xe6, 0xc4,
+    0x63, 0x50, 0x01, 0x76, 0x59, 0x09, 0xc1, 0x9f, 0x04, 0x0e, 0xc1, 0x9f,
+    0x10, 0x16, 0xc1, 0x9f, 0x1c, 0xc4, 0x42, 0x1a, 0x01, 0x76, 0xd9, 0x08,
+    0xc1, 0x9f, 0x2e, 0x07, 0xc1, 0x9f, 0x40, 0xc5, 0xa2, 0x77, 0x01, 0x77,
+    0x11, 0xc4, 0xa3, 0x18, 0x01, 0x77, 0x31, 0xc6, 0x89, 0x16, 0x01, 0x77,
+    0x80, 0x45, 0x71, 0xca, 0xc1, 0x9f, 0x4c, 0xc2, 0x00, 0x52, 0x01, 0x74,
+    0x58, 0xc3, 0x05, 0x16, 0x01, 0x74, 0x61, 0xc3, 0x01, 0xa1, 0x01, 0x74,
+    0x68, 0xc3, 0x25, 0x11, 0x01, 0x74, 0x91, 0x44, 0x4a, 0xd9, 0x41, 0x9f,
+    0x56, 0x49, 0x8a, 0xdb, 0xc1, 0x9f, 0x62, 0xc2, 0x3a, 0x35, 0x01, 0x75,
+    0x78, 0xc3, 0x05, 0x16, 0x01, 0x75, 0x61, 0xc3, 0x01, 0xa1, 0x01, 0x75,
+    0x68, 0xc3, 0x05, 0x16, 0x01, 0x75, 0x21, 0xc3, 0x01, 0xa1, 0x01, 0x75,
+    0x28, 0x9a, 0x01, 0x74, 0x31, 0xcb, 0x90, 0x61, 0x01, 0x75, 0x51, 0xc2,
+    0x00, 0xe1, 0x01, 0x77, 0x18, 0xc3, 0x05, 0x16, 0x01, 0x75, 0xd1, 0xc3,
+    0x01, 0xa1, 0x01, 0x75, 0xd8, 0xc3, 0x05, 0x16, 0x01, 0x74, 0x71, 0x16,
+    0xc1, 0x9f, 0x70, 0xc4, 0x04, 0x9f, 0x01, 0x74, 0x88, 0xc3, 0x05, 0x16,
+    0x01, 0x76, 0x89, 0xc3, 0x01, 0xa1, 0x01, 0x76, 0x90, 0x43, 0x0e, 0xea,
+    0xc1, 0x9f, 0x7c, 0x86, 0x01, 0x77, 0x08, 0xc2, 0x00, 0x47, 0x01, 0x74,
+    0xe9, 0xc4, 0x15, 0x4b, 0x01, 0x74, 0xf9, 0xc4, 0xd5, 0x81, 0x01, 0x75,
+    0xe9, 0x44, 0x0d, 0xd2, 0x41, 0x9f, 0x88, 0xc2, 0x00, 0xa7, 0x01, 0x75,
+    0xa9, 0xc2, 0x01, 0x17, 0x01, 0x75, 0xe0, 0x44, 0x01, 0x95, 0xc1, 0x9f,
+    0x94, 0x43, 0xe5, 0x7a, 0x41, 0x9f, 0xa0, 0xc3, 0x05, 0x16, 0x01, 0x76,
+    0x19, 0xc3, 0x01, 0xa1, 0x01, 0x76, 0x20, 0xc4, 0x17, 0xf7, 0x01, 0x77,
+    0x59, 0x16, 0xc1, 0x9f, 0xac, 0xc6, 0x89, 0x16, 0x01, 0x77, 0x78, 0xc3,
+    0x05, 0x16, 0x01, 0x76, 0xe9, 0x16, 0x41, 0x9f, 0xb8, 0xc2, 0x01, 0xa2,
+    0x01, 0x75, 0x91, 0xc4, 0x03, 0xe0, 0x01, 0x75, 0x98, 0xc3, 0x05, 0x16,
+    0x01, 0x75, 0xf1, 0x16, 0x41, 0x9f, 0xc4, 0x9c, 0x01, 0x8e, 0xc1, 0x89,
+    0x01, 0x8e, 0xf8, 0xc2, 0x64, 0x57, 0x01, 0x8e, 0x49, 0x9c, 0x01, 0x8e,
+    0xf0, 0x9c, 0x01, 0x8e, 0x2b, 0x01, 0x9f, 0xd0, 0x89, 0x01, 0x8e, 0x31,
+    0x99, 0x01, 0x8e, 0x6b, 0x01, 0x9f, 0xdb, 0x96, 0x01, 0x8e, 0x50, 0xc2,
+    0x64, 0x57, 0x01, 0x8e, 0x60, 0x07, 0xc1, 0x9f, 0xdf, 0xd5, 0x32, 0xec,
+    0x01, 0x3e, 0x31, 0xcd, 0x22, 0x38, 0x00, 0x02, 0xeb, 0x01, 0x9f, 0xeb,
+    0x0b, 0xc1, 0x9f, 0xef, 0x42, 0x00, 0x78, 0xc1, 0x9f, 0xfb, 0xd3, 0x1d,
+    0xf4, 0x01, 0x70, 0x18, 0x10, 0xc1, 0xa0, 0x0a, 0x14, 0x41, 0xa0, 0x14,
+    0xc9, 0x9c, 0x29, 0x01, 0x3e, 0xb1, 0x43, 0x00, 0xe1, 0xc1, 0xa0, 0x20,
+    0xcf, 0x60, 0xa7, 0x0f, 0xdd, 0xe0, 0x43, 0x04, 0x32, 0xc1, 0xa0, 0x2c,
+    0xd5, 0x35, 0x0e, 0x0f, 0xab, 0xe8, 0xc7, 0xc5, 0x86, 0x01, 0x1d, 0xc9,
+    0xcd, 0x7e, 0xd2, 0x01, 0x71, 0x08, 0xcc, 0x00, 0x35, 0x00, 0x03, 0xeb,
+    0x01, 0xa0, 0x44, 0xc6, 0xbe, 0xd9, 0x01, 0x18, 0x49, 0xcd, 0x69, 0xfa,
+    0x01, 0x80, 0x68, 0x01, 0x41, 0xa0, 0x48, 0xc4, 0x1f, 0x8a, 0x01, 0x18,
+    0x59, 0x0b, 0x41, 0xa0, 0x5a, 0x14, 0xc1, 0xa0, 0x66, 0xc3, 0x00, 0x3c,
+    0x01, 0x15, 0x11, 0x0a, 0xc1, 0xa0, 0x72, 0xd5, 0x06, 0xeb, 0x01, 0x80,
+    0xa8, 0x45, 0x03, 0x7c, 0xc1, 0xa0, 0x84, 0xd9, 0x1d, 0xee, 0x01, 0x70,
+    0x28, 0xcb, 0x87, 0x79, 0x01, 0x4e, 0xc9, 0x45, 0x00, 0xbc, 0x41, 0xa0,
+    0x9a, 0xd6, 0x06, 0xea, 0x01, 0x4c, 0xc1, 0xd2, 0x25, 0xdb, 0x01, 0x80,
+    0x88, 0xca, 0x03, 0x3f, 0x01, 0x0f, 0x43, 0x01, 0xa0, 0xb6, 0xc9, 0xa8,
+    0xda, 0x01, 0x0c, 0xe8, 0x42, 0x00, 0x4c, 0xc1, 0xa0, 0xba, 0x42, 0x01,
+    0xa2, 0xc1, 0xa0, 0xc6, 0xd5, 0x38, 0x17, 0x0f, 0xc5, 0x18, 0xcf, 0x5b,
+    0xf3, 0x0f, 0xc2, 0x91, 0x42, 0x00, 0xe5, 0x41, 0xa0, 0xd2, 0x45, 0x10,
+    0xe5, 0xc1, 0xa0, 0xde, 0x03, 0x41, 0xa0, 0xea, 0x01, 0xc1, 0xa0, 0xf6,
+    0xc5, 0x14, 0xc3, 0x01, 0x48, 0xd0, 0xcb, 0x84, 0xcd, 0x01, 0x0f, 0x11,
+    0x46, 0x03, 0x7b, 0x41, 0xa1, 0x13, 0x45, 0x06, 0x65, 0xc1, 0xa1, 0x22,
+    0xd8, 0x21, 0xe5, 0x0f, 0xc5, 0x09, 0xdf, 0x0c, 0xa5, 0x0f, 0xc5, 0x48,
+    0xc5, 0xd0, 0x59, 0x0f, 0xb3, 0x71, 0xd7, 0x28, 0xb8, 0x0f, 0xc5, 0x28,
+    0xd0, 0x51, 0x9c, 0x0f, 0xc1, 0xb1, 0xe0, 0x03, 0x29, 0x0f, 0xc5, 0x58,
+    0xd0, 0x5a, 0x62, 0x0f, 0xa8, 0x71, 0xcd, 0x08, 0x53, 0x01, 0x19, 0x51,
+    0xd4, 0x3b, 0x8a, 0x01, 0x4f, 0xe9, 0xdb, 0x15, 0x62, 0x00, 0x05, 0xd8,
+    0xdc, 0x14, 0x17, 0x01, 0x3d, 0x49, 0xd7, 0x26, 0x79, 0x01, 0x49, 0xc0,
+    0xc7, 0x02, 0x1c, 0x01, 0x03, 0x39, 0xc8, 0xbf, 0x08, 0x01, 0x01, 0x71,
+    0xc9, 0xa8, 0xb6, 0x01, 0x01, 0x59, 0xc4, 0x01, 0x65, 0x01, 0x00, 0x78,
+    0xd6, 0x31, 0x16, 0x00, 0x2c, 0x69, 0xc4, 0xba, 0xda, 0x0f, 0xc8, 0xe1,
+    0xcb, 0x93, 0x8f, 0x00, 0x7e, 0xaa, 0x01, 0xa1, 0x2e, 0xc4, 0x00, 0x2f,
+    0x01, 0x5d, 0x81, 0xc5, 0x00, 0x64, 0x01, 0x5d, 0x88, 0xc4, 0x00, 0x2f,
+    0x01, 0x5d, 0x91, 0xc5, 0x00, 0x64, 0x01, 0x5d, 0x98, 0xc2, 0x00, 0x6f,
+    0x01, 0x5d, 0xa1, 0xc4, 0x05, 0x45, 0x01, 0x5d, 0xb0, 0xc2, 0x00, 0x6f,
+    0x01, 0x5d, 0xa9, 0xc4, 0x05, 0x45, 0x01, 0x5d, 0xb8, 0xc7, 0xc3, 0x2c,
+    0x0f, 0x9d, 0x11, 0xc5, 0xda, 0x9e, 0x0f, 0xb7, 0xe0, 0xc6, 0xd2, 0x14,
+    0x0f, 0x93, 0x21, 0xc2, 0x00, 0xd9, 0x0f, 0x93, 0x10, 0x01, 0x41, 0xa1,
+    0x34, 0x0b, 0xc1, 0xa1, 0x46, 0xc3, 0x04, 0xa0, 0x01, 0x0b, 0x18, 0xc2,
+    0x24, 0x36, 0x01, 0x0b, 0x2b, 0x01, 0xa1, 0x58, 0xc4, 0x17, 0xf7, 0x01,
+    0x0b, 0x30, 0xc2, 0x00, 0x79, 0x01, 0x0b, 0x4b, 0x01, 0xa1, 0x5e, 0x19,
+    0xc1, 0xa1, 0x64, 0xc4, 0x03, 0xe0, 0x01, 0x0b, 0x10, 0xc5, 0x65, 0x84,
+    0x01, 0x0b, 0x51, 0xc4, 0x00, 0x65, 0x01, 0x0b, 0x38, 0x42, 0x01, 0x42,
+    0xc1, 0xa1, 0x6e, 0xcb, 0x91, 0x74, 0x08, 0x0c, 0x91, 0xcd, 0x7d, 0xc1,
+    0x08, 0x0c, 0xc0, 0x46, 0x00, 0x91, 0x41, 0xa1, 0x7a, 0xc6, 0x00, 0x8b,
+    0x0f, 0x8b, 0x61, 0xc6, 0x43, 0x48, 0x0f, 0x8b, 0x59, 0xc6, 0x57, 0x7b,
+    0x0f, 0x8b, 0x50, 0xd8, 0x21, 0x0d, 0x01, 0x70, 0x38, 0xc7, 0x2a, 0x11,
+    0x00, 0x02, 0xe3, 0x01, 0xa1, 0x86, 0xc5, 0x0a, 0xe4, 0x00, 0x04, 0x69,
+    0x42, 0x00, 0xdf, 0xc1, 0xa1, 0x8a, 0x55, 0x34, 0xe4, 0xc1, 0xa1, 0x96,
+    0xcd, 0x79, 0x97, 0x0f, 0xb3, 0xf8, 0x14, 0xc1, 0xa1, 0xa2, 0xc8, 0x64,
+    0x14, 0x01, 0x18, 0x81, 0x16, 0xc1, 0xa1, 0xb4, 0x15, 0xc1, 0xa1, 0xc9,
+    0x12, 0xc1, 0xa1, 0xd5, 0x47, 0x03, 0x7a, 0xc1, 0xa1, 0xe1, 0xe0, 0x01,
+    0x29, 0x0f, 0xac, 0xa9, 0xcc, 0x86, 0xf4, 0x0f, 0xac, 0xa1, 0xc9, 0xae,
+    0x71, 0x01, 0x4d, 0x81, 0xc5, 0x00, 0xc4, 0x01, 0x4d, 0x1b, 0x01, 0xa1,
+    0xf0, 0xd2, 0x4b, 0x61, 0x01, 0x70, 0x89, 0xcd, 0x30, 0xea, 0x01, 0x71,
+    0x71, 0xc5, 0x04, 0x0c, 0x01, 0x72, 0x08, 0xa1, 0x01, 0x37, 0x09, 0xa0,
+    0x01, 0x37, 0x00, 0xd1, 0x53, 0x22, 0x01, 0x33, 0xd1, 0x45, 0x1b, 0x99,
+    0x41, 0xa1, 0xf6, 0x87, 0x05, 0x4a, 0x4b, 0x01, 0xa2, 0x20, 0x03, 0xc1,
+    0xa2, 0x28, 0x91, 0x05, 0x4a, 0x59, 0x97, 0x05, 0x4a, 0x41, 0x8b, 0x05,
+    0x4a, 0x38, 0x89, 0x05, 0x4a, 0x78, 0x1b, 0xc1, 0xa2, 0x30, 0xc2, 0x0e,
+    0x60, 0x05, 0x4a, 0x21, 0x09, 0xc1, 0xa2, 0x3a, 0x83, 0x05, 0x49, 0xa8,
+    0xc2, 0x00, 0xa0, 0x05, 0x4a, 0x11, 0x83, 0x05, 0x49, 0xc0, 0xc5, 0x0a,
+    0xc9, 0x08, 0x73, 0xe9, 0xc7, 0x06, 0x7b, 0x08, 0x73, 0xe1, 0xc4, 0x04,
+    0x30, 0x08, 0x73, 0xd8, 0xc8, 0x0c, 0xe6, 0x08, 0x73, 0xd1, 0xc2, 0x0c,
+    0xf3, 0x08, 0x73, 0x88, 0xc8, 0x0c, 0xe6, 0x08, 0x73, 0xc9, 0x9b, 0x08,
+    0x73, 0x80, 0x44, 0x17, 0xf7, 0xc1, 0xa2, 0x44, 0x42, 0x24, 0x36, 0x41,
+    0xa2, 0x50, 0x0b, 0xc1, 0xa2, 0x5c, 0x11, 0x41, 0xa2, 0x68, 0x0a, 0xc1,
+    0xa2, 0x74, 0x19, 0xc1, 0xa2, 0x80, 0xc2, 0x00, 0x79, 0x08, 0x73, 0x48,
+    0xc4, 0x17, 0xf7, 0x08, 0x73, 0x31, 0xc2, 0x24, 0x36, 0x08, 0x73, 0x28,
+    0xc3, 0x0c, 0xf7, 0x08, 0x73, 0x21, 0xc3, 0x04, 0xa0, 0x08, 0x73, 0x18,
+    0xc4, 0x03, 0xe0, 0x08, 0x73, 0x11, 0xc2, 0x01, 0xa2, 0x08, 0x73, 0x08,
+    0x08, 0xc1, 0xa2, 0x8c, 0x91, 0x00, 0xb5, 0x73, 0x01, 0xa2, 0x98, 0x15,
+    0xc1, 0xa2, 0xb6, 0x8d, 0x00, 0xb7, 0x8b, 0x01, 0xa2, 0xcf, 0x9a, 0x00,
+    0xb7, 0x51, 0x93, 0x00, 0xb7, 0x49, 0x0b, 0xc1, 0xa2, 0xd5, 0x0e, 0xc1,
+    0xa2, 0xf6, 0x85, 0x00, 0xb6, 0x6b, 0x01, 0xa3, 0x02, 0x87, 0x00, 0xb6,
+    0x13, 0x01, 0xa3, 0x12, 0x86, 0x00, 0xb6, 0x8b, 0x01, 0xa3, 0x2a, 0xcc,
+    0x8b, 0x2c, 0x00, 0xb6, 0xb9, 0xd8, 0x21, 0x6d, 0x00, 0xb6, 0x91, 0x16,
+    0xc1, 0xa3, 0x36, 0x9c, 0x00, 0xb6, 0x71, 0x03, 0xc1, 0xa3, 0x42, 0xcf,
+    0x61, 0x79, 0x00, 0xb6, 0x41, 0x89, 0x00, 0xb5, 0xab, 0x01, 0xa3, 0x5a,
+    0xc7, 0xc9, 0x92, 0x00, 0xb6, 0x19, 0xd1, 0x4f, 0x7b, 0x00, 0xb5, 0xf1,
+    0x42, 0x00, 0xce, 0xc1, 0xa3, 0x64, 0x99, 0x00, 0xb5, 0x2b, 0x01, 0xa3,
+    0x70, 0xd0, 0x5f, 0xe2, 0x00, 0xb5, 0x89, 0x9b, 0x00, 0xb5, 0x23, 0x01,
+    0xa3, 0x76, 0xc9, 0xae, 0x29, 0x00, 0xb5, 0x11, 0x98, 0x00, 0xb5, 0x08,
+    0xc7, 0xc4, 0x44, 0x0f, 0xa2, 0xd1, 0xc3, 0x1a, 0x76, 0x0f, 0xa2, 0x91,
+    0xc6, 0xb0, 0xcf, 0x0f, 0xa3, 0x09, 0xc5, 0xd5, 0xa3, 0x0f, 0xa3, 0x10,
+    0x45, 0xcc, 0x27, 0xc1, 0xa3, 0x7a, 0xc5, 0x00, 0x7d, 0x01, 0x2e, 0x5b,
+    0x01, 0xa3, 0xb1, 0xd4, 0x3f, 0x4a, 0x01, 0x3f, 0x0b, 0x01, 0xa3, 0xb5,
+    0xc8, 0xb9, 0xd8, 0x01, 0x33, 0x38, 0x07, 0xc1, 0xa3, 0xbb, 0xd5, 0x33,
+    0xe8, 0x0f, 0xad, 0x59, 0x11, 0x41, 0xa3, 0xc5, 0xca, 0x9b, 0x7e, 0x0f,
+    0xc5, 0x69, 0xc3, 0x05, 0x16, 0x0f, 0xc5, 0x60, 0xc5, 0x09, 0x2c, 0x01,
+    0x2d, 0x0b, 0x01, 0xa3, 0xd1, 0xc7, 0x32, 0x52, 0x01, 0x38, 0x21, 0xc9,
+    0xad, 0x7e, 0x01, 0x33, 0x21, 0xc2, 0x05, 0x1f, 0x0f, 0x99, 0x1b, 0x01,
+    0xa3, 0xd5, 0x0f, 0xc1, 0xa3, 0xd9, 0xca, 0x57, 0x36, 0x01, 0x30, 0xb1,
+    0xc3, 0x0d, 0xf5, 0x01, 0x30, 0x31, 0xc9, 0xad, 0x12, 0x07, 0xf2, 0x30,
+    0x03, 0xc1, 0xa3, 0xe5, 0x43, 0x00, 0x30, 0xc1, 0xa3, 0xf1, 0x45, 0x0a,
+    0x43, 0x41, 0xa3, 0xfb, 0xc6, 0x3f, 0x58, 0x01, 0x2e, 0x3b, 0x01, 0xa4,
+    0x01, 0x48, 0xb8, 0xf0, 0xc1, 0xa4, 0x05, 0x43, 0x04, 0x67, 0x41, 0xa4,
+    0x11, 0x14, 0xc1, 0xa4, 0x1d, 0xd7, 0x29, 0x2b, 0x01, 0x36, 0xb9, 0xc8,
+    0x35, 0x12, 0x01, 0x30, 0x79, 0xd2, 0x49, 0x33, 0x0f, 0xab, 0xf0, 0x0e,
+    0xc1, 0xa4, 0x29, 0x4c, 0x0e, 0x93, 0xc1, 0xa4, 0x36, 0xcc, 0x75, 0x47,
+    0x01, 0x31, 0xc8, 0x44, 0x00, 0x65, 0xc1, 0xa4, 0x42, 0xc8, 0x43, 0x2f,
+    0x01, 0x2d, 0x68, 0x4a, 0x09, 0x9f, 0xc1, 0xa4, 0x4e, 0x4a, 0x01, 0x4b,
+    0x41, 0xa4, 0x5a, 0x46, 0x04, 0x3e, 0xc1, 0xa4, 0x6f, 0xca, 0xa3, 0x58,
+    0x01, 0x5e, 0xe8, 0xcc, 0x83, 0x7c, 0x01, 0x2d, 0x89, 0x42, 0x00, 0x79,
+    0x41, 0xa4, 0x7f, 0x46, 0x05, 0x69, 0xc1, 0xa4, 0x8b, 0xce, 0x53, 0x03,
+    0x01, 0x58, 0xf0, 0xd5, 0x36, 0xc7, 0x0f, 0xc4, 0x39, 0xd0, 0x36, 0xcc,
+    0x0f, 0xc3, 0xf9, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x39, 0xca, 0x36, 0xd2,
+    0x0f, 0xc3, 0x79, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0xb8, 0xd5, 0x36, 0xc7,
+    0x0f, 0xc4, 0x31, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0xb1, 0xca, 0x36, 0xd2,
+    0x0f, 0xc3, 0x71, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x31, 0xd0, 0x36, 0xcc,
+    0x0f, 0xc3, 0xf0, 0xd5, 0x36, 0xc7, 0x0f, 0xc4, 0x29, 0xd1, 0x55, 0x86,
+    0x0f, 0xc3, 0xa9, 0xca, 0x36, 0xd2, 0x0f, 0xc3, 0x69, 0xd0, 0x5b, 0x42,
+    0x0f, 0xc3, 0x29, 0xd0, 0x36, 0xcc, 0x0f, 0xc3, 0xe8, 0xd5, 0x36, 0xc7,
+    0x0f, 0xc4, 0x21, 0xd1, 0x55, 0x86, 0x0f, 0xc3, 0xa1, 0xca, 0x36, 0xd2,
+    0x0f, 0xc3, 0x61, 0xd0, 0x5b, 0x42, 0x0f, 0xc3, 0x21, 0xd0, 0x36, 0xcc,
+    0x0f, 0xc3, 0xe0, 0xc5, 0xd5, 0x3f, 0x0f, 0x9c, 0x81, 0xcc, 0x89, 0x4c,
+    0x0f, 0x99, 0x60, 0xc6, 0xca, 0xbe, 0x0f, 0xb5, 0xf1, 0xc4, 0x54, 0xc6,
+    0x0f, 0x98, 0x51, 0xc7, 0xc2, 0xdf, 0x0f, 0xa0, 0x19, 0xc4, 0xe2, 0xc0,
+    0x0f, 0xc9, 0xe8, 0xc4, 0x28, 0x74, 0x0f, 0x17, 0xc9, 0xc5, 0x0a, 0xfd,
+    0x0f, 0x17, 0xc1, 0x15, 0xc1, 0xa4, 0x9d, 0x08, 0xc1, 0xa4, 0xa9, 0x16,
+    0xc1, 0xa4, 0xb5, 0xc3, 0x05, 0x16, 0x0f, 0x17, 0x89, 0xc4, 0x18, 0xa7,
+    0x0f, 0x17, 0x80, 0xc3, 0xdd, 0xb6, 0x0f, 0x17, 0x73, 0x01, 0xa4, 0xc1,
+    0xc3, 0x49, 0xfc, 0x0f, 0x17, 0x62, 0x01, 0xa4, 0xc7, 0x1b, 0xc1, 0xa4,
+    0xcd, 0x97, 0x0f, 0x16, 0xf3, 0x01, 0xa4, 0xd7, 0x10, 0xc1, 0xa4, 0xdd,
+    0x83, 0x0f, 0x16, 0x0b, 0x01, 0xa4, 0xed, 0x87, 0x0f, 0x16, 0xdb, 0x01,
+    0xa4, 0xfe, 0x91, 0x0f, 0x16, 0xab, 0x01, 0xa5, 0x02, 0x8b, 0x0f, 0x16,
+    0xe3, 0x01, 0xa5, 0x09, 0x16, 0xc1, 0xa5, 0x0f, 0x0e, 0xc1, 0xa5, 0x25,
+    0xc2, 0x00, 0xce, 0x0f, 0x16, 0xd1, 0x0d, 0xc1, 0xa5, 0x2f, 0xc2, 0x00,
+    0xb6, 0x0f, 0x16, 0xc1, 0xc2, 0x00, 0x3b, 0x0f, 0x16, 0xb9, 0xc2, 0x02,
+    0x63, 0x0f, 0x16, 0x99, 0xc2, 0x00, 0x71, 0x0f, 0x16, 0x91, 0xc2, 0x01,
+    0x16, 0x0f, 0x16, 0x89, 0xc2, 0x21, 0x7d, 0x0f, 0x16, 0x81, 0x15, 0xc1,
+    0xa5, 0x39, 0xc2, 0x04, 0x70, 0x0f, 0x16, 0x69, 0x12, 0xc1, 0xa5, 0x43,
+    0xc2, 0x00, 0xeb, 0x0f, 0x16, 0x29, 0xc2, 0x0e, 0x60, 0x0f, 0x16, 0x21,
+    0xc2, 0x03, 0xc6, 0x0f, 0x16, 0x19, 0xc2, 0x00, 0xa0, 0x0f, 0x16, 0x10,
+    0xc6, 0x2a, 0x48, 0x08, 0xc7, 0x91, 0xc6, 0xcf, 0x44, 0x08, 0xc7, 0x89,
+    0x15, 0xc1, 0xa5, 0x4d, 0x08, 0xc1, 0xa5, 0x59, 0x16, 0x41, 0xa5, 0x65,
+    0xc4, 0x28, 0x74, 0x08, 0xc7, 0x49, 0xc5, 0x0a, 0xfd, 0x08, 0xc7, 0x41,
+    0x15, 0xc1, 0xa5, 0x77, 0x08, 0xc1, 0xa5, 0x83, 0x16, 0xc1, 0xa5, 0x8f,
+    0xc3, 0x05, 0x16, 0x08, 0xc7, 0x09, 0xc4, 0x18, 0xa7, 0x08, 0xc7, 0x00,
+    0xc4, 0xde, 0x6c, 0x08, 0xc6, 0xf9, 0x15, 0xc1, 0xa5, 0x9b, 0x0a, 0xc1,
+    0xa5, 0xa7, 0xc2, 0x05, 0x1e, 0x08, 0xc6, 0xc1, 0xc2, 0x06, 0x4c, 0x08,
+    0xc6, 0xb9, 0x83, 0x08, 0xc6, 0x0b, 0x01, 0xa5, 0xb7, 0xc2, 0x0e, 0x60,
+    0x08, 0xc6, 0xa1, 0x10, 0xc1, 0xa5, 0xc5, 0xc3, 0x01, 0x94, 0x08, 0xc6,
+    0x91, 0x91, 0x08, 0xc6, 0x4b, 0x01, 0xa5, 0xd1, 0x87, 0x08, 0xc6, 0x43,
+    0x01, 0xa5, 0xd7, 0x17, 0xc1, 0xa5, 0xdb, 0x1b, 0xc1, 0xa5, 0xe3, 0xc2,
+    0x08, 0x6a, 0x08, 0xc6, 0x61, 0xc2, 0x00, 0xeb, 0x08, 0xc6, 0x59, 0xc2,
+    0x25, 0x71, 0x08, 0xc6, 0x31, 0xc2, 0x00, 0x92, 0x08, 0xc6, 0x10, 0xc4,
+    0xde, 0x6c, 0x08, 0xc5, 0xf9, 0x15, 0xc1, 0xa5, 0xf2, 0x0a, 0xc1, 0xa5,
+    0xfe, 0xc2, 0x05, 0x1e, 0x08, 0xc5, 0xc1, 0xc2, 0x06, 0x4c, 0x08, 0xc5,
+    0xb9, 0x83, 0x08, 0xc5, 0x0b, 0x01, 0xa6, 0x0e, 0xc2, 0x0e, 0x60, 0x08,
+    0xc5, 0xa1, 0x10, 0xc1, 0xa6, 0x1c, 0xc3, 0x01, 0x94, 0x08, 0xc5, 0x91,
+    0x91, 0x08, 0xc5, 0x4b, 0x01, 0xa6, 0x28, 0x87, 0x08, 0xc5, 0x43, 0x01,
+    0xa6, 0x2e, 0x17, 0xc1, 0xa6, 0x32, 0x1b, 0xc1, 0xa6, 0x3a, 0xc2, 0x08,
+    0x6a, 0x08, 0xc5, 0x61, 0xc2, 0x00, 0xeb, 0x08, 0xc5, 0x59, 0xc2, 0x25,
+    0x71, 0x08, 0xc5, 0x31, 0xc2, 0x00, 0x92, 0x08, 0xc5, 0x10, 0xc3, 0x00,
+    0xe0, 0x01, 0x18, 0x39, 0xc7, 0x7f, 0x4d, 0x07, 0xf2, 0x78, 0xc5, 0x00,
+    0x64, 0x01, 0x49, 0x99, 0xc4, 0x00, 0x2f, 0x01, 0x59, 0xf8, 0xcf, 0x1b,
+    0x75, 0x01, 0x02, 0xa9, 0xcc, 0x89, 0xa0, 0x0f, 0x9d, 0xa0, 0x05, 0xc1,
+    0xa6, 0x49, 0xd7, 0x17, 0x31, 0x01, 0x39, 0x19, 0xd8, 0x25, 0x8d, 0x01,
+    0x39, 0x11, 0x44, 0x05, 0x1a, 0xc1, 0xa6, 0x55, 0xcb, 0x92, 0x50, 0x0f,
+    0x9a, 0x01, 0xd2, 0x23, 0xcb, 0x0f, 0xbe, 0x30, 0xcb, 0x94, 0x13, 0x0f,
+    0x9b, 0xe8, 0x01, 0xc1, 0xa6, 0x61, 0xc9, 0xb4, 0xaa, 0x0f, 0xb1, 0xb0,
+    0xd7, 0x29, 0xb5, 0x0f, 0xb0, 0x59, 0xd0, 0x5d, 0x72, 0x0f, 0xb1, 0x88,
+    0xdf, 0x0d, 0x9d, 0x01, 0x36, 0xf1, 0x49, 0x0d, 0x22, 0x41, 0xa6, 0xaa,
+    0xe0, 0x02, 0xe9, 0x01, 0x3d, 0x60, 0xc9, 0xaf, 0x0a, 0x0f, 0x98, 0xe9,
+    0xc6, 0x07, 0xf3, 0x0f, 0x98, 0xa8, 0xca, 0x58, 0xd2, 0x07, 0xf8, 0x19,
+    0xc7, 0x64, 0x15, 0x07, 0xff, 0x10, 0xc7, 0x09, 0x82, 0x07, 0xf8, 0x51,
+    0xc8, 0x33, 0xd7, 0x07, 0xf8, 0x31, 0xc9, 0x2e, 0xd1, 0x07, 0xf8, 0x38,
+    0x45, 0x04, 0x9a, 0xc1, 0xa6, 0xb6, 0xca, 0x94, 0xe5, 0x07, 0xf8, 0x20,
+    0x11, 0xc1, 0xa6, 0xda, 0xd0, 0x0a, 0x19, 0x07, 0xf9, 0xf1, 0xc8, 0x90,
+    0x01, 0x07, 0xff, 0x00, 0xc8, 0x50, 0x47, 0x07, 0xf8, 0xd9, 0xc6, 0x2a,
+    0x12, 0x07, 0xf8, 0x78, 0x07, 0xc1, 0xa6, 0xe6, 0x45, 0x09, 0x34, 0xc1,
+    0xa6, 0xf2, 0xc7, 0x7f, 0x4d, 0x07, 0xf9, 0xf8, 0xca, 0x0f, 0xb0, 0x07,
+    0xf8, 0xe9, 0xcf, 0x0e, 0xee, 0x07, 0xf8, 0x08, 0xcf, 0x51, 0x7b, 0x07,
+    0xf8, 0xf1, 0xca, 0x20, 0x55, 0x07, 0xfa, 0x00, 0xcb, 0x30, 0xec, 0x07,
+    0xf8, 0xf9, 0xcc, 0x01, 0x5d, 0x07, 0xf8, 0x10, 0xce, 0x69, 0x63, 0x07,
+    0xf9, 0xe1, 0x45, 0x01, 0x79, 0x41, 0xa6, 0xfe, 0xc9, 0x9c, 0x5b, 0x07,
+    0xff, 0x09, 0xcb, 0x8f, 0xfe, 0x07, 0xf8, 0x29, 0xc8, 0x64, 0xb3, 0x07,
+    0xf8, 0x58, 0x01, 0x41, 0xa7, 0x16, 0xc9, 0xb4, 0xce, 0x0f, 0x9c, 0x39,
+    0x95, 0x0f, 0x9c, 0x30, 0xc5, 0x93, 0xcc, 0x0f, 0xb4, 0x91, 0xcb, 0x93,
+    0x2c, 0x0f, 0xcf, 0x78, 0x49, 0xa9, 0xe8, 0xc1, 0xa7, 0x22, 0xc2, 0x00,
+    0xbe, 0x0b, 0x7a, 0x50, 0x44, 0x1c, 0xa4, 0xc1, 0xa7, 0x2e, 0x15, 0xc1,
+    0xa7, 0x4a, 0x87, 0x0b, 0x7a, 0x41, 0x42, 0x2d, 0x72, 0xc1, 0xa7, 0x5e,
+    0xc2, 0x00, 0x51, 0x0b, 0x78, 0x71, 0x83, 0x0b, 0x78, 0x50, 0x83, 0x0b,
+    0x78, 0x83, 0x01, 0xa7, 0x68, 0x1b, 0xc1, 0xa7, 0x6e, 0x09, 0xc1, 0xa7,
+    0x78, 0x10, 0xc1, 0xa7, 0x82, 0xc2, 0x00, 0xce, 0x0b, 0x78, 0x88, 0x1c,
+    0xc1, 0xa7, 0x8c, 0x42, 0x2d, 0x72, 0xc1, 0xa7, 0xa2, 0xc2, 0x0e, 0x60,
+    0x0b, 0x78, 0x79, 0x83, 0x0b, 0x78, 0x58, 0xc2, 0x13, 0x1a, 0x0b, 0x7a,
+    0x31, 0x83, 0x0b, 0x79, 0xd1, 0xc2, 0x0d, 0x01, 0x0b, 0x79, 0xa1, 0xc2,
+    0x00, 0xce, 0x0b, 0x79, 0x98, 0xc2, 0x00, 0x4c, 0x0b, 0x7a, 0x29, 0x83,
+    0x0b, 0x78, 0x08, 0xc2, 0x00, 0xce, 0x0b, 0x7a, 0x21, 0x83, 0x0b, 0x79,
+    0x30, 0x8a, 0x0b, 0x7a, 0x19, 0x47, 0x76, 0xda, 0x41, 0xa7, 0xac, 0x1c,
+    0xc1, 0xa7, 0xbc, 0x15, 0xc1, 0xa7, 0xca, 0x83, 0x0b, 0x79, 0xd9, 0xc2,
+    0x00, 0xce, 0x0b, 0x79, 0xa8, 0x16, 0xc1, 0xa7, 0xd4, 0xc4, 0xe0, 0xe4,
+    0x0b, 0x79, 0x89, 0xc2, 0x02, 0x4d, 0x0b, 0x79, 0x01, 0xc3, 0x3f, 0x6f,
+    0x0b, 0x78, 0x91, 0xc2, 0x04, 0xf2, 0x0b, 0x78, 0x10, 0x0a, 0xc1, 0xa7,
+    0xe2, 0x83, 0x0b, 0x78, 0xf8, 0xc2, 0x00, 0xeb, 0x0b, 0x79, 0x11, 0x83,
+    0x0b, 0x79, 0x08, 0x0a, 0xc1, 0xa7, 0xec, 0xc2, 0x1a, 0x18, 0x0b, 0x78,
+    0xb9, 0x83, 0x0b, 0x78, 0xb0, 0xc2, 0x04, 0x70, 0x0b, 0x78, 0x49, 0x83,
+    0x0b, 0x78, 0x40, 0xc2, 0x00, 0xce, 0x0b, 0x78, 0x29, 0x83, 0x0b, 0x78,
+    0x20, 0xc2, 0x00, 0x89, 0x0b, 0x78, 0x19, 0x83, 0x0b, 0x78, 0x00, 0x8b,
+    0x0b, 0x7c, 0x39, 0xc2, 0x13, 0x72, 0x0b, 0x7b, 0xf9, 0xc2, 0x00, 0xb2,
+    0x0b, 0x7b, 0x81, 0xc2, 0x0a, 0xfd, 0x0b, 0x7b, 0x79, 0x97, 0x0b, 0x7b,
+    0x71, 0x83, 0x0b, 0x7b, 0x5a, 0x01, 0xa7, 0xf6, 0x91, 0x0b, 0x7b, 0x2b,
+    0x01, 0xa7, 0xfd, 0x89, 0x0b, 0x7c, 0x21, 0xc2, 0x00, 0xb2, 0x0b, 0x7b,
+    0x49, 0x97, 0x0b, 0x7b, 0x41, 0x8b, 0x0b, 0x7b, 0x39, 0x87, 0x0b, 0x7b,
+    0x31, 0x83, 0x0b, 0x7b, 0x12, 0x01, 0xa8, 0x03, 0x83, 0x0b, 0x7c, 0x29,
+    0x8b, 0x0b, 0x7b, 0xd1, 0x94, 0x0b, 0x7b, 0xbb, 0x01, 0xa8, 0x0a, 0x90,
+    0x0b, 0x7a, 0xf2, 0x01, 0xa8, 0x0e, 0x07, 0xc1, 0xa8, 0x12, 0x89, 0x0b,
+    0x7c, 0x09, 0x97, 0x0b, 0x7b, 0xe1, 0x91, 0x0b, 0x7a, 0xd0, 0xc2, 0x01,
+    0xd6, 0x0b, 0x7c, 0x01, 0x8b, 0x0b, 0x7b, 0x90, 0x89, 0x0b, 0x7b, 0xf0,
+    0x97, 0x0b, 0x7b, 0xd9, 0x8b, 0x0b, 0x7b, 0xc9, 0x87, 0x0b, 0x7b, 0x9b,
+    0x01, 0xa8, 0x1a, 0x90, 0x0b, 0x7a, 0xbb, 0x01, 0xa8, 0x1e, 0xc2, 0x4c,
+    0x26, 0x0b, 0x7a, 0xb1, 0x83, 0x0b, 0x7a, 0xa8, 0x94, 0x0b, 0x7b, 0xb0,
+    0x91, 0x0b, 0x7a, 0xd8, 0xca, 0x9d, 0xcc, 0x0b, 0x7a, 0x99, 0xc7, 0xc0,
+    0x54, 0x0b, 0x7a, 0x90, 0xc5, 0x20, 0x41, 0x01, 0x12, 0x11, 0xc4, 0x00,
+    0x8d, 0x01, 0x10, 0x92, 0x01, 0xa8, 0x22, 0x4e, 0x70, 0x6a, 0xc1, 0xa8,
+    0x26, 0xcb, 0x57, 0x87, 0x0f, 0xbd, 0x19, 0x46, 0x00, 0xbb, 0xc1, 0xa8,
+    0x32, 0x04, 0xc1, 0xa8, 0x3e, 0x45, 0x00, 0x64, 0xc1, 0xa8, 0x4a, 0x44,
+    0x00, 0x2f, 0xc1, 0xa8, 0x54, 0x08, 0xc1, 0xa8, 0x5e, 0xcc, 0x06, 0xbd,
+    0x01, 0x3a, 0xc9, 0x15, 0xc1, 0xa8, 0x70, 0xd2, 0x4a, 0x1d, 0x01, 0x02,
+    0xf9, 0x46, 0x0d, 0xe6, 0x41, 0xa8, 0x88, 0xc5, 0x04, 0x0c, 0x01, 0x72,
+    0x61, 0xd0, 0x0e, 0xed, 0x01, 0x72, 0x99, 0xcd, 0x30, 0xea, 0x01, 0x72,
+    0xa0, 0xca, 0x9d, 0xb8, 0x0b, 0x74, 0xc9, 0x4c, 0x28, 0xa8, 0x41, 0xa8,
+    0x94, 0xc4, 0x04, 0x0d, 0x0b, 0x74, 0xb9, 0x4e, 0x09, 0x3a, 0x41, 0xa9,
+    0x0e, 0x16, 0xc1, 0xa9, 0x88, 0xc3, 0x05, 0x16, 0x0b, 0x74, 0x0b, 0x01,
+    0xa9, 0x9a, 0xc4, 0x28, 0x74, 0x0b, 0x74, 0x49, 0xc5, 0x0a, 0xfd, 0x0b,
+    0x74, 0x41, 0x15, 0xc1, 0xa9, 0xa0, 0x08, 0xc1, 0xa9, 0xac, 0xc4, 0x18,
+    0xa7, 0x0b, 0x74, 0x00, 0xc8, 0x48, 0x01, 0x0b, 0x74, 0x99, 0x07, 0xc1,
+    0xa9, 0xb8, 0x15, 0xc1, 0xa9, 0xc4, 0x08, 0xc1, 0xa9, 0xd0, 0x16, 0x41,
+    0xa9, 0xdc, 0xc8, 0xbd, 0x18, 0x01, 0x1e, 0xc1, 0xc6, 0xce, 0xba, 0x01,
+    0x1e, 0xb9, 0x4a, 0xa2, 0x90, 0x41, 0xa9, 0xee, 0xca, 0x9b, 0xf6, 0x01,
+    0x1e, 0xa1, 0xc5, 0x2c, 0x9e, 0x01, 0x1e, 0x90, 0x1f, 0xc1, 0xa9, 0xfa,
+    0x20, 0x41, 0xaa, 0x22, 0xc3, 0x05, 0x16, 0x0f, 0x46, 0x39, 0x16, 0xc1,
+    0xaa, 0x4a, 0x08, 0xc1, 0xaa, 0x56, 0x15, 0xc1, 0xaa, 0x62, 0xc5, 0x0a,
+    0xfd, 0x0f, 0x46, 0x71, 0xc4, 0x28, 0x74, 0x0f, 0x46, 0x78, 0x16, 0xc1,
+    0xaa, 0x6e, 0x47, 0x0c, 0xe7, 0xc1, 0xaa, 0x78, 0xc8, 0x32, 0x37, 0x0f,
+    0x46, 0xb0, 0x49, 0x54, 0x43, 0xc1, 0xaa, 0x82, 0x47, 0x37, 0xb8, 0xc1,
+    0xaa, 0x9e, 0x0e, 0x41, 0xaa, 0xc5, 0xcb, 0x93, 0x42, 0x08, 0x4c, 0xf3,
+    0x01, 0xaa, 0xd1, 0x47, 0x01, 0x92, 0x41, 0xaa, 0xd7, 0x01, 0x41, 0xab,
+    0x39, 0xc7, 0x40, 0xae, 0x05, 0x57, 0xa9, 0x03, 0xc1, 0xab, 0x45, 0x17,
+    0xc1, 0xab, 0x53, 0x0b, 0xc1, 0xab, 0x5d, 0xc4, 0xe1, 0x90, 0x05, 0x5f,
+    0x19, 0xc5, 0xd5, 0x08, 0x05, 0x5f, 0x31, 0xc7, 0xc0, 0x38, 0x05, 0x5f,
+    0x49, 0xc4, 0xe2, 0x4c, 0x05, 0x5f, 0x51, 0xc6, 0xca, 0x46, 0x05, 0x5f,
+    0x38, 0x15, 0xc1, 0xab, 0x67, 0x10, 0xc1, 0xab, 0x79, 0x06, 0xc1, 0xab,
+    0x95, 0x16, 0xc1, 0xab, 0xa5, 0x42, 0x11, 0x99, 0xc1, 0xab, 0xb8, 0x91,
+    0x05, 0x57, 0x09, 0x87, 0x05, 0x57, 0x01, 0x0d, 0xc1, 0xab, 0xc2, 0xc3,
+    0x00, 0x9b, 0x05, 0x5e, 0x13, 0x01, 0xab, 0xd1, 0xc3, 0x2b, 0x3c, 0x05,
+    0x5e, 0x1b, 0x01, 0xab, 0xd7, 0x12, 0xc1, 0xab, 0xdd, 0xc4, 0xaf, 0x1f,
+    0x05, 0x5e, 0x61, 0xc3, 0xcd, 0xfd, 0x05, 0x5e, 0x69, 0xc2, 0x05, 0x1f,
+    0x05, 0x5e, 0x71, 0x8b, 0x05, 0x5e, 0x7b, 0x01, 0xab, 0xea, 0xc5, 0xd5,
+    0x6c, 0x05, 0x5e, 0x89, 0x09, 0xc1, 0xab, 0xf0, 0xc3, 0x17, 0x53, 0x05,
+    0x5e, 0xa1, 0x04, 0xc1, 0xab, 0xfc, 0xc3, 0x48, 0x56, 0x05, 0x5e, 0x59,
+    0x0c, 0x41, 0xac, 0x06, 0xc2, 0x01, 0xa2, 0x05, 0x5f, 0x91, 0xc4, 0x03,
+    0xe0, 0x05, 0x5f, 0x98, 0xc3, 0x04, 0xa0, 0x05, 0x5f, 0xa1, 0xc3, 0x0c,
+    0xf7, 0x05, 0x5f, 0xa8, 0xc2, 0x24, 0x36, 0x05, 0x5f, 0xb1, 0xc4, 0x17,
+    0xf7, 0x05, 0x5f, 0xb8, 0xc7, 0xc5, 0xc5, 0x0f, 0xb7, 0xa9, 0xc4, 0xcd,
+    0xde, 0x0f, 0xb7, 0x28, 0x01, 0x41, 0xac, 0x12, 0xc4, 0x07, 0xe9, 0x0f,
+    0xa1, 0x69, 0xc4, 0xd2, 0x7a, 0x0f, 0xd5, 0x20, 0xc5, 0x67, 0x41, 0x0e,
+    0x98, 0x01, 0x1b, 0x41, 0xac, 0x24, 0x46, 0x46, 0x0e, 0xc1, 0xac, 0x30,
+    0xd9, 0x1f, 0x65, 0x08, 0xb3, 0x19, 0xcf, 0x6a, 0x9d, 0x00, 0xc0, 0x30,
+    0xca, 0x03, 0x6a, 0x08, 0xb3, 0x4b, 0x01, 0xac, 0x36, 0xdc, 0x13, 0x1b,
+    0x00, 0xc0, 0x38, 0xd5, 0x03, 0x74, 0x08, 0xb3, 0x40, 0x46, 0x00, 0x91,
+    0x41, 0xac, 0x3c, 0x46, 0x00, 0x91, 0x41, 0xac, 0x48, 0xd9, 0x1e, 0x39,
+    0x08, 0xb3, 0x11, 0x45, 0x04, 0x9a, 0x41, 0xac, 0x54, 0xc2, 0x00, 0xb6,
+    0x00, 0xc1, 0x73, 0x01, 0xac, 0x78, 0x83, 0x00, 0xc1, 0x03, 0x01, 0xac,
+    0x7e, 0x16, 0xc1, 0xac, 0x8a, 0x42, 0x11, 0x99, 0xc1, 0xac, 0x9a, 0x15,
+    0xc1, 0xac, 0xa5, 0x1c, 0xc1, 0xac, 0xb5, 0x0e, 0xc1, 0xac, 0xc5, 0xc3,
+    0x3a, 0xec, 0x00, 0xc1, 0xf1, 0x0d, 0xc1, 0xac, 0xcf, 0xc2, 0x04, 0x70,
+    0x00, 0xc1, 0xc9, 0xc2, 0x00, 0x71, 0x00, 0xc1, 0xc1, 0xc2, 0x00, 0x3b,
+    0x00, 0xc1, 0xb9, 0xc2, 0x1a, 0x18, 0x00, 0xc1, 0xb1, 0xc2, 0x21, 0x7d,
+    0x00, 0xc1, 0xa9, 0xc2, 0x0e, 0x60, 0x00, 0xc1, 0x99, 0xc2, 0x00, 0xeb,
+    0x00, 0xc1, 0x69, 0xc2, 0x0f, 0xba, 0x00, 0xc1, 0x61, 0xc2, 0x04, 0xf2,
+    0x00, 0xc1, 0x59, 0xc2, 0x00, 0xa0, 0x00, 0xc1, 0x51, 0xc2, 0x03, 0x83,
+    0x00, 0xc1, 0x41, 0x87, 0x00, 0xc1, 0x0b, 0x01, 0xac, 0xd9, 0x97, 0x00,
+    0xc1, 0x23, 0x01, 0xac, 0xdd, 0x91, 0x00, 0xc1, 0x1b, 0x01, 0xac, 0xe1,
+    0x8b, 0x00, 0xc1, 0x10, 0x57, 0x2a, 0x6d, 0xc1, 0xac, 0xe5, 0xc8, 0x3c,
+    0xd0, 0x00, 0xc0, 0x29, 0xc8, 0x11, 0xa2, 0x00, 0xc0, 0x18, 0xc9, 0x11,
+    0xa1, 0x00, 0xc0, 0x49, 0xc5, 0x04, 0x0c, 0x00, 0xc0, 0x40, 0xc3, 0x0d,
+    0xc9, 0x00, 0xc0, 0x21, 0xc3, 0x04, 0x0e, 0x00, 0xc0, 0x10, 0xca, 0xa1,
+    0xdc, 0x0f, 0xa5, 0xc1, 0xc3, 0x32, 0xf4, 0x0f, 0xa5, 0x80, 0x06, 0xc1,
+    0xac, 0xf5, 0x45, 0x00, 0x8d, 0xc1, 0xad, 0x07, 0xd1, 0x4f, 0x8c, 0x08,
+    0xb2, 0x19, 0x4b, 0x6e, 0xbb, 0xc1, 0xad, 0x17, 0x47, 0x01, 0x92, 0x41,
+    0xad, 0x37, 0x47, 0x01, 0x92, 0xc1, 0xad, 0x9c, 0xd9, 0x20, 0x5f, 0x05,
+    0x5a, 0xd8, 0x48, 0x09, 0x39, 0xc1, 0xad, 0xe2, 0x12, 0xc1, 0xae, 0x83,
+    0xca, 0xa1, 0x5a, 0x0e, 0xb8, 0xd1, 0xcc, 0x88, 0xd4, 0x0e, 0xb8, 0xc1,
+    0xcc, 0x8a, 0x90, 0x0e, 0xb8, 0xb9, 0xce, 0x11, 0xb9, 0x0e, 0xb8, 0xb1,
+    0x46, 0x00, 0xb5, 0xc1, 0xae, 0x95, 0xc5, 0xda, 0x3a, 0x0e, 0xb7, 0xd8,
+    0x15, 0xc1, 0xaf, 0x35, 0x46, 0x04, 0x99, 0xc1, 0xaf, 0x41, 0x48, 0x09,
+    0x39, 0xc1, 0xaf, 0x65, 0x47, 0xc8, 0x49, 0xc1, 0xb0, 0x06, 0x12, 0xc1,
+    0xb0, 0x34, 0xca, 0xa1, 0x5a, 0x0e, 0xb7, 0x01, 0xcc, 0x88, 0xd4, 0x0e,
+    0xb6, 0xf1, 0xcc, 0x8a, 0x90, 0x0e, 0xb6, 0xe9, 0xce, 0x11, 0xb9, 0x0e,
+    0xb6, 0xe1, 0xc5, 0xda, 0x3a, 0x0e, 0xb6, 0x09, 0x48, 0xbf, 0x00, 0x41,
+    0xb0, 0x46, 0x46, 0x04, 0x99, 0xc1, 0xb0, 0x52, 0x46, 0x00, 0xb5, 0xc1,
+    0xb0, 0x76, 0x48, 0x09, 0x39, 0x41, 0xb0, 0xde, 0x4a, 0x44, 0x1f, 0xc1,
+    0xb1, 0x46, 0x46, 0x02, 0x11, 0x41, 0xb1, 0x64, 0x46, 0x04, 0x99, 0xc1,
+    0xb1, 0x70, 0x46, 0x00, 0xb5, 0xc1, 0xb1, 0x94, 0x48, 0x09, 0x39, 0x41,
+    0xb1, 0xfc, 0x47, 0xbf, 0x01, 0xc1, 0xb2, 0x48, 0xcf, 0x36, 0x88, 0x01,
+    0x3e, 0x68, 0x44, 0x01, 0x7a, 0xc1, 0xb2, 0x54, 0xcd, 0x28, 0xe6, 0x01,
+    0x3e, 0x58, 0xd5, 0x32, 0x59, 0x01, 0x3f, 0x71, 0x46, 0x00, 0xbb, 0xc1,
+    0xb2, 0x6c, 0xd4, 0x39, 0x6e, 0x01, 0x3f, 0x51, 0xcd, 0x08, 0x53, 0x01,
+    0x3f, 0x40, 0xc3, 0x02, 0x6e, 0x0e, 0x97, 0x90, 0xc4, 0x12, 0xbb, 0x0e,
+    0x97, 0x88, 0xc4, 0x12, 0xbb, 0x0e, 0x97, 0x80, 0xc5, 0x12, 0xba, 0x0e,
+    0x97, 0x79, 0xc2, 0x00, 0x98, 0x0e, 0x97, 0x28, 0xc4, 0x12, 0xbb, 0x0e,
+    0x97, 0x70, 0xc6, 0x4f, 0xe2, 0x0e, 0x97, 0x69, 0xc3, 0x03, 0xe1, 0x0e,
+    0x97, 0x18, 0xc4, 0x23, 0xc6, 0x0e, 0x97, 0x61, 0x91, 0x0e, 0x97, 0x10,
+    0xc2, 0x1a, 0x18, 0x08, 0xf7, 0x59, 0x83, 0x08, 0xf7, 0x41, 0xc2, 0x00,
+    0xeb, 0x08, 0xf7, 0x10, 0xc4, 0x28, 0x74, 0x08, 0xea, 0xc9, 0xc5, 0x0a,
+    0xfd, 0x08, 0xea, 0xc1, 0x15, 0xc1, 0xb2, 0x78, 0x08, 0xc1, 0xb2, 0x84,
+    0x16, 0xc1, 0xb2, 0x90, 0xc3, 0x05, 0x16, 0x08, 0xea, 0x89, 0xc4, 0x18,
+    0xa7, 0x08, 0xea, 0x80, 0xc6, 0xd2, 0xaa, 0x08, 0xea, 0x39, 0xc4, 0xb8,
+    0xda, 0x08, 0xea, 0x30, 0xc5, 0x1f, 0xf6, 0x08, 0xea, 0x29, 0x4a, 0x6e,
+    0xbc, 0x41, 0xb2, 0x9c, 0xc7, 0xc4, 0xc9, 0x08, 0xea, 0x21, 0xc6, 0x1f,
+    0xe9, 0x08, 0xea, 0x19, 0xc5, 0x34, 0xd9, 0x08, 0xea, 0x11, 0xc7, 0x40,
+    0xae, 0x08, 0xea, 0x09, 0xc8, 0x14, 0x02, 0x08, 0xea, 0x00, 0x16, 0xc1,
+    0xb2, 0xbc, 0x0c, 0xc1, 0xb2, 0xd0, 0x0d, 0xc1, 0xb2, 0xe0, 0x0e, 0xc1,
+    0xb2, 0xf0, 0xc2, 0x00, 0xce, 0x08, 0xe9, 0x61, 0x15, 0xc1, 0xb2, 0xfa,
+    0xc2, 0x02, 0x63, 0x08, 0xe9, 0x41, 0xc2, 0x00, 0x3b, 0x08, 0xe9, 0x31,
+    0xc2, 0x1a, 0x18, 0x08, 0xe9, 0x29, 0xc2, 0x00, 0xb6, 0x08, 0xe9, 0x21,
+    0x04, 0xc1, 0xb3, 0x0a, 0x12, 0xc1, 0xb3, 0x14, 0x10, 0xc1, 0xb3, 0x1e,
+    0x06, 0xc1, 0xb3, 0x34, 0x05, 0xc1, 0xb3, 0x42, 0x09, 0xc1, 0xb3, 0x4c,
+    0x83, 0x08, 0xe8, 0x03, 0x01, 0xb3, 0x56, 0x91, 0x08, 0xe8, 0x49, 0x87,
+    0x08, 0xe8, 0x31, 0x97, 0x08, 0xe8, 0x23, 0x01, 0xb3, 0x62, 0x8b, 0x08,
+    0xe8, 0x12, 0x01, 0xb3, 0x66, 0x44, 0x00, 0x8e, 0xc1, 0xb3, 0x6a, 0x50,
+    0x5e, 0x22, 0x41, 0xb3, 0x76, 0x91, 0x08, 0xe5, 0xa1, 0x87, 0x08, 0xe5,
+    0x99, 0x97, 0x08, 0xe5, 0x91, 0x8b, 0x08, 0xe5, 0x89, 0xc2, 0x12, 0x99,
+    0x08, 0xe5, 0x80, 0x83, 0x08, 0xe4, 0x79, 0xc2, 0x00, 0xce, 0x08, 0xe4,
+    0x71, 0x15, 0xc1, 0xb3, 0xd0, 0xc2, 0x00, 0x89, 0x08, 0xe4, 0x59, 0xc2,
+    0x00, 0x3b, 0x08, 0xe4, 0x51, 0xc2, 0x1a, 0x18, 0x08, 0xe4, 0x49, 0xc2,
+    0x1e, 0x12, 0x08, 0xe4, 0x41, 0x1c, 0xc1, 0xb3, 0xda, 0xc2, 0x00, 0x71,
+    0x08, 0xe4, 0x29, 0x06, 0xc1, 0xb3, 0xe4, 0x16, 0xc1, 0xb3, 0xee, 0xc2,
+    0x00, 0xb6, 0x08, 0xe4, 0x09, 0xc2, 0x00, 0xa0, 0x08, 0xe4, 0x01, 0x12,
+    0xc1, 0xb3, 0xfc, 0x10, 0xc1, 0xb4, 0x06, 0xc2, 0x21, 0x7d, 0x08, 0xe3,
+    0xc1, 0x05, 0xc1, 0xb4, 0x16, 0xc2, 0x00, 0xeb, 0x08, 0xe3, 0xa1, 0x0d,
+    0x41, 0xb4, 0x20, 0xd8, 0x22, 0x45, 0x01, 0x35, 0x39, 0xc4, 0x00, 0x8d,
+    0x01, 0x35, 0x30, 0x05, 0xc1, 0xb4, 0x2a, 0x03, 0xc1, 0xb4, 0x3c, 0x18,
+    0xc1, 0xb4, 0x48, 0xc4, 0x04, 0xf2, 0x00, 0x6a, 0x78, 0x18, 0xc1, 0xb4,
+    0x52, 0x83, 0x00, 0x68, 0x2b, 0x01, 0xb4, 0x62, 0x8b, 0x00, 0x68, 0x3b,
+    0x01, 0xb4, 0x74, 0x97, 0x00, 0x68, 0x4b, 0x01, 0xb4, 0x78, 0x87, 0x00,
+    0x68, 0x73, 0x01, 0xb4, 0x7c, 0x91, 0x00, 0x68, 0x93, 0x01, 0xb4, 0x80,
+    0x0d, 0xc1, 0xb4, 0x84, 0x09, 0xc1, 0xb4, 0x8e, 0x10, 0xc1, 0xb4, 0x98,
+    0x05, 0xc1, 0xb4, 0xac, 0x0c, 0xc1, 0xb4, 0xb4, 0x16, 0xc1, 0xb4, 0xbe,
+    0x06, 0xc1, 0xb4, 0xcc, 0x12, 0xc1, 0xb4, 0xe0, 0x04, 0xc1, 0xb4, 0xea,
+    0xc2, 0x00, 0xb6, 0x00, 0x69, 0x71, 0xc2, 0x1a, 0x18, 0x00, 0x69, 0x79,
+    0x14, 0xc1, 0xb4, 0xf4, 0x0e, 0xc1, 0xb4, 0xfe, 0x15, 0xc1, 0xb5, 0x06,
+    0xc2, 0x00, 0xce, 0x00, 0x69, 0xc8, 0x03, 0xc1, 0xb5, 0x16, 0x8b, 0x00,
+    0x69, 0xfb, 0x01, 0xb5, 0x22, 0x97, 0x00, 0x6a, 0x0b, 0x01, 0xb5, 0x26,
+    0x48, 0xaa, 0xd2, 0xc1, 0xb5, 0x2a, 0x87, 0x00, 0x6a, 0x33, 0x01, 0xb5,
+    0x38, 0x91, 0x00, 0x6a, 0x52, 0x01, 0xb5, 0x3c, 0x44, 0x05, 0x16, 0xc1,
+    0xb5, 0x40, 0x46, 0x03, 0xdf, 0x41, 0xb5, 0x66, 0x45, 0x04, 0x9a, 0xc1,
+    0xb5, 0x7e, 0xc8, 0xbd, 0xa0, 0x00, 0x6b, 0xc8, 0xc3, 0x01, 0x43, 0x00,
+    0x6b, 0x81, 0x44, 0x05, 0x16, 0x41, 0xb5, 0xa2, 0xcb, 0x90, 0x6c, 0x08,
+    0x57, 0xb1, 0xc8, 0x01, 0xa1, 0x08, 0x57, 0xa9, 0x42, 0x00, 0xd8, 0xc1,
+    0xb5, 0xae, 0xc7, 0x30, 0xa1, 0x08, 0x57, 0x89, 0xc4, 0x0d, 0xf4, 0x08,
+    0x57, 0x80, 0xc3, 0x05, 0x16, 0x08, 0x57, 0x5b, 0x01, 0xb5, 0xbb, 0x16,
+    0xc1, 0xb5, 0xc1, 0xc4, 0x0c, 0xf6, 0x08, 0x57, 0x60, 0xc5, 0x01, 0x24,
+    0x08, 0x57, 0x31, 0xc5, 0x00, 0xd2, 0x08, 0x57, 0x28, 0x16, 0xc1, 0xb5,
+    0xcd, 0x15, 0xc1, 0xb5, 0xdf, 0xc4, 0x5a, 0xd2, 0x08, 0x57, 0x09, 0x13,
+    0xc1, 0xb5, 0xef, 0x1a, 0xc1, 0xb5, 0xfb, 0xc2, 0x15, 0x48, 0x08, 0x56,
+    0xe1, 0xc2, 0x00, 0x78, 0x08, 0x56, 0xd9, 0x03, 0xc1, 0xb6, 0x07, 0xc3,
+    0x20, 0xb0, 0x08, 0x56, 0xb9, 0xc3, 0x03, 0xb0, 0x08, 0x56, 0xb1, 0x06,
+    0xc1, 0xb6, 0x19, 0xc6, 0xd0, 0xf4, 0x08, 0x56, 0x99, 0x0d, 0xc1, 0xb6,
+    0x25, 0xc4, 0x4e, 0x09, 0x08, 0x56, 0x79, 0xc2, 0x00, 0x61, 0x08, 0x56,
+    0x33, 0x01, 0xb6, 0x31, 0x0c, 0xc1, 0xb6, 0x37, 0x1c, 0xc1, 0xb6, 0x43,
+    0xc3, 0x76, 0xe6, 0x08, 0x56, 0x39, 0x09, 0xc1, 0xb6, 0x4f, 0x04, 0x41,
+    0xb6, 0x5b, 0xd8, 0x23, 0xad, 0x0f, 0xab, 0xa1, 0xc6, 0xcd, 0x28, 0x0f,
+    0xc9, 0xa8, 0xc6, 0xd2, 0xec, 0x0f, 0xa3, 0x99, 0xca, 0x9c, 0x50, 0x0f,
+    0xa3, 0x90, 0x03, 0xc1, 0xb6, 0x67, 0xc3, 0xa1, 0x42, 0x00, 0x42, 0xb9,
+    0xc8, 0xb6, 0x80, 0x00, 0x42, 0xb1, 0x0b, 0xc1, 0xb6, 0xae, 0xc7, 0xb6,
+    0x81, 0x00, 0x42, 0x29, 0xc5, 0xde, 0x13, 0x00, 0x42, 0x00, 0xcc, 0x83,
+    0x70, 0x08, 0x8b, 0xb1, 0x46, 0x01, 0x93, 0x41, 0xb6, 0xb6, 0xcb, 0x46,
+    0xd3, 0x08, 0x8b, 0xa9, 0xc9, 0xab, 0x98, 0x08, 0x8b, 0x98, 0xc5, 0x07,
+    0xdd, 0x0f, 0x81, 0x49, 0xc8, 0xbb, 0xa0, 0x0f, 0x80, 0x11, 0xcb, 0x92,
+    0x03, 0x0f, 0x80, 0x30, 0xc8, 0xbc, 0xf8, 0x0f, 0x80, 0x01, 0x48, 0x97,
+    0xed, 0x41, 0xb7, 0x10, 0xc9, 0xb4, 0xa1, 0x0f, 0x80, 0x09, 0x46, 0xcb,
+    0x96, 0xc1, 0xb7, 0x1a, 0x48, 0xbd, 0x40, 0xc1, 0xb7, 0x24, 0xc5, 0xc7,
+    0xf6, 0x0f, 0x81, 0x31, 0xc5, 0xd5, 0x8a, 0x0f, 0x81, 0x38, 0xc9, 0xad,
+    0x99, 0x0f, 0x80, 0x19, 0x47, 0xba, 0x51, 0x41, 0xb7, 0x2e, 0x46, 0xb7,
+    0xf7, 0xc1, 0xb7, 0x38, 0xc5, 0xd4, 0x27, 0x0f, 0x81, 0x18, 0x46, 0xd0,
+    0x16, 0xc1, 0xb7, 0x42, 0x48, 0xbd, 0xb0, 0x41, 0xb7, 0x4c, 0x47, 0xc4,
+    0xa6, 0xc1, 0xb7, 0x56, 0x47, 0xc9, 0xed, 0x41, 0xb7, 0x60, 0xc2, 0x00,
+    0x3d, 0x0f, 0x81, 0x59, 0xc4, 0x95, 0x9b, 0x0f, 0x81, 0x20, 0x15, 0xc1,
+    0xb7, 0x6a, 0xc8, 0x80, 0x74, 0x0f, 0x9d, 0xcb, 0x01, 0xb7, 0x76, 0xc4,
+    0x22, 0xe8, 0x0f, 0x9d, 0xa8, 0xca, 0xa4, 0x52, 0x01, 0x33, 0x79, 0xcc,
+    0x83, 0xac, 0x01, 0x33, 0x71, 0xc9, 0xb2, 0x10, 0x01, 0x33, 0x68, 0x48,
+    0x1d, 0xaa, 0xc1, 0xb7, 0x7c, 0xcf, 0x61, 0x5b, 0x0f, 0x9d, 0xb0, 0x01,
+    0x41, 0xb7, 0x89, 0x14, 0xc1, 0xb7, 0x95, 0xc2, 0x00, 0xce, 0x08, 0x95,
+    0x31, 0xc2, 0x0d, 0x01, 0x08, 0x95, 0x29, 0xc2, 0x02, 0x63, 0x08, 0x95,
+    0x21, 0xc2, 0x00, 0x89, 0x08, 0x95, 0x19, 0xc2, 0x1a, 0x18, 0x08, 0x95,
+    0x09, 0xc2, 0x00, 0xb6, 0x08, 0x95, 0x01, 0x04, 0xc1, 0xb7, 0xa5, 0x12,
+    0xc1, 0xb7, 0xaf, 0x10, 0xc1, 0xb7, 0xb9, 0x06, 0xc1, 0xb7, 0xc9, 0x16,
+    0xc1, 0xb7, 0xd7, 0x0c, 0xc1, 0xb7, 0xe5, 0x05, 0xc1, 0xb7, 0xef, 0x09,
+    0xc1, 0xb7, 0xf9, 0x0d, 0xc1, 0xb8, 0x03, 0x87, 0x08, 0x94, 0x19, 0x83,
+    0x08, 0x94, 0x01, 0x8b, 0x08, 0x94, 0x09, 0x97, 0x08, 0x94, 0x10, 0xc4,
+    0x17, 0xf7, 0x0b, 0x53, 0x39, 0xc2, 0x24, 0x36, 0x0b, 0x53, 0x30, 0xc3,
+    0x0c, 0xf7, 0x0b, 0x53, 0x29, 0xc3, 0x04, 0xa0, 0x0b, 0x53, 0x20, 0xc4,
+    0x03, 0xe0, 0x0b, 0x53, 0x19, 0xc2, 0x01, 0xa2, 0x0b, 0x53, 0x10, 0xa4,
+    0x05, 0x53, 0xe9, 0xa1, 0x05, 0x53, 0xe0, 0x44, 0x00, 0xce, 0xc1, 0xb8,
+    0x0d, 0xc6, 0x00, 0x43, 0x00, 0x82, 0x58, 0xc7, 0x14, 0x03, 0x00, 0x81,
+    0xb1, 0xc3, 0x93, 0xa9, 0x00, 0x81, 0xd0, 0xc5, 0x40, 0xb0, 0x00, 0x81,
+    0xc1, 0xc4, 0x1f, 0xf7, 0x00, 0x81, 0xc8, 0xa0, 0x00, 0x83, 0x49, 0xa1,
+    0x00, 0x83, 0x51, 0xa2, 0x00, 0x83, 0x59, 0xa3, 0x00, 0x83, 0x61, 0xa4,
+    0x00, 0x83, 0x68, 0xa0, 0x00, 0x84, 0xd1, 0xa2, 0x00, 0x84, 0xd8, 0x45,
+    0xc7, 0x8c, 0xc1, 0xb8, 0x1f, 0xcd, 0x79, 0xcb, 0x00, 0x82, 0x70, 0xc3,
+    0x05, 0x16, 0x00, 0x84, 0xf1, 0xcb, 0x0e, 0xed, 0x00, 0x84, 0xf8, 0xc2,
+    0x01, 0xa2, 0x00, 0x84, 0x91, 0xc4, 0x03, 0xe0, 0x00, 0x84, 0x98, 0xc3,
+    0x04, 0xa0, 0x00, 0x84, 0xa1, 0xc3, 0x0c, 0xf7, 0x00, 0x84, 0xa8, 0xc2,
+    0x24, 0x36, 0x00, 0x84, 0xb1, 0xc4, 0x17, 0xf7, 0x00, 0x84, 0xb8, 0xc7,
+    0xc7, 0x8c, 0x05, 0x53, 0xd1, 0x97, 0x00, 0x81, 0x50, 0xc2, 0x00, 0xce,
+    0x00, 0x80, 0x0b, 0x01, 0xb8, 0x31, 0x83, 0x00, 0x80, 0x00, 0x83, 0x00,
+    0x80, 0x83, 0x01, 0xb8, 0x37, 0x16, 0xc1, 0xb8, 0x3d, 0xc2, 0x00, 0xce,
+    0x00, 0x80, 0x88, 0x0a, 0xc1, 0xb8, 0x47, 0x83, 0x00, 0x80, 0xf1, 0xc2,
+    0x0d, 0x01, 0x00, 0x82, 0x89, 0xcd, 0x76, 0x7e, 0x00, 0x83, 0x08, 0x83,
+    0x00, 0x80, 0x11, 0xc2, 0x00, 0xce, 0x00, 0x80, 0x19, 0xc7, 0xbb, 0x99,
+    0x00, 0x81, 0xf8, 0xc2, 0x00, 0xeb, 0x00, 0x80, 0x21, 0xc2, 0x1a, 0x18,
+    0x00, 0x80, 0x49, 0x10, 0xc1, 0xb8, 0x54, 0x83, 0x00, 0x80, 0xa0, 0x83,
+    0x00, 0x80, 0x29, 0xc2, 0x00, 0xce, 0x00, 0x80, 0x30, 0x83, 0x00, 0x80,
+    0x39, 0xc2, 0x00, 0xce, 0x00, 0x80, 0x40, 0x06, 0xc1, 0xb8, 0x5e, 0x83,
+    0x00, 0x80, 0x91, 0xc2, 0x00, 0xce, 0x00, 0x80, 0x98, 0x83, 0x00, 0x80,
+    0xa9, 0xc2, 0x00, 0xce, 0x00, 0x80, 0xb0, 0x83, 0x00, 0x80, 0xb9, 0xc2,
+    0x00, 0xce, 0x00, 0x80, 0xc0, 0x83, 0x00, 0x80, 0xc9, 0x43, 0x00, 0x47,
+    0x41, 0xb8, 0x68, 0x83, 0x00, 0x80, 0xd9, 0xcf, 0x61, 0x6a, 0x00, 0x84,
+    0x70, 0x83, 0x00, 0x80, 0xe1, 0xc2, 0x00, 0x89, 0x00, 0x81, 0x00, 0x83,
+    0x00, 0x80, 0xe9, 0x51, 0x27, 0x1b, 0x41, 0xb8, 0x7e, 0x8b, 0x00, 0x81,
+    0x20, 0x97, 0x00, 0x81, 0x30, 0x51, 0x50, 0x14, 0x41, 0xb8, 0x8a, 0x94,
+    0x00, 0x82, 0x93, 0x01, 0xb8, 0x9c, 0x8e, 0x00, 0x82, 0xa2, 0x01, 0xb8,
+    0xa0, 0xc4, 0x17, 0xf7, 0x05, 0x4f, 0xb9, 0xc2, 0x24, 0x36, 0x05, 0x4f,
+    0xb0, 0xc3, 0x0c, 0xf7, 0x05, 0x4f, 0xa9, 0xc3, 0x04, 0xa0, 0x05, 0x4f,
+    0xa0, 0xc4, 0x03, 0xe0, 0x05, 0x4f, 0x99, 0xc2, 0x01, 0xa2, 0x05, 0x4f,
+    0x90, 0xc5, 0xd6, 0x34, 0x00, 0x84, 0xe2, 0x01, 0xb8, 0xa4, 0x94, 0x00,
+    0x82, 0xb8, 0x8e, 0x00, 0x82, 0xc8, 0xc2, 0x12, 0x99, 0x00, 0x84, 0x19,
+    0x87, 0x00, 0x84, 0x23, 0x01, 0xb8, 0xa8, 0xc7, 0xc1, 0x1f, 0x00, 0x84,
+    0x30, 0xc2, 0x1a, 0x18, 0x00, 0x81, 0xd9, 0xc2, 0x00, 0x3b, 0x00, 0x81,
+    0xe1, 0xc2, 0x00, 0x71, 0x00, 0x81, 0xe9, 0xc2, 0x00, 0xce, 0x00, 0x81,
+    0xf0, 0xc2, 0x03, 0x83, 0x00, 0x82, 0xf1, 0xc2, 0x00, 0xb6, 0x00, 0x82,
+    0xf9, 0xc2, 0x00, 0x89, 0x00, 0x83, 0x00, 0xcd, 0x77, 0x41, 0x01, 0x18,
+    0xc1, 0xc7, 0xc8, 0xb2, 0x0f, 0xb6, 0x80, 0x04, 0xc1, 0xb8, 0xae, 0x47,
+    0x6d, 0x77, 0xc1, 0xb8, 0xba, 0x16, 0xc1, 0xb8, 0xd2, 0x08, 0xc1, 0xb8,
+    0xea, 0x15, 0xc1, 0xb8, 0xf4, 0x49, 0xab, 0x2c, 0xc1, 0xb9, 0x00, 0x48,
+    0xba, 0x50, 0xc1, 0xb9, 0x18, 0x48, 0xb5, 0x70, 0xc1, 0xb9, 0x30, 0x0d,
+    0xc1, 0xb9, 0x48, 0x49, 0xb0, 0x06, 0xc1, 0xb9, 0x54, 0xc9, 0xb4, 0x59,
+    0x0f, 0x85, 0xf9, 0xcb, 0x91, 0xd7, 0x0f, 0x86, 0xf8, 0x16, 0xc1, 0xb9,
+    0x6c, 0x08, 0x41, 0xb9, 0x78, 0x01, 0x41, 0xb9, 0x84, 0xc5, 0x0b, 0x24,
+    0x01, 0x10, 0xe8, 0xce, 0x53, 0xe0, 0x01, 0x1c, 0xc9, 0xc2, 0x00, 0x2c,
+    0x0f, 0xad, 0x42, 0x01, 0xb9, 0x96, 0xc2, 0x00, 0xca, 0x0f, 0xa3, 0xc0,
+    0x1e, 0xc1, 0xb9, 0x9c, 0x01, 0x41, 0xb9, 0xa4, 0xd5, 0x34, 0x27, 0x01,
+    0x17, 0x41, 0xce, 0x6b, 0x9a, 0x01, 0x15, 0x81, 0x46, 0x24, 0x62, 0xc1,
+    0xb9, 0xb0, 0x46, 0x00, 0xd2, 0x41, 0xb9, 0xbc, 0x42, 0x00, 0xaa, 0xc1,
+    0xb9, 0xd4, 0xc9, 0xa9, 0xd6, 0x07, 0xf0, 0xa1, 0x07, 0xc1, 0xb9, 0xe0,
+    0xcd, 0x30, 0xea, 0x07, 0xf0, 0xb1, 0xd3, 0x26, 0x0a, 0x07, 0xf0, 0xc9,
+    0xce, 0x71, 0x4a, 0x07, 0xf1, 0x81, 0xcd, 0x7f, 0x47, 0x07, 0xf1, 0xa1,
+    0x0e, 0xc1, 0xb9, 0xf2, 0x46, 0x01, 0x78, 0xc1, 0xb9, 0xfe, 0x4c, 0x1a,
+    0x4c, 0x41, 0xba, 0x2c, 0x46, 0x0a, 0x13, 0xc1, 0xba, 0x38, 0xc9, 0xb1,
+    0x92, 0x0f, 0xa6, 0x20, 0xc5, 0x28, 0x97, 0x08, 0xd7, 0xc1, 0xc7, 0x41,
+    0x60, 0x08, 0xd7, 0x80, 0x01, 0x41, 0xba, 0x44, 0x08, 0xc1, 0xba, 0x53,
+    0x8b, 0x08, 0xd6, 0xbb, 0x01, 0xba, 0x5d, 0x97, 0x08, 0xd6, 0xcb, 0x01,
+    0xba, 0x61, 0x91, 0x08, 0xd6, 0xc1, 0x87, 0x08, 0xd6, 0xb1, 0x83, 0x08,
+    0xd6, 0xa9, 0x05, 0xc1, 0xba, 0x65, 0xc2, 0x00, 0x3b, 0x08, 0xd6, 0x91,
+    0x12, 0xc1, 0xba, 0x6f, 0x10, 0xc1, 0xba, 0x79, 0x16, 0xc1, 0xba, 0x83,
+    0xc2, 0x00, 0xa0, 0x08, 0xd6, 0x61, 0xc2, 0x0d, 0x01, 0x08, 0xd6, 0x59,
+    0x0d, 0xc1, 0xba, 0x8d, 0xc2, 0x00, 0xeb, 0x08, 0xd6, 0x49, 0xc2, 0x00,
+    0xce, 0x08, 0xd6, 0x41, 0xc2, 0x02, 0x63, 0x08, 0xd6, 0x31, 0xc2, 0x01,
+    0x16, 0x08, 0xd6, 0x29, 0xc2, 0x0e, 0x60, 0x08, 0xd6, 0x21, 0xc2, 0x00,
+    0xb6, 0x08, 0xd6, 0x19, 0xc2, 0x00, 0x89, 0x08, 0xd6, 0x10, 0xc5, 0x28,
+    0x97, 0x08, 0xd7, 0x91, 0xca, 0xa4, 0x66, 0x08, 0xd7, 0x88, 0x01, 0x41,
+    0xba, 0x97, 0xc6, 0x28, 0x96, 0x08, 0xd7, 0x50, 0xc5, 0x28, 0x97, 0x08,
+    0xd7, 0x49, 0xc4, 0x0d, 0xc9, 0x08, 0xd7, 0x2a, 0x01, 0xba, 0xa6, 0xc4,
+    0x1e, 0x06, 0x0f, 0x99, 0xa1, 0xc9, 0xb1, 0xa4, 0x0f, 0xd7, 0x99, 0xc7,
+    0xc7, 0x70, 0x0f, 0xd7, 0xa1, 0xc6, 0x29, 0xdb, 0x01, 0x70, 0xc8, 0x47,
+    0x37, 0xb8, 0xc1, 0xba, 0xac, 0xd6, 0x30, 0x92, 0x08, 0x43, 0xc1, 0x42,
+    0x00, 0x2f, 0x41, 0xba, 0xba, 0xd8, 0x24, 0x3d, 0x01, 0x33, 0xe9, 0x01,
+    0x41, 0xba, 0xc6, 0x4d, 0x28, 0xa7, 0xc1, 0xba, 0xd2, 0x4f, 0x09, 0x39,
+    0x41, 0xbb, 0x3a, 0x16, 0xc1, 0xbb, 0xa2, 0xc8, 0x48, 0x01, 0x01, 0x24,
+    0x31, 0x07, 0xc1, 0xbb, 0xb4, 0x15, 0xc1, 0xbb, 0xc0, 0x08, 0x41, 0xbb,
+    0xcc, 0xc4, 0x28, 0x74, 0x01, 0x23, 0xe1, 0xc5, 0x0a, 0xfd, 0x01, 0x23,
+    0xd9, 0x15, 0xc1, 0xbb, 0xd8, 0x08, 0xc1, 0xbb, 0xe4, 0x16, 0xc1, 0xbb,
+    0xf0, 0xc3, 0x05, 0x16, 0x01, 0x23, 0xa0, 0x0d, 0xc1, 0xbb, 0xfc, 0xc5,
+    0xda, 0xcb, 0x01, 0x90, 0x0b, 0x01, 0xbc, 0x0e, 0x16, 0xc1, 0xbc, 0x14,
+    0xc5, 0xd4, 0x7c, 0x01, 0x90, 0x1b, 0x01, 0xbc, 0x26, 0xc5, 0xdb, 0x5c,
+    0x01, 0x90, 0x23, 0x01, 0xbc, 0x2c, 0x12, 0xc1, 0xbc, 0x32, 0xc4, 0xad,
+    0x95, 0x01, 0x90, 0x33, 0x01, 0xbc, 0x44, 0xc5, 0xbe, 0x8b, 0x01, 0x90,
+    0x3b, 0x01, 0xbc, 0x4a, 0x05, 0xc1, 0xbc, 0x50, 0xc5, 0x98, 0x2e, 0x01,
+    0x90, 0x6a, 0x01, 0xbc, 0x62, 0xc4, 0xe0, 0x1c, 0x01, 0x90, 0xe9, 0xc3,
+    0x0c, 0xe6, 0x01, 0x90, 0xf0, 0xc3, 0x05, 0x16, 0x01, 0x91, 0x01, 0x16,
+    0xc1, 0xbc, 0x68, 0x08, 0xc1, 0xbc, 0x7a, 0x15, 0xc1, 0xbc, 0x8a, 0x07,
+    0xc1, 0xbc, 0xa8, 0x10, 0xc1, 0xbc, 0xba, 0x0f, 0xc1, 0xbc, 0xc6, 0x19,
+    0xc1, 0xbc, 0xd2, 0xc4, 0xde, 0x52, 0x01, 0x91, 0x91, 0x05, 0xc1, 0xbc,
+    0xde, 0xc5, 0xdc, 0x1f, 0x01, 0x91, 0xc1, 0x42, 0x03, 0xe1, 0xc1, 0xbc,
+    0xea, 0xc8, 0xb6, 0xc0, 0x01, 0x91, 0xf8, 0xc2, 0x00, 0x5d, 0x01, 0x11,
+    0x29, 0x45, 0x00, 0x92, 0x41, 0xbc, 0xfa, 0xca, 0x1b, 0x3f, 0x01, 0x01,
+    0x49, 0xc2, 0x0c, 0x05, 0x01, 0x70, 0x79, 0xc7, 0x68, 0xd4, 0x01, 0x72,
+    0x68, 0x18, 0xc1, 0xbd, 0x06, 0x0d, 0xc1, 0xbd, 0x12, 0x16, 0xc1, 0xbd,
+    0x24, 0x1b, 0xc1, 0xbd, 0x2e, 0xc3, 0xe5, 0xc2, 0x0b, 0x5c, 0x59, 0x42,
+    0x00, 0xce, 0xc1, 0xbd, 0x3a, 0xc4, 0xe3, 0x08, 0x0b, 0x5c, 0x39, 0xc4,
+    0xe3, 0xac, 0x0b, 0x5c, 0x21, 0xc5, 0xdd, 0x4b, 0x0b, 0x5c, 0x09, 0x0e,
+    0x41, 0xbd, 0x44, 0x05, 0xc1, 0xbd, 0x50, 0xc3, 0xe5, 0x52, 0x0b, 0x59,
+    0x71, 0xc2, 0x1f, 0x90, 0x0b, 0x59, 0x69, 0x10, 0xc1, 0xbd, 0x5c, 0xc5,
+    0xd3, 0xbe, 0x0b, 0x59, 0x51, 0x0a, 0xc1, 0xbd, 0x78, 0xc3, 0xc6, 0xbf,
+    0x0b, 0x59, 0x31, 0xc3, 0xd5, 0x6f, 0x0b, 0x59, 0x21, 0xc4, 0xe2, 0xb0,
+    0x0b, 0x59, 0x19, 0xc3, 0x51, 0xdd, 0x0b, 0x59, 0x09, 0xc3, 0x1f, 0x8f,
+    0x0b, 0x58, 0xf1, 0xc3, 0x9d, 0x71, 0x0b, 0x58, 0xe0, 0xc8, 0xb5, 0x30,
+    0x0b, 0x5b, 0xb9, 0xc8, 0xbd, 0x48, 0x0b, 0x5b, 0xb1, 0x16, 0xc1, 0xbd,
+    0x8a, 0x05, 0xc1, 0xbd, 0x99, 0xd2, 0x47, 0x29, 0x0b, 0x5b, 0x90, 0xc2,
+    0x10, 0x85, 0x0b, 0x5b, 0x89, 0x44, 0x9d, 0x6a, 0x41, 0xbd, 0xa5, 0xc2,
+    0x1f, 0x90, 0x0b, 0x5b, 0x79, 0xca, 0x9d, 0x68, 0x0b, 0x5b, 0x69, 0xce,
+    0x72, 0x8c, 0x0b, 0x5b, 0x30, 0xc3, 0xe4, 0x8d, 0x0b, 0x5b, 0x59, 0xc3,
+    0xe5, 0x86, 0x0b, 0x5b, 0x48, 0xc3, 0x3f, 0xea, 0x0b, 0x5b, 0x51, 0x1b,
+    0xc1, 0xbd, 0xb1, 0xc3, 0x28, 0x3a, 0x0b, 0x5a, 0x20, 0xc3, 0x6b, 0xb5,
+    0x0b, 0x5b, 0x41, 0xc2, 0x00, 0xdf, 0x0b, 0x5b, 0x28, 0xc3, 0x44, 0xca,
+    0x0b, 0x5b, 0x19, 0xc4, 0xe2, 0xa0, 0x0b, 0x5a, 0x11, 0xc4, 0xde, 0x3c,
+    0x0b, 0x5a, 0x01, 0xc4, 0xe1, 0x48, 0x0b, 0x59, 0xd9, 0x16, 0x41, 0xbd,
+    0xbd, 0xc8, 0xb7, 0xc0, 0x0b, 0x5b, 0x09, 0x42, 0x00, 0x79, 0x41, 0xbd,
+    0xc7, 0xc9, 0x32, 0x36, 0x0b, 0x5a, 0xf9, 0x95, 0x0b, 0x5a, 0xe0, 0xc4,
+    0x17, 0xf7, 0x0b, 0x5a, 0xb9, 0xc2, 0x24, 0x36, 0x0b, 0x5a, 0xb0, 0xc3,
+    0x0c, 0xf7, 0x0b, 0x5a, 0xa9, 0xc3, 0x04, 0xa0, 0x0b, 0x5a, 0xa0, 0xc4,
+    0x03, 0xe0, 0x0b, 0x5a, 0x99, 0xc2, 0x01, 0xa2, 0x0b, 0x5a, 0x90, 0xc3,
+    0xe5, 0x53, 0x0b, 0x59, 0xb1, 0xc2, 0x00, 0xda, 0x0b, 0x59, 0x80, 0xc3,
+    0x7d, 0xa6, 0x0b, 0x59, 0xa1, 0x91, 0x0b, 0x59, 0x88, 0xc3, 0x40, 0xac,
+    0x0b, 0x59, 0x99, 0xc2, 0x00, 0x5a, 0x0b, 0x59, 0x90, 0x03, 0xc1, 0xbd,
+    0xcf, 0x98, 0x0b, 0x58, 0xb9, 0x84, 0x0b, 0x58, 0xb1, 0x19, 0xc1, 0xbd,
+    0xd7, 0x0b, 0xc1, 0xbd, 0xdf, 0x17, 0x41, 0xbd, 0xe7, 0x98, 0x0b, 0x58,
+    0xc9, 0x84, 0x0b, 0x58, 0xc0, 0x03, 0xc1, 0xbd, 0xef, 0x98, 0x0b, 0x58,
+    0x19, 0x84, 0x0b, 0x58, 0x10, 0x98, 0x0b, 0x58, 0x99, 0x84, 0x0b, 0x58,
+    0x91, 0x11, 0x41, 0xbd, 0xf7, 0x03, 0xc1, 0xbd, 0xff, 0x98, 0x0b, 0x58,
+    0x39, 0x84, 0x0b, 0x58, 0x30, 0x98, 0x0b, 0x58, 0x49, 0x84, 0x0b, 0x58,
+    0x41, 0x07, 0x41, 0xbe, 0x07, 0xc4, 0x27, 0x7b, 0x0f, 0xa7, 0x79, 0xc4,
+    0x01, 0x65, 0x01, 0x80, 0x92, 0x01, 0xbe, 0x0f, 0x01, 0xc1, 0xbe, 0x15,
+    0xcb, 0x78, 0x7b, 0x0f, 0xa5, 0xd8, 0x91, 0x08, 0x5d, 0x51, 0xc4, 0x17,
+    0xf9, 0x08, 0x5d, 0x70, 0xc3, 0x17, 0x62, 0x08, 0x5c, 0x79, 0xc4, 0xd9,
+    0x0f, 0x08, 0x5c, 0x68, 0x16, 0xc1, 0xbe, 0x3d, 0xc3, 0x05, 0x16, 0x08,
+    0x48, 0xb2, 0x01, 0xbe, 0x4d, 0x16, 0xc1, 0xbe, 0x53, 0x15, 0xc1, 0xbe,
+    0x5f, 0xc4, 0xaf, 0x02, 0x08, 0x48, 0x99, 0xc3, 0xe5, 0x95, 0x08, 0x48,
+    0x91, 0xc2, 0x00, 0x78, 0x08, 0x48, 0x81, 0x03, 0xc1, 0xbe, 0x71, 0xc3,
+    0x20, 0xb0, 0x08, 0x48, 0x69, 0xc3, 0x03, 0xb0, 0x08, 0x48, 0x61, 0xc4,
+    0xdb, 0xe8, 0x08, 0x48, 0x59, 0xc3, 0xb8, 0x25, 0x08, 0x48, 0x51, 0xc3,
+    0x4e, 0x09, 0x08, 0x48, 0x49, 0xc2, 0x00, 0x61, 0x08, 0x48, 0x23, 0x01,
+    0xbe, 0x7d, 0xc3, 0x6b, 0x15, 0x08, 0x48, 0x31, 0xc3, 0xc8, 0x7f, 0x08,
+    0x48, 0x29, 0xc4, 0xd6, 0x98, 0x08, 0x48, 0x19, 0xc4, 0xaa, 0x63, 0x08,
+    0x48, 0x11, 0xc3, 0x02, 0x6a, 0x08, 0x48, 0x08, 0x0d, 0xc1, 0xbe, 0x81,
+    0x09, 0xc1, 0xbe, 0x8b, 0x10, 0xc1, 0xbe, 0x95, 0x05, 0xc1, 0xbe, 0xab,
+    0xc2, 0x21, 0x7d, 0x05, 0x42, 0x31, 0x16, 0xc1, 0xbe, 0xb8, 0x06, 0xc1,
+    0xbe, 0xca, 0x12, 0xc1, 0xbe, 0xda, 0xc2, 0x00, 0xa0, 0x05, 0x42, 0x71,
+    0xc2, 0x00, 0xb6, 0x05, 0x42, 0x79, 0xc2, 0x00, 0x71, 0x05, 0x42, 0x99,
+    0x1c, 0xc1, 0xbe, 0xe4, 0x15, 0xc1, 0xbe, 0xee, 0xc2, 0x1a, 0x18, 0x05,
+    0x42, 0xb9, 0xc2, 0x00, 0x3b, 0x05, 0x42, 0xc1, 0xc2, 0x00, 0x89, 0x05,
+    0x42, 0xc9, 0xc2, 0x00, 0xce, 0x05, 0x42, 0xe1, 0x83, 0x05, 0x42, 0xeb,
+    0x01, 0xbe, 0xfe, 0x8b, 0x05, 0x42, 0xf1, 0x97, 0x05, 0x42, 0xf9, 0x87,
+    0x05, 0x43, 0x03, 0x01, 0xbf, 0x0a, 0x91, 0x05, 0x43, 0x09, 0xc2, 0x0f,
+    0xba, 0x05, 0x43, 0x11, 0xc2, 0x66, 0x73, 0x05, 0x43, 0x19, 0xc2, 0x04,
+    0x70, 0x05, 0x43, 0x21, 0x45, 0x14, 0xe6, 0x41, 0xbf, 0x0e, 0x17, 0xc1,
+    0xbf, 0x1a, 0xcf, 0x6a, 0x52, 0x05, 0x43, 0xa0, 0xc4, 0x02, 0xea, 0x05,
+    0x43, 0xb1, 0xcb, 0x99, 0x25, 0x05, 0x43, 0xb8, 0xc9, 0xa5, 0xf6, 0x08,
+    0x0e, 0x81, 0x0e, 0xc1, 0xbf, 0x26, 0xc6, 0xca, 0x52, 0x08, 0x0f, 0xa0,
+    0xcc, 0x87, 0x60, 0x08, 0x0e, 0x91, 0xc4, 0x83, 0x7b, 0x08, 0x0e, 0xc1,
+    0xc4, 0x5d, 0x49, 0x08, 0x0f, 0x80, 0x03, 0xc1, 0xbf, 0x32, 0xc4, 0xdf,
+    0x6c, 0x08, 0x0e, 0xa1, 0xc3, 0x44, 0xca, 0x08, 0x0e, 0xe1, 0x11, 0x41,
+    0xbf, 0x42, 0xc4, 0x29, 0x8c, 0x08, 0x0e, 0xa9, 0xc8, 0xbd, 0xb8, 0x08,
+    0x0f, 0xe0, 0xc5, 0xba, 0xd3, 0x08, 0x0e, 0xb1, 0xc3, 0x03, 0x81, 0x08,
+    0x0f, 0x49, 0xc3, 0x06, 0xb5, 0x08, 0x0f, 0x50, 0x11, 0xc1, 0xbf, 0x51,
+    0xc2, 0x00, 0xc8, 0x08, 0x0f, 0x8b, 0x01, 0xbf, 0x5b, 0xc8, 0xbd, 0xe8,
+    0x08, 0x0f, 0x58, 0x42, 0x00, 0x0a, 0xc1, 0xbf, 0x61, 0xc2, 0x2f, 0x05,
+    0x08, 0x0e, 0xf9, 0xc4, 0x0a, 0xb7, 0x08, 0x0f, 0x29, 0xc8, 0xb4, 0xf8,
+    0x08, 0x0f, 0xd9, 0xc7, 0xbf, 0xdd, 0x08, 0x0f, 0xd0, 0xc6, 0xca, 0xfa,
+    0x08, 0x0e, 0xe9, 0xc5, 0xd6, 0xc0, 0x08, 0x0e, 0xf0, 0x86, 0x08, 0x0f,
+    0x01, 0xc2, 0x00, 0x37, 0x08, 0x0f, 0xb0, 0xc4, 0xdf, 0xe8, 0x08, 0x0f,
+    0x19, 0xc2, 0x00, 0x98, 0x08, 0x0f, 0x78, 0xc2, 0x03, 0x84, 0x08, 0x0f,
+    0x69, 0xc6, 0xcd, 0x76, 0x08, 0x0f, 0xa8, 0xc5, 0x4c, 0xec, 0x08, 0x0f,
+    0xc9, 0xc7, 0xc0, 0xf5, 0x08, 0x0e, 0xb8, 0x15, 0xc1, 0xbf, 0x6b, 0x83,
+    0x01, 0x85, 0x13, 0x01, 0xbf, 0x85, 0x0f, 0xc1, 0xbf, 0x8b, 0x8b, 0x01,
+    0x85, 0x21, 0x97, 0x01, 0x85, 0x31, 0x87, 0x01, 0x85, 0x41, 0x91, 0x01,
+    0x85, 0x51, 0x0d, 0xc1, 0xbf, 0xa2, 0x09, 0xc1, 0xbf, 0xb6, 0x1c, 0xc1,
+    0xbf, 0xca, 0x16, 0xc1, 0xbf, 0xde, 0x06, 0xc1, 0xbf, 0xf2, 0x90, 0x01,
+    0x87, 0x9b, 0x01, 0xc0, 0x06, 0x0a, 0xc1, 0xc0, 0x1a, 0x04, 0xc1, 0xc0,
+    0x2e, 0x12, 0xc1, 0xc0, 0x42, 0x1b, 0xc1, 0xc0, 0x56, 0x14, 0xc1, 0xc0,
+    0x62, 0x19, 0xc1, 0xc0, 0x76, 0x18, 0x41, 0xc0, 0x86, 0x97, 0x08, 0x85,
+    0xc1, 0x8b, 0x08, 0x85, 0xb1, 0x83, 0x08, 0x85, 0x80, 0x97, 0x08, 0x85,
+    0xa0, 0x8b, 0x08, 0x85, 0x90, 0xc5, 0x81, 0xf7, 0x08, 0x86, 0x09, 0xcc,
+    0x46, 0xd2, 0x08, 0x85, 0xf8, 0xc5, 0x34, 0xd9, 0x08, 0x85, 0xd1, 0x42,
+    0x06, 0xb4, 0xc1, 0xc0, 0x9a, 0xc8, 0x14, 0x02, 0x08, 0x84, 0x09, 0xcb,
+    0x1f, 0xe9, 0x08, 0x84, 0x00, 0x83, 0x08, 0x85, 0x71, 0xc2, 0x0d, 0x01,
+    0x08, 0x85, 0x69, 0xc2, 0x00, 0xce, 0x08, 0x85, 0x60, 0x83, 0x08, 0x85,
+    0x49, 0xc2, 0x00, 0xce, 0x08, 0x84, 0xe0, 0xc2, 0x00, 0xce, 0x08, 0x85,
+    0x31, 0x83, 0x08, 0x85, 0x28, 0xc2, 0x00, 0xce, 0x08, 0x85, 0x21, 0x83,
+    0x08, 0x85, 0x18, 0x83, 0x08, 0x85, 0x11, 0xc2, 0x03, 0x83, 0x08, 0x84,
+    0xe9, 0xc2, 0x1a, 0x18, 0x08, 0x84, 0xb1, 0xc2, 0x00, 0xeb, 0x08, 0x84,
+    0x88, 0xc2, 0x00, 0xce, 0x08, 0x85, 0x09, 0x83, 0x08, 0x85, 0x01, 0x06,
+    0x41, 0xc0, 0xa6, 0xc2, 0x00, 0xce, 0x08, 0x84, 0xf9, 0x83, 0x08, 0x84,
+    0xf1, 0x16, 0x41, 0xc0, 0xb6, 0xc2, 0x00, 0xce, 0x08, 0x84, 0xa9, 0x83,
+    0x08, 0x84, 0xa0, 0xc2, 0x00, 0xce, 0x08, 0x84, 0x99, 0x83, 0x08, 0x84,
+    0x90, 0xc2, 0x00, 0xce, 0x08, 0x84, 0x81, 0x83, 0x08, 0x84, 0x78, 0xc2,
+    0x00, 0xce, 0x08, 0x84, 0x71, 0x83, 0x08, 0x84, 0x68, 0x97, 0x08, 0x84,
+    0x61, 0x8b, 0x08, 0x84, 0x51, 0x83, 0x08, 0x84, 0x20, 0x97, 0x08, 0x84,
+    0x40, 0x8b, 0x08, 0x84, 0x30, 0xc7, 0xc4, 0x3d, 0x05, 0x49, 0x68, 0x87,
+    0x05, 0x49, 0x48, 0x87, 0x05, 0x49, 0x30, 0x91, 0x05, 0x49, 0x29, 0x87,
+    0x05, 0x49, 0x18, 0x83, 0x05, 0x48, 0xf9, 0xc2, 0x00, 0x51, 0x05, 0x48,
+    0x98, 0xc2, 0x00, 0xce, 0x05, 0x48, 0xf1, 0x83, 0x05, 0x48, 0x90, 0xc2,
+    0x00, 0xce, 0x05, 0x48, 0xb1, 0x83, 0x05, 0x48, 0xa8, 0x83, 0x05, 0x48,
+    0xa1, 0xc2, 0x1a, 0x18, 0x05, 0x48, 0x89, 0xc2, 0x00, 0xeb, 0x05, 0x48,
+    0x68, 0xc2, 0x00, 0xce, 0x05, 0x48, 0x79, 0x83, 0x05, 0x48, 0x70, 0xc2,
+    0x00, 0xce, 0x05, 0x48, 0x59, 0x83, 0x05, 0x48, 0x50, 0xc4, 0x17, 0xf7,
+    0x05, 0x48, 0x39, 0xc2, 0x24, 0x36, 0x05, 0x48, 0x30, 0xc3, 0x0c, 0xf7,
+    0x05, 0x48, 0x29, 0xc3, 0x04, 0xa0, 0x05, 0x48, 0x20, 0xc4, 0x03, 0xe0,
+    0x05, 0x48, 0x19, 0xc2, 0x01, 0xa2, 0x05, 0x48, 0x10, 0x15, 0xc1, 0xc0,
+    0xc0, 0xcb, 0x1f, 0xe9, 0x00, 0x64, 0x09, 0x03, 0xc1, 0xc0, 0xcc, 0x42,
+    0x06, 0xb4, 0xc1, 0xc0, 0xd8, 0xc5, 0x34, 0xd9, 0x00, 0x65, 0xe1, 0xcb,
+    0x92, 0xf5, 0x00, 0x67, 0x89, 0xcb, 0x98, 0x33, 0x00, 0x67, 0x90, 0x45,
+    0x01, 0x94, 0xc1, 0xc0, 0xe4, 0xc9, 0x35, 0x6e, 0x00, 0x66, 0xa8, 0x03,
+    0xc1, 0xc1, 0x53, 0x8b, 0x00, 0x65, 0xfb, 0x01, 0xc1, 0x5f, 0x97, 0x00,
+    0x66, 0x0b, 0x01, 0xc1, 0x63, 0x48, 0xaa, 0xd2, 0xc1, 0xc1, 0x67, 0x87,
+    0x00, 0x66, 0x33, 0x01, 0xc1, 0x75, 0x91, 0x00, 0x66, 0x52, 0x01, 0xc1,
+    0x79, 0xc4, 0x18, 0xa7, 0x00, 0x67, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x67,
+    0x39, 0x16, 0xc1, 0xc1, 0x7d, 0x08, 0xc1, 0xc1, 0x89, 0x15, 0xc1, 0xc1,
+    0x95, 0xc5, 0x0a, 0xfd, 0x00, 0x67, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x67,
+    0x78, 0x11, 0xc1, 0xc1, 0xa1, 0x0e, 0xc1, 0xc1, 0xb4, 0x06, 0xc1, 0xc1,
+    0xc9, 0x15, 0xc1, 0xc1, 0xd9, 0x0a, 0xc1, 0xc2, 0x23, 0x16, 0xc1, 0xc2,
+    0x35, 0x0f, 0xc1, 0xc2, 0x5a, 0x07, 0xc1, 0xc2, 0x6c, 0x05, 0xc1, 0xc2,
+    0x8f, 0x0b, 0xc1, 0xc2, 0xa7, 0xc5, 0xa0, 0xc9, 0x01, 0x78, 0x89, 0x12,
+    0xc1, 0xc2, 0xb1, 0x19, 0xc1, 0xc2, 0xc7, 0x14, 0xc1, 0xc2, 0xe1, 0x03,
+    0xc1, 0xc2, 0xfb, 0x09, 0xc1, 0xc3, 0x13, 0x04, 0xc1, 0xc3, 0x2c, 0x10,
+    0xc1, 0xc3, 0x46, 0x08, 0xc1, 0xc3, 0x50, 0x42, 0x21, 0x7d, 0xc1, 0xc3,
+    0x72, 0xc3, 0x28, 0x3b, 0x01, 0x7b, 0x21, 0x18, 0xc1, 0xc3, 0x7c, 0xc6,
+    0xc6, 0xc8, 0x01, 0x7e, 0x40, 0xc4, 0x17, 0xf7, 0x08, 0x97, 0xb9, 0xc2,
+    0x24, 0x36, 0x08, 0x97, 0xb0, 0xc3, 0x0c, 0xf7, 0x08, 0x97, 0xa9, 0xc3,
+    0x04, 0xa0, 0x08, 0x97, 0xa0, 0xc4, 0x03, 0xe0, 0x08, 0x97, 0x99, 0xc2,
+    0x01, 0xa2, 0x08, 0x97, 0x90, 0x8b, 0x08, 0x97, 0x31, 0x83, 0x08, 0x97,
+    0x01, 0x97, 0x08, 0x97, 0x40, 0x97, 0x08, 0x97, 0x20, 0x8b, 0x08, 0x97,
+    0x10, 0x83, 0x08, 0x96, 0xe9, 0xc2, 0x00, 0xce, 0x08, 0x96, 0xe0, 0x83,
+    0x08, 0x96, 0xc9, 0xc2, 0x00, 0x3b, 0x08, 0x96, 0x50, 0xc2, 0x00, 0xce,
+    0x08, 0x96, 0xb1, 0xc2, 0x00, 0xa0, 0x08, 0x96, 0xa9, 0x83, 0x08, 0x96,
+    0xa0, 0xc2, 0x00, 0xce, 0x08, 0x96, 0x99, 0x83, 0x08, 0x96, 0x90, 0x83,
+    0x08, 0x96, 0x89, 0xc2, 0x03, 0x83, 0x08, 0x96, 0x61, 0xc2, 0x1a, 0x18,
+    0x08, 0x96, 0x29, 0xc2, 0x00, 0xeb, 0x08, 0x95, 0xf8, 0xc2, 0x00, 0xce,
+    0x08, 0x96, 0x81, 0x83, 0x08, 0x96, 0x79, 0x06, 0x41, 0xc3, 0x88, 0xc2,
+    0x00, 0xce, 0x08, 0x96, 0x71, 0x83, 0x08, 0x96, 0x69, 0x16, 0x41, 0xc3,
+    0x98, 0xc2, 0x00, 0xce, 0x08, 0x96, 0x21, 0xc2, 0x21, 0x7d, 0x08, 0x96,
+    0x19, 0x83, 0x08, 0x96, 0x10, 0xc2, 0x00, 0xce, 0x08, 0x96, 0x09, 0x83,
+    0x08, 0x96, 0x00, 0xc2, 0x00, 0xce, 0x08, 0x95, 0xf1, 0xc2, 0x00, 0xeb,
+    0x08, 0x95, 0xe9, 0x83, 0x08, 0x95, 0xe0, 0xc2, 0x00, 0xce, 0x08, 0x95,
+    0xd9, 0x83, 0x08, 0x95, 0xd0, 0x97, 0x08, 0x95, 0xc9, 0x8b, 0x08, 0x95,
+    0xb9, 0x83, 0x08, 0x95, 0x88, 0x97, 0x08, 0x95, 0xa8, 0x8b, 0x08, 0x95,
+    0x98, 0x15, 0xc1, 0xc3, 0xa2, 0xc5, 0x34, 0xd9, 0x08, 0x91, 0xb1, 0xc6,
+    0x1f, 0xf5, 0x08, 0x91, 0xa9, 0xc8, 0x14, 0x02, 0x08, 0x91, 0xa0, 0xcc,
+    0x46, 0xd2, 0x08, 0x91, 0xe1, 0xc5, 0x81, 0xf7, 0x08, 0x91, 0xc8, 0x97,
+    0x08, 0x91, 0x99, 0x8b, 0x08, 0x91, 0x89, 0x83, 0x08, 0x91, 0x60, 0x8b,
+    0x08, 0x91, 0x70, 0xc2, 0x00, 0x89, 0x08, 0x91, 0x59, 0x83, 0x08, 0x91,
+    0x38, 0xc2, 0x00, 0xce, 0x08, 0x91, 0x19, 0xc2, 0x00, 0xa0, 0x08, 0x91,
+    0x11, 0x83, 0x08, 0x91, 0x08, 0xc2, 0x00, 0xce, 0x08, 0x91, 0x01, 0x83,
+    0x08, 0x90, 0xf8, 0x83, 0x08, 0x90, 0xf1, 0xc2, 0x03, 0x83, 0x08, 0x90,
+    0xc1, 0xc2, 0x1a, 0x18, 0x08, 0x90, 0x99, 0xc2, 0x00, 0xeb, 0x08, 0x90,
+    0x68, 0xc2, 0x00, 0xce, 0x08, 0x90, 0xe9, 0x06, 0xc1, 0xc3, 0xae, 0x83,
+    0x08, 0x90, 0xd8, 0xc2, 0x00, 0xce, 0x08, 0x90, 0xd1, 0x83, 0x08, 0x90,
+    0xc9, 0x16, 0x41, 0xc3, 0xbe, 0xc2, 0x21, 0x7d, 0x08, 0x90, 0x89, 0x83,
+    0x08, 0x90, 0x80, 0xc2, 0x00, 0xce, 0x08, 0x90, 0x79, 0x83, 0x08, 0x90,
+    0x70, 0xc2, 0x00, 0xce, 0x08, 0x90, 0x61, 0xc2, 0x00, 0xeb, 0x08, 0x90,
+    0x59, 0x83, 0x08, 0x90, 0x50, 0xc2, 0x00, 0xce, 0x08, 0x90, 0x49, 0x83,
+    0x08, 0x90, 0x40, 0x97, 0x08, 0x90, 0x39, 0x8b, 0x08, 0x90, 0x29, 0x83,
+    0x08, 0x90, 0x08, 0x43, 0xd3, 0x94, 0xc1, 0xc3, 0xc8, 0x12, 0xc1, 0xc3,
+    0xd0, 0x04, 0xc1, 0xc3, 0xe2, 0x45, 0xdc, 0x15, 0xc1, 0xc3, 0xee, 0xc9,
+    0xb2, 0x97, 0x00, 0xcf, 0x81, 0x4a, 0xa5, 0x74, 0x41, 0xc3, 0xfa, 0x03,
+    0xc1, 0xc4, 0x0e, 0x0d, 0xc1, 0xc4, 0x20, 0xcb, 0x97, 0xdb, 0x00, 0xbe,
+    0xc9, 0x04, 0xc1, 0xc4, 0x32, 0xc7, 0xc1, 0x0a, 0x00, 0xbe, 0xb9, 0x05,
+    0xc1, 0xc4, 0x3c, 0xc6, 0xcf, 0xda, 0x00, 0xbe, 0x89, 0xcd, 0x76, 0x3d,
+    0x00, 0xbe, 0x81, 0x16, 0xc1, 0xc4, 0x48, 0x14, 0xc1, 0xc4, 0x54, 0xcb,
+    0x90, 0x56, 0x00, 0xbe, 0x49, 0xcd, 0x7d, 0x9a, 0x00, 0xbe, 0x41, 0xc7,
+    0xc3, 0x25, 0x00, 0xbe, 0x30, 0xc4, 0x17, 0xf7, 0x00, 0xbf, 0x39, 0xc2,
+    0x24, 0x36, 0x00, 0xbf, 0x30, 0xc3, 0x0c, 0xf7, 0x00, 0xbf, 0x29, 0xc3,
+    0x04, 0xa0, 0x00, 0xbf, 0x20, 0xc4, 0x03, 0xe0, 0x00, 0xbf, 0x19, 0xc2,
+    0x01, 0xa2, 0x00, 0xbf, 0x10, 0x03, 0xc1, 0xc4, 0x60, 0x11, 0xc1, 0xc4,
+    0x70, 0x87, 0x00, 0xbe, 0x09, 0x8b, 0x00, 0xbd, 0xbb, 0x01, 0xc4, 0x78,
+    0x9b, 0x00, 0xbd, 0xcb, 0x01, 0xc4, 0x80, 0x97, 0x00, 0xbd, 0xda, 0x01,
+    0xc4, 0x88, 0x83, 0x00, 0xbd, 0xa9, 0x93, 0x00, 0xbd, 0xa0, 0x03, 0xc1,
+    0xc4, 0x90, 0x48, 0xb9, 0x60, 0xc1, 0xc4, 0xa0, 0x87, 0x00, 0xbd, 0x79,
+    0x97, 0x00, 0xbd, 0x3b, 0x01, 0xc4, 0xac, 0x8b, 0x00, 0xbd, 0x2a, 0x01,
+    0xc4, 0xb7, 0x9b, 0x00, 0xbd, 0x70, 0x9b, 0x00, 0xbd, 0x60, 0x83, 0x00,
+    0xbd, 0x09, 0x91, 0x00, 0xbc, 0xd8, 0x83, 0x00, 0xbc, 0xf9, 0xc2, 0x02,
+    0x1d, 0x00, 0xbc, 0xf1, 0xc2, 0x00, 0xce, 0x00, 0xbc, 0xe8, 0x0a, 0xc1,
+    0xc4, 0xbb, 0x91, 0x00, 0xbc, 0xb0, 0x91, 0x00, 0xbc, 0x99, 0xc2, 0x00,
+    0x10, 0x00, 0xbc, 0x71, 0xc2, 0x31, 0xda, 0x00, 0xbc, 0x49, 0xc2, 0x14,
+    0x10, 0x00, 0xbc, 0x20, 0x0a, 0xc1, 0xc4, 0xc3, 0x91, 0x00, 0xbc, 0x89,
+    0x83, 0x00, 0xbc, 0x79, 0x42, 0x00, 0x60, 0x41, 0xc4, 0xcb, 0x91, 0x00,
+    0xbc, 0x61, 0x83, 0x00, 0xbc, 0x50, 0x0a, 0xc1, 0xc4, 0xd3, 0x91, 0x00,
+    0xbc, 0x39, 0x83, 0x00, 0xbc, 0x28, 0x0a, 0xc1, 0xc4, 0xdb, 0x91, 0x00,
+    0xbc, 0x11, 0x83, 0x00, 0xbc, 0x00, 0xc4, 0x23, 0xb0, 0x08, 0x52, 0xc1,
+    0xc4, 0x71, 0x75, 0x08, 0x52, 0xa8, 0x11, 0xc1, 0xc4, 0xe3, 0xc4, 0x19,
+    0xf1, 0x08, 0x52, 0xb0, 0xcb, 0x80, 0xa1, 0x08, 0x52, 0x99, 0xc5, 0x00,
+    0x7d, 0x08, 0x52, 0x90, 0xc8, 0x53, 0xd0, 0x08, 0x52, 0x39, 0xc7, 0x0c,
+    0xe7, 0x08, 0x52, 0x30, 0xc5, 0x26, 0x6c, 0x08, 0x52, 0x29, 0xc2, 0x00,
+    0x79, 0x08, 0x52, 0x20, 0xc4, 0x03, 0xe0, 0x08, 0x52, 0x11, 0xc2, 0x01,
+    0xa2, 0x08, 0x52, 0x08, 0xcb, 0x35, 0x6c, 0x08, 0x50, 0x61, 0x45, 0x00,
+    0x8d, 0x41, 0xc4, 0xed, 0xc7, 0x0f, 0x80, 0x08, 0x51, 0xd1, 0xcf, 0x64,
+    0x2b, 0x08, 0x50, 0x68, 0xc2, 0x00, 0xce, 0x08, 0x51, 0xa9, 0x83, 0x08,
+    0x51, 0x60, 0x16, 0xc1, 0xc5, 0x03, 0xc2, 0x00, 0xce, 0x08, 0x51, 0x01,
+    0x83, 0x08, 0x50, 0xf8, 0xc2, 0x00, 0xce, 0x08, 0x51, 0x39, 0x83, 0x08,
+    0x51, 0x30, 0xc2, 0x00, 0xce, 0x08, 0x51, 0x29, 0x83, 0x08, 0x51, 0x20,
+    0x83, 0x08, 0x51, 0x19, 0xc2, 0x03, 0x83, 0x08, 0x50, 0xf1, 0xc2, 0x1a,
+    0x18, 0x08, 0x50, 0xc8, 0xc2, 0x00, 0xce, 0x08, 0x51, 0x11, 0x83, 0x08,
+    0x51, 0x09, 0x06, 0x41, 0xc5, 0x11, 0xc2, 0x00, 0xce, 0x08, 0x50, 0xb1,
+    0x83, 0x08, 0x50, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0x50, 0x99, 0x83, 0x08,
+    0x50, 0x90, 0xc2, 0x00, 0xce, 0x08, 0x50, 0x89, 0x83, 0x08, 0x50, 0x81,
+    0xc2, 0x02, 0x4d, 0x08, 0x51, 0x90, 0xc2, 0x00, 0xce, 0x08, 0x51, 0x69,
+    0xc2, 0x0d, 0x01, 0x08, 0x51, 0x71, 0x83, 0x08, 0x51, 0x78, 0x46, 0x00,
+    0x91, 0x41, 0xc5, 0x1b, 0x44, 0x83, 0xd3, 0x41, 0xc5, 0x27, 0xca, 0x9b,
+    0x38, 0x0e, 0x98, 0x11, 0xcd, 0x7d, 0x32, 0x0e, 0x98, 0x08, 0xc2, 0x00,
+    0xaf, 0x01, 0x34, 0x79, 0xc3, 0x00, 0xc4, 0x01, 0x34, 0x60, 0xc3, 0x00,
+    0xc4, 0x01, 0x34, 0x71, 0xc2, 0x00, 0xaf, 0x01, 0x34, 0x68, 0x01, 0x41,
+    0xc5, 0x33, 0x01, 0x41, 0xc5, 0x3f, 0xc4, 0x17, 0xf7, 0x00, 0x01, 0xbb,
+    0x01, 0xc5, 0x4b, 0xc2, 0x24, 0x36, 0x00, 0x01, 0xb2, 0x01, 0xc5, 0x4f,
+    0xc3, 0x0c, 0xf7, 0x00, 0x01, 0xab, 0x01, 0xc5, 0x53, 0xc3, 0x04, 0xa0,
+    0x00, 0x01, 0xa2, 0x01, 0xc5, 0x57, 0xc4, 0x03, 0xe0, 0x00, 0x01, 0x9b,
+    0x01, 0xc5, 0x5b, 0xc2, 0x01, 0xa2, 0x00, 0x01, 0x92, 0x01, 0xc5, 0x5f,
+    0x01, 0x41, 0xc5, 0x63, 0x01, 0x41, 0xc5, 0x6f, 0xca, 0xa0, 0x7e, 0x01,
+    0x3c, 0x99, 0x46, 0x04, 0x99, 0x41, 0xc5, 0x7b, 0xc4, 0x28, 0x74, 0x01,
+    0x3b, 0xf1, 0xc5, 0x0a, 0xfd, 0x01, 0x3b, 0xe9, 0x15, 0xc1, 0xc5, 0x9f,
+    0x08, 0xc1, 0xc5, 0xab, 0x16, 0xc1, 0xc5, 0xb7, 0xc3, 0x05, 0x16, 0x01,
+    0x3b, 0xb0, 0xc4, 0x28, 0x74, 0x01, 0x3c, 0x41, 0xc5, 0x0a, 0xfd, 0x01,
+    0x3c, 0x39, 0x15, 0xc1, 0xc5, 0xc3, 0x08, 0xc1, 0xc5, 0xcf, 0x16, 0xc1,
+    0xc5, 0xdb, 0xc3, 0x05, 0x16, 0x01, 0x3c, 0x01, 0xc4, 0x18, 0xa7, 0x0f,
+    0x88, 0x58, 0xd1, 0x53, 0x11, 0x0f, 0xb1, 0x29, 0xc4, 0x07, 0xe9, 0x0f,
+    0xb0, 0xf0, 0x45, 0x04, 0x9a, 0xc1, 0xc5, 0xe7, 0xcb, 0x8c, 0xe6, 0x08,
+    0xca, 0x20, 0xc5, 0x34, 0xd9, 0x08, 0xca, 0x19, 0xc7, 0xc4, 0xc9, 0x08,
+    0xc9, 0xe9, 0xcb, 0x1f, 0xe9, 0x08, 0xc9, 0xe1, 0xc8, 0x14, 0x02, 0x08,
+    0xc9, 0xd8, 0xc2, 0x00, 0x3b, 0x08, 0xca, 0x11, 0xc2, 0x1a, 0x18, 0x08,
+    0xca, 0x00, 0xc5, 0x1f, 0xf6, 0x08, 0xc9, 0xf1, 0x4a, 0x6e, 0xbc, 0x41,
+    0xc6, 0x0b, 0xc2, 0x01, 0x16, 0x08, 0xc9, 0x79, 0x0e, 0xc1, 0xc6, 0x25,
+    0xc2, 0x00, 0xce, 0x08, 0xc9, 0x69, 0x15, 0xc1, 0xc6, 0x2f, 0xc2, 0x02,
+    0x63, 0x08, 0xc9, 0x49, 0xc2, 0x00, 0x3b, 0x08, 0xc9, 0x39, 0x1b, 0xc1,
+    0xc6, 0x3f, 0xc2, 0x00, 0xb6, 0x08, 0xc9, 0x21, 0x04, 0xc1, 0xc6, 0x49,
+    0x12, 0xc1, 0xc6, 0x53, 0x10, 0xc1, 0xc6, 0x5d, 0x06, 0xc1, 0xc6, 0x73,
+    0x16, 0xc1, 0xc6, 0x81, 0xc2, 0x21, 0x7d, 0x08, 0xc8, 0x99, 0x05, 0xc1,
+    0xc6, 0x91, 0x09, 0xc1, 0xc6, 0x9b, 0x0d, 0xc1, 0xc6, 0xa5, 0x91, 0x08,
+    0xc8, 0x49, 0x87, 0x08, 0xc8, 0x31, 0x97, 0x08, 0xc8, 0x23, 0x01, 0xc6,
+    0xaf, 0x8b, 0x08, 0xc8, 0x13, 0x01, 0xc6, 0xb3, 0x83, 0x08, 0xc8, 0x02,
+    0x01, 0xc6, 0xb7, 0xc5, 0x00, 0xef, 0x01, 0x16, 0x39, 0x15, 0x41, 0xc6,
+    0xbb, 0xc8, 0x16, 0x68, 0x01, 0x16, 0x21, 0xd7, 0x28, 0x5c, 0x0f, 0xa5,
+    0x01, 0x45, 0x00, 0x92, 0xc1, 0xc6, 0xc7, 0xc6, 0xd1, 0xa2, 0x0f, 0xbc,
+    0xe0, 0xc4, 0x06, 0x45, 0x0f, 0xc8, 0x43, 0x01, 0xc6, 0xdf, 0xcc, 0x84,
+    0x54, 0x0f, 0xc8, 0x4a, 0x01, 0xc6, 0xe5, 0x16, 0xc1, 0xc6, 0xeb, 0x15,
+    0xc1, 0xc6, 0xf7, 0x0a, 0xc1, 0xc7, 0x03, 0x03, 0xc1, 0xc7, 0x0f, 0xcf,
+    0x66, 0xdd, 0x01, 0x3f, 0x89, 0xcb, 0x03, 0x3e, 0x01, 0x0f, 0x4b, 0x01,
+    0xc7, 0x1e, 0x06, 0xc1, 0xc7, 0x24, 0xcd, 0x79, 0x7d, 0x01, 0x0e, 0x51,
+    0xcc, 0x30, 0xde, 0x01, 0x0d, 0x79, 0x46, 0x06, 0x64, 0xc1, 0xc7, 0x30,
+    0xc6, 0xd0, 0x58, 0x0f, 0xb3, 0x79, 0xd1, 0x51, 0x9b, 0x0f, 0xc1, 0xb9,
+    0xd0, 0x5c, 0xd2, 0x0f, 0xc1, 0xf8, 0xd2, 0x48, 0x6d, 0x01, 0x57, 0x88,
+    0xd0, 0x59, 0x82, 0x01, 0x4f, 0x49, 0xcf, 0x66, 0x47, 0x01, 0x4f, 0x40,
+    0x43, 0xe5, 0x0b, 0xc1, 0xc7, 0x3c, 0x43, 0xe4, 0xe1, 0xc1, 0xc7, 0x58,
+    0x43, 0xe5, 0x38, 0xc1, 0xc7, 0x74, 0x43, 0xe4, 0xd5, 0xc1, 0xc7, 0x90,
+    0x43, 0xe4, 0xf6, 0xc1, 0xc7, 0xac, 0x43, 0xe5, 0x4a, 0xc1, 0xc7, 0xc8,
+    0x43, 0xe4, 0xae, 0x41, 0xc7, 0xe4, 0x43, 0xe5, 0x38, 0xc1, 0xc8, 0x00,
+    0x43, 0xe4, 0xe1, 0xc1, 0xc8, 0x1c, 0x43, 0xe4, 0xd5, 0xc1, 0xc8, 0x38,
+    0x43, 0xe4, 0xf6, 0xc1, 0xc8, 0x54, 0x43, 0xe5, 0x0b, 0xc1, 0xc8, 0x70,
+    0x43, 0xe5, 0x4a, 0xc1, 0xc8, 0x8c, 0x43, 0xe4, 0xae, 0x41, 0xc8, 0xa8,
+    0x05, 0xc1, 0xc8, 0xc4, 0x49, 0x06, 0xbd, 0xc1, 0xc8, 0xd6, 0x17, 0xc1,
+    0xc8, 0xe5, 0x44, 0x07, 0xdd, 0xc1, 0xc8, 0xf1, 0x15, 0xc1, 0xc8, 0xfd,
+    0xcd, 0x30, 0xea, 0x01, 0x02, 0x39, 0xd0, 0x0e, 0xed, 0x01, 0x01, 0xe1,
+    0x12, 0xc1, 0xc9, 0x11, 0x06, 0xc1, 0xc9, 0x1b, 0x0a, 0xc1, 0xc9, 0x27,
+    0x0e, 0xc1, 0xc9, 0x33, 0xdb, 0x17, 0x7e, 0x01, 0x4c, 0xb1, 0x47, 0xc4,
+    0x05, 0xc1, 0xc9, 0x3d, 0xcc, 0x87, 0x24, 0x00, 0x16, 0xe9, 0xcd, 0x7b,
+    0x5e, 0x07, 0xf2, 0x61, 0xce, 0x6f, 0x98, 0x01, 0x70, 0xb8, 0xc9, 0x1c,
+    0xe7, 0x01, 0x35, 0x19, 0xcb, 0x22, 0x52, 0x01, 0x35, 0x11, 0xc6, 0x07,
+    0xf3, 0x01, 0x5f, 0xe0, 0x47, 0x6f, 0xd7, 0xc1, 0xc9, 0x4c, 0xce, 0x6e,
+    0xf0, 0x01, 0x4e, 0xf9, 0x45, 0x00, 0xdf, 0x41, 0xc9, 0x64, 0xc5, 0x00,
+    0x7d, 0x01, 0x2e, 0x61, 0xc4, 0x0d, 0x23, 0x01, 0x02, 0xe0, 0xc5, 0x09,
+    0x2c, 0x01, 0x58, 0xd1, 0xc6, 0x2a, 0x12, 0x01, 0x72, 0x50, 0xc5, 0x34,
+    0xd9, 0x08, 0xc1, 0xd1, 0x42, 0x06, 0xb4, 0xc1, 0xc9, 0x70, 0xc8, 0x14,
+    0x02, 0x08, 0xc1, 0xb8, 0x03, 0xc1, 0xc9, 0x7c, 0x91, 0x08, 0xc1, 0xa9,
+    0x87, 0x08, 0xc1, 0x99, 0xc9, 0xaa, 0xd2, 0x08, 0xc1, 0x8b, 0x01, 0xc9,
+    0x88, 0x97, 0x08, 0xc1, 0x7b, 0x01, 0xc9, 0x8c, 0x8b, 0x08, 0xc1, 0x6a,
+    0x01, 0xc9, 0x90, 0x14, 0xc1, 0xc9, 0x94, 0xc2, 0x00, 0xce, 0x08, 0xc1,
+    0x51, 0x15, 0xc1, 0xc9, 0x9e, 0xc2, 0x02, 0x63, 0x08, 0xc1, 0x31, 0xc2,
+    0x00, 0x89, 0x08, 0xc1, 0x29, 0xc2, 0x1a, 0x18, 0x08, 0xc1, 0x19, 0xc2,
+    0x00, 0xb6, 0x08, 0xc1, 0x11, 0x04, 0xc1, 0xc9, 0xae, 0x12, 0xc1, 0xc9,
+    0xb8, 0x10, 0xc1, 0xc9, 0xc2, 0x06, 0xc1, 0xc9, 0xd8, 0x16, 0xc1, 0xc9,
+    0xe6, 0x0c, 0xc1, 0xc9, 0xf4, 0x05, 0xc1, 0xc9, 0xfe, 0x09, 0xc1, 0xca,
+    0x08, 0x0d, 0xc1, 0xca, 0x12, 0x83, 0x08, 0xc0, 0x03, 0x01, 0xca, 0x1c,
+    0x91, 0x08, 0xc0, 0x41, 0x87, 0x08, 0xc0, 0x31, 0x97, 0x08, 0xc0, 0x23,
+    0x01, 0xca, 0x28, 0x8b, 0x08, 0xc0, 0x12, 0x01, 0xca, 0x2c, 0xc9, 0x24,
+    0x61, 0x01, 0x17, 0x68, 0xc9, 0x24, 0x61, 0x01, 0x17, 0x00, 0xcc, 0x80,
+    0xb8, 0x0f, 0xad, 0xd0, 0xc7, 0xc3, 0x79, 0x0f, 0x9e, 0xe8, 0x4f, 0x09,
+    0x39, 0xc1, 0xca, 0x30, 0x4d, 0x28, 0xa7, 0x41, 0xca, 0x92, 0xcf, 0x64,
+    0x85, 0x01, 0x1f, 0x41, 0xd4, 0x3e, 0x82, 0x01, 0x1c, 0xb0, 0x47, 0x0b,
+    0xfc, 0xc1, 0xca, 0xf4, 0x44, 0x06, 0xa9, 0xc1, 0xcb, 0x00, 0xc4, 0x54,
+    0xc6, 0x01, 0x1e, 0x30, 0xc8, 0x00, 0xc1, 0x01, 0x1e, 0x19, 0xc6, 0x00,
+    0x7c, 0x01, 0x1e, 0x00, 0xc4, 0x54, 0xc6, 0x01, 0x1e, 0x41, 0xc8, 0x00,
+    0xc1, 0x01, 0x1e, 0x29, 0xc6, 0x00, 0x7c, 0x01, 0x1e, 0x10, 0xc4, 0x54,
+    0xc6, 0x01, 0x1e, 0x39, 0xc8, 0x00, 0xc1, 0x01, 0x1e, 0x21, 0xc6, 0x00,
+    0x7c, 0x01, 0x1e, 0x08, 0x0e, 0xc1, 0xcb, 0x0c, 0x14, 0xc1, 0xcb, 0x14,
+    0x1b, 0xc1, 0xcb, 0x24, 0xc2, 0x00, 0xb6, 0x00, 0x49, 0x73, 0x01, 0xcb,
+    0x2e, 0x04, 0xc1, 0xcb, 0x34, 0x12, 0xc1, 0xcb, 0x44, 0x10, 0xc1, 0xcb,
+    0x4e, 0x06, 0xc1, 0xcb, 0x62, 0x16, 0xc1, 0xcb, 0x70, 0x0c, 0xc1, 0xcb,
+    0x7e, 0x05, 0xc1, 0xcb, 0x8e, 0x09, 0xc1, 0xcb, 0x9b, 0x0d, 0xc1, 0xcb,
+    0xaf, 0x83, 0x00, 0x48, 0x2b, 0x01, 0xcb, 0xb7, 0x91, 0x00, 0x48, 0x9b,
+    0x01, 0xcb, 0xcb, 0x15, 0xc1, 0xcb, 0xd5, 0x87, 0x00, 0x48, 0x79, 0x18,
+    0xc1, 0xcb, 0xe3, 0x97, 0x00, 0x48, 0x4b, 0x01, 0xcb, 0xed, 0x8b, 0x00,
+    0x48, 0x3b, 0x01, 0xcb, 0xf8, 0x0a, 0xc1, 0xcb, 0xfc, 0x1c, 0xc1, 0xcc,
+    0x06, 0xc2, 0x0f, 0xba, 0x00, 0x4a, 0xc1, 0xc2, 0x04, 0x70, 0x00, 0x4a,
+    0xf0, 0x44, 0x00, 0x8e, 0xc1, 0xcc, 0x10, 0x4b, 0x94, 0x4a, 0x41, 0xcc,
+    0x45, 0x03, 0xc1, 0xcc, 0x51, 0xcf, 0x60, 0x4d, 0x00, 0x4a, 0x71, 0x91,
+    0x00, 0x4a, 0x5b, 0x01, 0xcc, 0x65, 0x46, 0x2c, 0x9e, 0xc1, 0xcc, 0x6f,
+    0x47, 0xc3, 0xbf, 0xc1, 0xcc, 0x77, 0x87, 0x00, 0x4a, 0x39, 0x48, 0xaa,
+    0xd2, 0xc1, 0xcc, 0x85, 0x97, 0x00, 0x4a, 0x0b, 0x01, 0xcc, 0x93, 0x8b,
+    0x00, 0x49, 0xfa, 0x01, 0xcc, 0x9e, 0xc9, 0x90, 0x2b, 0x05, 0x47, 0xc9,
+    0xcb, 0x20, 0x54, 0x00, 0x4a, 0x98, 0xd0, 0x4f, 0x8d, 0x00, 0x4b, 0x81,
+    0xcb, 0x87, 0x25, 0x00, 0x4a, 0xa0, 0xc4, 0x19, 0xf1, 0x00, 0x4b, 0x21,
+    0xcb, 0x8c, 0xe6, 0x00, 0x4b, 0x29, 0x45, 0x04, 0x9a, 0x41, 0xcc, 0xa2,
+    0xc2, 0x01, 0xa2, 0x00, 0x00, 0x91, 0xc4, 0x03, 0xe0, 0x00, 0x00, 0x98,
+    0x43, 0x01, 0x81, 0xc1, 0xcc, 0xc6, 0xd5, 0x34, 0x90, 0x0d, 0xe3, 0x80,
+    0xc8, 0x03, 0xc1, 0x0d, 0xe4, 0x43, 0x01, 0xcc, 0xf5, 0xc4, 0x54, 0xc6,
+    0x0d, 0xe4, 0x39, 0x0e, 0xc1, 0xcc, 0xfb, 0xc6, 0x00, 0x7c, 0x0d, 0xe4,
+    0x29, 0xc3, 0x01, 0xa5, 0x0d, 0xe4, 0x21, 0xc5, 0x20, 0x53, 0x0d, 0xe4,
+    0x11, 0xcb, 0x8d, 0x3e, 0x0d, 0xe4, 0x09, 0xc5, 0x34, 0xf9, 0x0d, 0xe4,
+    0x00, 0x42, 0x00, 0x51, 0xc1, 0xcd, 0x07, 0xc6, 0xcf, 0x5c, 0x0d, 0xe3,
+    0xd9, 0xc6, 0x92, 0x3f, 0x0d, 0xe3, 0xd1, 0xd4, 0x38, 0xf6, 0x0d, 0xe3,
+    0xb9, 0xc6, 0x28, 0x56, 0x0d, 0xe3, 0xb0, 0xcf, 0x67, 0xfa, 0x0d, 0xe3,
+    0xa1, 0xd1, 0x28, 0x4b, 0x0d, 0xe3, 0x88, 0xc2, 0x00, 0x63, 0x0d, 0xe1,
+    0xd1, 0x8a, 0x0d, 0xe1, 0xc9, 0x91, 0x0d, 0xe2, 0xeb, 0x01, 0xcd, 0x16,
+    0xc2, 0x0a, 0xfd, 0x0d, 0xe2, 0xf9, 0x8b, 0x0d, 0xe2, 0xf1, 0x83, 0x0d,
+    0xe2, 0xe0, 0x01, 0xc1, 0xcd, 0x1a, 0x8a, 0x0d, 0xe0, 0x88, 0x01, 0xc1,
+    0xcd, 0x24, 0x45, 0xdc, 0x42, 0xc1, 0xcd, 0x55, 0xc6, 0xd0, 0x7c, 0x0d,
+    0xe2, 0x48, 0x01, 0x41, 0xcd, 0x71, 0x01, 0xc1, 0xcd, 0x8f, 0x45, 0x41,
+    0xef, 0x41, 0xcd, 0xa0, 0x01, 0x41, 0xcd, 0xb0, 0x8a, 0x0d, 0xe0, 0xc1,
+    0xc2, 0x00, 0x41, 0x0d, 0xe0, 0x81, 0x48, 0xb9, 0x38, 0x41, 0xcd, 0xc1,
+    0x8a, 0x0d, 0xe0, 0xb9, 0x44, 0x01, 0x0a, 0x41, 0xcd, 0xc9, 0x8e, 0x0d,
+    0xe0, 0xb0, 0x8d, 0x0d, 0xe0, 0xa1, 0x01, 0x41, 0xcd, 0xd1, 0x8a, 0x0d,
+    0xe0, 0x99, 0xc2, 0x00, 0x41, 0x0d, 0xe0, 0x68, 0xc2, 0x02, 0x2f, 0x0d,
+    0xe0, 0x70, 0xc2, 0x02, 0x2f, 0x0d, 0xe0, 0x61, 0x47, 0xc9, 0x8b, 0x41,
+    0xcd, 0xdb, 0xc4, 0xe2, 0xac, 0x0d, 0xe1, 0xf0, 0xc8, 0xb7, 0x10, 0x0d,
+    0xe3, 0x50, 0x99, 0x0d, 0xe2, 0x98, 0x97, 0x0d, 0xe2, 0xd9, 0x99, 0x0d,
+    0xe2, 0xd1, 0xc2, 0x31, 0xdb, 0x0d, 0xe2, 0xc9, 0x83, 0x0d, 0xe2, 0x18,
+    0x8a, 0x0d, 0xe2, 0xb9, 0xc2, 0x02, 0x2f, 0x0d, 0xe2, 0xa1, 0x8b, 0x0d,
+    0xe2, 0x50, 0x97, 0x0d, 0xe2, 0x91, 0x87, 0x0d, 0xe2, 0x58, 0x87, 0x0d,
+    0xe2, 0x40, 0xc2, 0x00, 0xd9, 0x0d, 0xe2, 0x28, 0xca, 0xa5, 0x24, 0x01,
+    0x71, 0xb1, 0xcb, 0x98, 0xac, 0x01, 0x71, 0xb8, 0xca, 0xa6, 0x50, 0x0f,
+    0xd2, 0x53, 0x01, 0xcd, 0xe3, 0xc5, 0xb0, 0x06, 0x0f, 0xd0, 0x0b, 0x01,
+    0xcd, 0xe9, 0x0d, 0xc1, 0xcd, 0xef, 0xc6, 0xd1, 0xd8, 0x0f, 0xd0, 0x1b,
+    0x01, 0xce, 0x01, 0xc4, 0xde, 0xd0, 0x0f, 0xd0, 0x13, 0x01, 0xce, 0x07,
+    0xc4, 0xe3, 0x24, 0x0f, 0xd0, 0x2b, 0x01, 0xce, 0x0d, 0x47, 0x46, 0x0d,
+    0x41, 0xce, 0x13, 0x0b, 0xc1, 0xce, 0x2f, 0xca, 0x9a, 0x16, 0x08, 0xa2,
+    0xf0, 0x18, 0xc1, 0xce, 0x3b, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0xa1, 0x15,
+    0xc1, 0xce, 0x47, 0x10, 0xc1, 0xce, 0x57, 0x06, 0xc1, 0xce, 0x6f, 0x16,
+    0xc1, 0xce, 0x7d, 0x0c, 0xc1, 0xce, 0x8b, 0x05, 0xc1, 0xce, 0x95, 0x09,
+    0xc1, 0xce, 0x9f, 0x0d, 0xc1, 0xce, 0xa9, 0x83, 0x08, 0xa0, 0x03, 0x01,
+    0xce, 0xb3, 0x91, 0x08, 0xa0, 0x61, 0x87, 0x08, 0xa0, 0x51, 0x97, 0x08,
+    0xa0, 0x23, 0x01, 0xce, 0xbf, 0x8b, 0x08, 0xa0, 0x13, 0x01, 0xce, 0xc3,
+    0x12, 0xc1, 0xce, 0xc7, 0x04, 0xc1, 0xce, 0xd1, 0x0f, 0xc1, 0xce, 0xdb,
+    0xc2, 0x1a, 0x18, 0x08, 0xa1, 0x59, 0x14, 0xc1, 0xce, 0xe5, 0x0e, 0xc1,
+    0xce, 0xef, 0xc2, 0x00, 0x71, 0x08, 0xa1, 0x80, 0x46, 0x03, 0x7b, 0xc1,
+    0xce, 0xf9, 0x45, 0x04, 0x9a, 0xc1, 0xcf, 0x05, 0xc4, 0x19, 0xf1, 0x08,
+    0xa2, 0x58, 0x03, 0xc1, 0xcf, 0x29, 0x91, 0x08, 0xa2, 0x01, 0x87, 0x08,
+    0xa1, 0xf1, 0x48, 0xaa, 0xd2, 0xc1, 0xcf, 0x35, 0x97, 0x08, 0xa1, 0xc3,
+    0x01, 0xcf, 0x43, 0x8b, 0x08, 0xa1, 0xb2, 0x01, 0xcf, 0x47, 0xc8, 0xba,
+    0xb8, 0x00, 0xce, 0xf3, 0x01, 0xcf, 0x4b, 0x16, 0xc1, 0xcf, 0x4f, 0x46,
+    0x04, 0x99, 0xc1, 0xcf, 0x5b, 0x47, 0x01, 0x92, 0xc1, 0xcf, 0x7f, 0x4b,
+    0x6e, 0xbb, 0x41, 0xcf, 0x91, 0xc9, 0xaf, 0x0a, 0x0f, 0x98, 0xd1, 0xc6,
+    0x07, 0xf3, 0x0f, 0x98, 0x88, 0xca, 0xa6, 0x3c, 0x01, 0x3a, 0x71, 0xc2,
+    0x17, 0xce, 0x0f, 0x8c, 0x79, 0xc2, 0x00, 0x03, 0x0f, 0x8c, 0x71, 0xc2,
+    0x0d, 0x01, 0x0f, 0x8c, 0x69, 0xc2, 0x04, 0xf2, 0x0f, 0x8c, 0x61, 0xc2,
+    0x01, 0x8f, 0x0f, 0x8c, 0x59, 0x55, 0x09, 0x33, 0xc1, 0xcf, 0xb1, 0xcd,
+    0x30, 0xea, 0x0f, 0xde, 0x20, 0xca, 0xa7, 0x18, 0x01, 0x27, 0xf9, 0x47,
+    0x37, 0xb8, 0xc1, 0xd0, 0x19, 0x55, 0x09, 0x33, 0xc1, 0xd0, 0x2f, 0xc8,
+    0x00, 0xc1, 0x0f, 0xbe, 0xb1, 0xc6, 0x09, 0x2b, 0x0f, 0xbe, 0xc0, 0xc5,
+    0x0d, 0x22, 0x0f, 0xdd, 0xe9, 0xdc, 0x0a, 0x4d, 0x0f, 0xdd, 0xf1, 0xc7,
+    0x3f, 0x57, 0x0f, 0xdd, 0xf8, 0xd6, 0x2f, 0xa0, 0x01, 0x14, 0x49, 0xd4,
+    0x38, 0x56, 0x01, 0x14, 0x40, 0xe0, 0x0b, 0x09, 0x01, 0x12, 0x38, 0xca,
+    0x34, 0x32, 0x01, 0x13, 0xa9, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x88, 0xca,
+    0x34, 0x32, 0x01, 0x13, 0xa1, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x80, 0xcf,
+    0x60, 0x4d, 0x08, 0xcf, 0x21, 0x03, 0xc1, 0xd0, 0x97, 0x91, 0x08, 0xce,
+    0xe1, 0x87, 0x08, 0xce, 0xd1, 0xc9, 0xaa, 0xd2, 0x08, 0xce, 0xb3, 0x01,
+    0xd0, 0xa3, 0x97, 0x08, 0xce, 0xa3, 0x01, 0xd0, 0xa7, 0x8b, 0x08, 0xce,
+    0x92, 0x01, 0xd0, 0xab, 0xc7, 0xc8, 0xf1, 0x08, 0xcf, 0x11, 0x03, 0xc1,
+    0xd0, 0xaf, 0x42, 0x06, 0xb4, 0x41, 0xd0, 0xbb, 0x14, 0xc1, 0xd0, 0xc7,
+    0x0e, 0xc1, 0xd0, 0xd1, 0xc2, 0x00, 0xce, 0x08, 0xce, 0x71, 0x15, 0xc1,
+    0xd0, 0xdb, 0x18, 0xc1, 0xd0, 0xeb, 0xc2, 0x1a, 0x18, 0x08, 0xce, 0x39,
+    0xc2, 0x00, 0xb6, 0x08, 0xce, 0x31, 0x04, 0xc1, 0xd0, 0xf8, 0x12, 0xc1,
+    0xd1, 0x02, 0x10, 0xc1, 0xd1, 0x0c, 0x06, 0xc1, 0xd1, 0x22, 0x16, 0xc1,
+    0xd1, 0x30, 0x0c, 0xc1, 0xd1, 0x3e, 0x05, 0xc1, 0xd1, 0x48, 0x09, 0xc1,
+    0xd1, 0x52, 0x0d, 0xc1, 0xd1, 0x5c, 0x83, 0x08, 0xcd, 0x03, 0x01, 0xd1,
+    0x66, 0x91, 0x08, 0xcd, 0x61, 0x87, 0x08, 0xcd, 0x51, 0x97, 0x08, 0xcd,
+    0x23, 0x01, 0xd1, 0x72, 0x8b, 0x08, 0xcd, 0x12, 0x01, 0xd1, 0x76, 0xc3,
+    0x05, 0x16, 0x08, 0x45, 0x3b, 0x01, 0xd1, 0x7a, 0x16, 0xc1, 0xd1, 0x80,
+    0x08, 0x41, 0xd1, 0x90, 0x16, 0xc1, 0xd1, 0x9c, 0x15, 0xc1, 0xd1, 0xa8,
+    0x46, 0x28, 0x97, 0xc1, 0xd1, 0xb2, 0xc4, 0x5a, 0xd2, 0x08, 0x44, 0xd9,
+    0xc4, 0xb5, 0x0c, 0x08, 0x44, 0xd1, 0xc2, 0x00, 0x78, 0x08, 0x44, 0xc1,
+    0x03, 0xc1, 0xd1, 0xe8, 0xc3, 0x20, 0xb0, 0x08, 0x44, 0xa9, 0xc3, 0x03,
+    0xb0, 0x08, 0x44, 0x99, 0xc6, 0xd0, 0xf4, 0x08, 0x44, 0x89, 0xc4, 0xe0,
+    0x58, 0x08, 0x44, 0x79, 0xc4, 0x4e, 0x09, 0x08, 0x44, 0x69, 0xc2, 0x00,
+    0x61, 0x08, 0x44, 0x3b, 0x01, 0xd1, 0xf4, 0xc5, 0x4e, 0x03, 0x08, 0x44,
+    0x49, 0xc3, 0x76, 0xe6, 0x08, 0x44, 0x41, 0xc6, 0x46, 0x53, 0x08, 0x44,
+    0x29, 0xc5, 0x9b, 0xd8, 0x08, 0x44, 0x21, 0xc4, 0xe0, 0x9c, 0x08, 0x44,
+    0x18, 0x45, 0x1d, 0xe4, 0xc1, 0xd1, 0xfa, 0x45, 0x17, 0xe0, 0xc1, 0xd2,
+    0x25, 0x46, 0x04, 0x93, 0x41, 0xd2, 0x50, 0xde, 0x0e, 0xca, 0x0f, 0xaa,
+    0x19, 0x4a, 0x09, 0xc9, 0x41, 0xd2, 0x68, 0xe0, 0x09, 0x09, 0x01, 0x3d,
+    0x88, 0xcc, 0x24, 0x61, 0x01, 0x17, 0x60, 0x46, 0x1f, 0xa2, 0xc1, 0xd2,
+    0x6e, 0xc3, 0x00, 0x8e, 0x00, 0x05, 0x60, 0xc3, 0x33, 0x2c, 0x01, 0x15,
+    0x69, 0xc4, 0x20, 0x42, 0x01, 0x12, 0x08, 0x43, 0x02, 0x0a, 0xc1, 0xd2,
+    0x7a, 0xce, 0x66, 0x0c, 0x01, 0x12, 0x49, 0xd6, 0x2d, 0x0c, 0x01, 0x12,
+    0x21, 0xcc, 0x82, 0x80, 0x01, 0x10, 0x48, 0xca, 0x34, 0x32, 0x01, 0x13,
+    0x69, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x00, 0x86, 0x0f, 0xae, 0x51, 0xc2,
+    0x01, 0x3d, 0x0f, 0xae, 0x48, 0xd6, 0x31, 0x00, 0x0f, 0xa6, 0xa0, 0x87,
+    0x0f, 0x09, 0x58, 0x91, 0x0f, 0x09, 0x48, 0x83, 0x0f, 0x09, 0x28, 0xc2,
+    0x00, 0x3b, 0x0f, 0x09, 0x19, 0x83, 0x0f, 0x08, 0xb0, 0xc2, 0x00, 0x89,
+    0x0f, 0x09, 0x09, 0x83, 0x0f, 0x08, 0xd0, 0xc2, 0x00, 0x89, 0x0f, 0x09,
+    0x01, 0x83, 0x0f, 0x08, 0x00, 0x8a, 0x0f, 0x08, 0xf8, 0x12, 0xc1, 0xd2,
+    0x86, 0xc2, 0x0f, 0xba, 0x0f, 0x08, 0xc9, 0x16, 0xc1, 0xd2, 0x90, 0xc2,
+    0x00, 0x3b, 0x0f, 0x08, 0x89, 0xc2, 0x1a, 0x18, 0x0f, 0x08, 0x81, 0xc2,
+    0x03, 0xc6, 0x0f, 0x08, 0x61, 0xc2, 0x02, 0x4d, 0x0f, 0x08, 0x39, 0x83,
+    0x0f, 0x08, 0x28, 0xc2, 0x00, 0x89, 0x0f, 0x08, 0xe9, 0x83, 0x0f, 0x08,
+    0x78, 0xc2, 0x1a, 0x18, 0x0f, 0x08, 0xd9, 0x83, 0x0f, 0x08, 0x30, 0xc2,
+    0x66, 0x73, 0x0f, 0x08, 0xa1, 0x83, 0x0f, 0x08, 0x19, 0xc2, 0x0d, 0x01,
+    0x0f, 0x08, 0x08, 0xcc, 0x83, 0xe8, 0x0f, 0x09, 0xd9, 0xc6, 0xb4, 0xf5,
+    0x0f, 0x09, 0xd1, 0xc8, 0x77, 0x75, 0x0f, 0x09, 0xc9, 0xc5, 0x9b, 0x40,
+    0x0f, 0x09, 0xc1, 0xc6, 0x17, 0x4c, 0x0f, 0x09, 0xb8, 0x42, 0x00, 0x2b,
+    0xc1, 0xd2, 0xa0, 0xd1, 0x4f, 0xe1, 0x01, 0x24, 0xa1, 0xcc, 0x48, 0x07,
+    0x01, 0x24, 0x88, 0xd1, 0x55, 0x53, 0x01, 0x24, 0xc9, 0xcf, 0x65, 0x84,
+    0x01, 0x24, 0x90, 0xd2, 0x49, 0xb1, 0x01, 0x24, 0xc1, 0x0b, 0x41, 0xd2,
+    0xac, 0xd0, 0x58, 0xf2, 0x01, 0x24, 0xb1, 0xd1, 0x52, 0x9a, 0x01, 0x24,
+    0xa8, 0xc4, 0x17, 0xf7, 0x00, 0x3e, 0x39, 0xc2, 0x24, 0x36, 0x00, 0x3e,
+    0x30, 0xc3, 0x0c, 0xf7, 0x00, 0x3e, 0x29, 0xc3, 0x04, 0xa0, 0x00, 0x3e,
+    0x20, 0xc4, 0x03, 0xe0, 0x00, 0x3e, 0x19, 0xc2, 0x01, 0xa2, 0x00, 0x3e,
+    0x10, 0x44, 0xe1, 0x94, 0xc1, 0xd2, 0xb8, 0x83, 0x00, 0x3e, 0xb0, 0xc2,
+    0x1a, 0x18, 0x00, 0x3f, 0x13, 0x01, 0xd2, 0xca, 0x83, 0x00, 0x3f, 0x1a,
+    0x01, 0xd2, 0xd0, 0xc2, 0x00, 0x3b, 0x00, 0x3e, 0xd1, 0x83, 0x00, 0x3e,
+    0xc8, 0xc8, 0xbc, 0x48, 0x00, 0x3e, 0x88, 0x91, 0x00, 0x3e, 0x78, 0x87,
+    0x00, 0x3e, 0x58, 0xcb, 0x57, 0x62, 0x00, 0x3f, 0x89, 0xc8, 0xa9, 0x1a,
+    0x00, 0x3f, 0x81, 0xc9, 0x3c, 0x7a, 0x00, 0x3f, 0x79, 0xcf, 0x61, 0xe2,
+    0x00, 0x3f, 0x70, 0xcb, 0x57, 0x62, 0x00, 0x3f, 0x69, 0xc8, 0xa9, 0x1a,
+    0x00, 0x3f, 0x61, 0xc9, 0x3c, 0x7a, 0x00, 0x3f, 0x58, 0x46, 0x00, 0x91,
+    0x41, 0xd2, 0xd6, 0x95, 0x0f, 0xae, 0x68, 0xc3, 0x22, 0xe9, 0x0f, 0xae,
+    0x2b, 0x01, 0xd2, 0xee, 0xc3, 0x17, 0xe1, 0x0f, 0xd5, 0xc8, 0xc5, 0x12,
+    0x14, 0x01, 0x1e, 0xd1, 0x45, 0xdc, 0x3d, 0x41, 0xd2, 0xf4, 0xc4, 0x9d,
+    0x0a, 0x0f, 0x99, 0xf1, 0xc5, 0xdb, 0xc0, 0x0f, 0x99, 0xe8, 0x22, 0xc1,
+    0xd2, 0xfe, 0x21, 0xc1, 0xd3, 0x21, 0x20, 0xc1, 0xd3, 0x4f, 0x1f, 0x41,
+    0xd3, 0x7d, 0xa8, 0x09, 0x82, 0xc9, 0xa7, 0x09, 0x82, 0xc1, 0xa6, 0x09,
+    0x82, 0xb9, 0xa5, 0x09, 0x82, 0xb1, 0xa4, 0x09, 0x82, 0xa3, 0x01, 0xd3,
+    0xa7, 0xa3, 0x09, 0x82, 0x99, 0xa2, 0x09, 0x82, 0x91, 0xa1, 0x09, 0x82,
+    0x89, 0xa0, 0x09, 0x82, 0x80, 0x24, 0xc1, 0xd3, 0xab, 0x23, 0xc1, 0xd3,
+    0xb6, 0x22, 0xc1, 0xd3, 0xde, 0x21, 0xc1, 0xd4, 0x0f, 0x20, 0xc1, 0xd4,
+    0x43, 0x1f, 0x41, 0xd4, 0x71, 0x47, 0x0b, 0xfc, 0xc1, 0xd4, 0x9e, 0x44,
+    0x06, 0xa9, 0x41, 0xd4, 0xaa, 0x20, 0xc1, 0xd4, 0xb6, 0x1f, 0x41, 0xd4,
+    0xd4, 0xa7, 0x09, 0x8c, 0x39, 0xa6, 0x09, 0x8c, 0x31, 0xa5, 0x09, 0x8c,
+    0x23, 0x01, 0xd4, 0xfe, 0xa4, 0x09, 0x8c, 0x19, 0xa3, 0x09, 0x8c, 0x11,
+    0xa2, 0x09, 0x8c, 0x09, 0xa1, 0x09, 0x8c, 0x01, 0xa0, 0x09, 0x8b, 0xf8,
+    0xc2, 0xe6, 0x2c, 0x09, 0x9d, 0x6b, 0x01, 0xd5, 0x02, 0x22, 0xc1, 0xd5,
+    0x06, 0x21, 0xc1, 0xd5, 0x3a, 0x20, 0xc1, 0xd5, 0x6e, 0x1f, 0x41, 0xd5,
+    0x9c, 0x22, 0xc1, 0xd5, 0xc9, 0x21, 0xc1, 0xd5, 0xd5, 0x20, 0xc1, 0xd5,
+    0xfd, 0x1f, 0x41, 0xd6, 0x25, 0xc2, 0xe4, 0x9a, 0x09, 0x82, 0x79, 0x25,
+    0xc1, 0xd6, 0x4c, 0x24, 0xc1, 0xd6, 0x74, 0x23, 0xc1, 0xd6, 0x9c, 0x22,
+    0xc1, 0xd6, 0xd0, 0x21, 0xc1, 0xd6, 0xfb, 0x20, 0xc1, 0xd7, 0x23, 0x1f,
+    0x41, 0xd7, 0x51, 0xa5, 0x09, 0xa0, 0x23, 0x01, 0xd7, 0x7b, 0xa4, 0x09,
+    0x9f, 0xd3, 0x01, 0xd7, 0x9b, 0xa3, 0x09, 0x9f, 0xc9, 0xa2, 0x09, 0x9f,
+    0xc1, 0xa1, 0x09, 0x9f, 0xb9, 0xa0, 0x09, 0x9f, 0xb1, 0x9f, 0x09, 0x9f,
+    0xa8, 0xa8, 0x09, 0x9f, 0xa1, 0xa7, 0x09, 0x9f, 0x99, 0xa6, 0x09, 0x9f,
+    0x91, 0xa5, 0x09, 0x9f, 0x89, 0xa4, 0x09, 0x9f, 0x7b, 0x01, 0xd7, 0xbf,
+    0xa3, 0x09, 0x9f, 0x6b, 0x01, 0xd7, 0xc3, 0xa2, 0x09, 0x9f, 0x53, 0x01,
+    0xd7, 0xc7, 0xa1, 0x09, 0x9f, 0x2b, 0x01, 0xd7, 0xcf, 0xa0, 0x09, 0x9f,
+    0x20, 0x83, 0x09, 0x9e, 0xe0, 0x83, 0x09, 0x9e, 0xd0, 0x83, 0x09, 0x9e,
+    0xb8, 0x84, 0x09, 0x9e, 0xa1, 0x83, 0x09, 0x9e, 0x98, 0xa4, 0x09, 0x9e,
+    0x71, 0xa3, 0x09, 0x9e, 0x63, 0x01, 0xd7, 0xdf, 0xa2, 0x09, 0x9e, 0x59,
+    0xa1, 0x09, 0x9e, 0x51, 0xa0, 0x09, 0x9e, 0x49, 0x9f, 0x09, 0x9e, 0x40,
+    0xa8, 0x09, 0x9e, 0x39, 0xa7, 0x09, 0x9e, 0x2b, 0x01, 0xd7, 0xe3, 0xa6,
+    0x09, 0x9e, 0x1b, 0x01, 0xd7, 0xe7, 0xa5, 0x09, 0x9e, 0x11, 0xa4, 0x09,
+    0x9e, 0x09, 0xa3, 0x09, 0x9d, 0xfb, 0x01, 0xd7, 0xeb, 0xa2, 0x09, 0x9d,
+    0xf1, 0xa1, 0x09, 0x9d, 0xe9, 0xa0, 0x09, 0x9d, 0xe1, 0x9f, 0x09, 0x9d,
+    0xd2, 0x01, 0xd7, 0xef, 0xa8, 0x09, 0x9d, 0xc3, 0x01, 0xd7, 0xf3, 0xa7,
+    0x09, 0x9d, 0xb9, 0xa6, 0x09, 0x9d, 0xb1, 0xa5, 0x09, 0x9d, 0xa9, 0xa4,
+    0x09, 0x9d, 0xa1, 0xa3, 0x09, 0x9d, 0x99, 0xa2, 0x09, 0x9d, 0x8b, 0x01,
+    0xd7, 0xf7, 0xa1, 0x09, 0x9d, 0x81, 0xa0, 0x09, 0x9d, 0x78, 0xa1, 0x09,
+    0x9b, 0x09, 0xa0, 0x09, 0x9b, 0x01, 0x9f, 0x09, 0x9a, 0xf8, 0xa8, 0x09,
+    0x9a, 0xf1, 0xa7, 0x09, 0x9a, 0xe9, 0xa6, 0x09, 0x9a, 0xe1, 0xa5, 0x09,
+    0x9a, 0xd9, 0xa4, 0x09, 0x9a, 0xd1, 0xa3, 0x09, 0x9a, 0xc9, 0xa2, 0x09,
+    0x9a, 0xc1, 0xa1, 0x09, 0x9a, 0xb3, 0x01, 0xd7, 0xfb, 0xa0, 0x09, 0x9a,
+    0xa9, 0x9f, 0x09, 0x9a, 0xa0, 0xa8, 0x09, 0x9a, 0x93, 0x01, 0xd7, 0xff,
+    0xa7, 0x09, 0x9a, 0x89, 0xa6, 0x09, 0x9a, 0x81, 0xa5, 0x09, 0x9a, 0x79,
+    0xa4, 0x09, 0x9a, 0x71, 0xa3, 0x09, 0x9a, 0x69, 0xa2, 0x09, 0x9a, 0x5b,
+    0x01, 0xd8, 0x03, 0xa1, 0x09, 0x9a, 0x51, 0xa0, 0x09, 0x9a, 0x49, 0x9f,
+    0x09, 0x9a, 0x40, 0xa8, 0x09, 0x9a, 0x39, 0xa7, 0x09, 0x9a, 0x31, 0xa6,
+    0x09, 0x9a, 0x29, 0xa5, 0x09, 0x9a, 0x21, 0xa4, 0x09, 0x9a, 0x19, 0xa3,
+    0x09, 0x9a, 0x11, 0xa2, 0x09, 0x9a, 0x09, 0xa1, 0x09, 0x9a, 0x01, 0xa0,
+    0x09, 0x99, 0xf9, 0x9f, 0x09, 0x99, 0xf0, 0xa8, 0x09, 0x99, 0xe9, 0xa7,
+    0x09, 0x99, 0xe1, 0xa6, 0x09, 0x99, 0xd9, 0xa5, 0x09, 0x99, 0xc3, 0x01,
+    0xd8, 0x07, 0xa4, 0x09, 0x99, 0xb9, 0xa3, 0x09, 0x99, 0xb1, 0xa2, 0x09,
+    0x99, 0xa9, 0xa1, 0x09, 0x99, 0xa1, 0xa0, 0x09, 0x99, 0x98, 0xa5, 0x09,
+    0x99, 0x91, 0xa4, 0x09, 0x99, 0x89, 0xa3, 0x09, 0x99, 0x81, 0xa2, 0x09,
+    0x99, 0x73, 0x01, 0xd8, 0x0f, 0xa1, 0x09, 0x99, 0x63, 0x01, 0xd8, 0x13,
+    0xa0, 0x09, 0x99, 0x59, 0x9f, 0x09, 0x99, 0x50, 0xa8, 0x09, 0x99, 0x49,
+    0xa7, 0x09, 0x99, 0x41, 0xa6, 0x09, 0x99, 0x39, 0xa5, 0x09, 0x99, 0x31,
+    0xa4, 0x09, 0x99, 0x29, 0xa3, 0x09, 0x99, 0x21, 0xa2, 0x09, 0x99, 0x19,
+    0xa1, 0x09, 0x99, 0x11, 0xa0, 0x09, 0x99, 0x09, 0x9f, 0x09, 0x99, 0x00,
+    0xa8, 0x09, 0x98, 0xf9, 0xa7, 0x09, 0x98, 0xf1, 0xa6, 0x09, 0x98, 0xe9,
+    0xa5, 0x09, 0x98, 0xdb, 0x01, 0xd8, 0x17, 0xa4, 0x09, 0x98, 0xd1, 0xa3,
+    0x09, 0x98, 0xc9, 0xa2, 0x09, 0x98, 0xc1, 0xa1, 0x09, 0x98, 0xb9, 0xa0,
+    0x09, 0x98, 0xab, 0x01, 0xd8, 0x1b, 0x9f, 0x09, 0x98, 0xa0, 0xa8, 0x09,
+    0x98, 0x93, 0x01, 0xd8, 0x1f, 0xa7, 0x09, 0x98, 0x83, 0x01, 0xd8, 0x23,
+    0xa6, 0x09, 0x98, 0x73, 0x01, 0xd8, 0x27, 0xa5, 0x09, 0x98, 0x69, 0xa4,
+    0x09, 0x98, 0x61, 0xa3, 0x09, 0x98, 0x59, 0xa2, 0x09, 0x98, 0x4b, 0x01,
+    0xd8, 0x2b, 0xa1, 0x09, 0x98, 0x41, 0xa0, 0x09, 0x98, 0x38, 0xa5, 0x09,
+    0x98, 0x31, 0xa4, 0x09, 0x98, 0x29, 0xa3, 0x09, 0x98, 0x21, 0xa2, 0x09,
+    0x98, 0x19, 0xa1, 0x09, 0x98, 0x11, 0xa0, 0x09, 0x98, 0x09, 0x9f, 0x09,
+    0x98, 0x00, 0xa8, 0x09, 0x97, 0xf9, 0xa7, 0x09, 0x97, 0xf1, 0xa6, 0x09,
+    0x97, 0xe9, 0xa5, 0x09, 0x97, 0xe1, 0xa4, 0x09, 0x97, 0xd3, 0x01, 0xd8,
+    0x2f, 0xa3, 0x09, 0x97, 0xc9, 0xa2, 0x09, 0x97, 0xc1, 0xa1, 0x09, 0x97,
+    0xb9, 0xa0, 0x09, 0x97, 0xb1, 0x9f, 0x09, 0x97, 0xa8, 0xa8, 0x09, 0x97,
+    0xa1, 0xa7, 0x09, 0x97, 0x99, 0xa6, 0x09, 0x97, 0x91, 0xa5, 0x09, 0x97,
+    0x7b, 0x01, 0xd8, 0x33, 0xa4, 0x09, 0x97, 0x71, 0xa3, 0x09, 0x97, 0x69,
+    0xa2, 0x09, 0x97, 0x61, 0xa1, 0x09, 0x97, 0x59, 0xa0, 0x09, 0x97, 0x51,
+    0x9f, 0x09, 0x97, 0x48, 0xa8, 0x09, 0x97, 0x41, 0xa7, 0x09, 0x97, 0x39,
+    0xa6, 0x09, 0x97, 0x2b, 0x01, 0xd8, 0x3b, 0xa5, 0x09, 0x97, 0x21, 0xa4,
+    0x09, 0x97, 0x19, 0xa3, 0x09, 0x97, 0x03, 0x01, 0xd8, 0x3f, 0xa2, 0x09,
+    0x96, 0xf9, 0xa1, 0x09, 0x96, 0xf1, 0xa0, 0x09, 0x96, 0xe9, 0x9f, 0x09,
+    0x96, 0xe0, 0xa8, 0x09, 0x96, 0xd9, 0xa7, 0x09, 0x96, 0xd1, 0xa6, 0x09,
+    0x96, 0xc9, 0xa5, 0x09, 0x96, 0xbb, 0x01, 0xd8, 0x47, 0xa4, 0x09, 0x96,
+    0xb1, 0xa3, 0x09, 0x96, 0xa9, 0xa2, 0x09, 0x96, 0xa1, 0xa1, 0x09, 0x96,
+    0x93, 0x01, 0xd8, 0x4b, 0xa0, 0x09, 0x96, 0x88, 0xa8, 0x09, 0x96, 0x81,
+    0xa7, 0x09, 0x96, 0x79, 0xa6, 0x09, 0x96, 0x71, 0xa5, 0x09, 0x96, 0x69,
+    0xa4, 0x09, 0x96, 0x61, 0xa3, 0x09, 0x96, 0x59, 0xa2, 0x09, 0x96, 0x51,
+    0xa1, 0x09, 0x96, 0x49, 0xa0, 0x09, 0x96, 0x41, 0x9f, 0x09, 0x96, 0x38,
+    0xa8, 0x09, 0x96, 0x31, 0xa7, 0x09, 0x96, 0x29, 0xa6, 0x09, 0x96, 0x21,
+    0xa5, 0x09, 0x96, 0x13, 0x01, 0xd8, 0x4f, 0xa4, 0x09, 0x96, 0x09, 0xa3,
+    0x09, 0x96, 0x01, 0xa2, 0x09, 0x95, 0xf9, 0xa1, 0x09, 0x95, 0xf1, 0xa0,
+    0x09, 0x95, 0xe9, 0x9f, 0x09, 0x95, 0xda, 0x01, 0xd8, 0x53, 0xa8, 0x09,
+    0x95, 0xd1, 0xa7, 0x09, 0x95, 0xc9, 0xa6, 0x09, 0x95, 0xc1, 0xa5, 0x09,
+    0x95, 0xb9, 0xa4, 0x09, 0x95, 0xb1, 0xa3, 0x09, 0x95, 0xa9, 0xa2, 0x09,
+    0x95, 0x93, 0x01, 0xd8, 0x57, 0xa1, 0x09, 0x95, 0x83, 0x01, 0xd8, 0x5f,
+    0xa0, 0x09, 0x95, 0x78, 0xa0, 0x09, 0x95, 0x39, 0x9f, 0x09, 0x95, 0x30,
+    0xa8, 0x09, 0x95, 0x29, 0xa7, 0x09, 0x95, 0x21, 0xa6, 0x09, 0x95, 0x19,
+    0xa5, 0x09, 0x95, 0x11, 0xa4, 0x09, 0x95, 0x09, 0xa3, 0x09, 0x95, 0x01,
+    0xa2, 0x09, 0x94, 0xf3, 0x01, 0xd8, 0x63, 0xa1, 0x09, 0x94, 0xe9, 0xa0,
+    0x09, 0x94, 0xda, 0x01, 0xd8, 0x67, 0x21, 0xc1, 0xd8, 0x6b, 0x20, 0xc1,
+    0xd8, 0x7a, 0x1f, 0x41, 0xd8, 0xab, 0xc2, 0xda, 0x42, 0x09, 0x91, 0xa9,
+    0x20, 0xc1, 0xd8, 0xcf, 0x1f, 0x41, 0xd8, 0xfa, 0x23, 0xc1, 0xd9, 0x21,
+    0x22, 0xc1, 0xd9, 0x2d, 0x21, 0xc1, 0xd9, 0x61, 0x20, 0xc1, 0xd9, 0x8c,
+    0x1f, 0x41, 0xd9, 0xb7, 0xa3, 0x09, 0x8f, 0x71, 0xa2, 0x09, 0x8f, 0x69,
+    0xa1, 0x09, 0x8f, 0x61, 0xa0, 0x09, 0x8f, 0x59, 0x9f, 0x09, 0x8f, 0x4a,
+    0x01, 0xd9, 0xdb, 0xa8, 0x09, 0x8f, 0x41, 0xa7, 0x09, 0x8f, 0x39, 0xa6,
+    0x09, 0x8f, 0x31, 0xa5, 0x09, 0x8f, 0x29, 0xa4, 0x09, 0x8f, 0x21, 0xa3,
+    0x09, 0x8f, 0x19, 0xa2, 0x09, 0x8f, 0x03, 0x01, 0xd9, 0xdf, 0xa1, 0x09,
+    0x8e, 0xf9, 0xa0, 0x09, 0x8e, 0xeb, 0x01, 0xd9, 0xe7, 0x9f, 0x09, 0x8e,
+    0xe0, 0xa8, 0x09, 0x8e, 0xd9, 0xa7, 0x09, 0x8e, 0xcb, 0x01, 0xd9, 0xeb,
+    0xa6, 0x09, 0x8e, 0xc1, 0xa5, 0x09, 0x8e, 0xb9, 0xa4, 0x09, 0x8e, 0xb1,
+    0xa3, 0x09, 0x8e, 0xa3, 0x01, 0xd9, 0xef, 0xa2, 0x09, 0x8e, 0x99, 0xa1,
+    0x09, 0x8e, 0x8b, 0x01, 0xd9, 0xf3, 0xa0, 0x09, 0x8e, 0x81, 0x9f, 0x09,
+    0x8e, 0x78, 0xa8, 0x09, 0x8e, 0x71, 0xa7, 0x09, 0x8e, 0x69, 0xa6, 0x09,
+    0x8e, 0x5b, 0x01, 0xd9, 0xf7, 0xa5, 0x09, 0x8e, 0x4b, 0x01, 0xd9, 0xfb,
+    0xa4, 0x09, 0x8e, 0x3b, 0x01, 0xd9, 0xff, 0xa3, 0x09, 0x8e, 0x31, 0xa2,
+    0x09, 0x8e, 0x29, 0xa1, 0x09, 0x8d, 0xe3, 0x01, 0xda, 0x03, 0xa0, 0x09,
+    0x8d, 0xd9, 0x9f, 0x09, 0x8d, 0xca, 0x01, 0xda, 0x23, 0xa8, 0x09, 0x8d,
+    0xc1, 0xa7, 0x09, 0x8d, 0xb9, 0xa6, 0x09, 0x8d, 0xb1, 0xa5, 0x09, 0x8d,
+    0xa9, 0xa4, 0x09, 0x8d, 0xa1, 0xa3, 0x09, 0x8d, 0x99, 0xa2, 0x09, 0x8d,
+    0x8b, 0x01, 0xda, 0x27, 0xa1, 0x09, 0x8d, 0x81, 0xa0, 0x09, 0x8d, 0x6a,
+    0x01, 0xda, 0x2b, 0x83, 0x09, 0x8d, 0x50, 0x83, 0x09, 0x8d, 0x28, 0xa3,
+    0x09, 0x8b, 0xf1, 0xa2, 0x09, 0x8b, 0xe9, 0xa1, 0x09, 0x8b, 0xe1, 0xa0,
+    0x09, 0x8b, 0xd9, 0x9f, 0x09, 0x8b, 0xd0, 0xa8, 0x09, 0x8b, 0xc9, 0xa7,
+    0x09, 0x8b, 0xc1, 0xa6, 0x09, 0x8b, 0xb9, 0xa5, 0x09, 0x8b, 0xb1, 0xa4,
+    0x09, 0x8b, 0xa3, 0x01, 0xda, 0x33, 0xa3, 0x09, 0x8b, 0x99, 0xa2, 0x09,
+    0x8b, 0x8b, 0x01, 0xda, 0x37, 0xa1, 0x09, 0x8b, 0x81, 0xa0, 0x09, 0x8b,
+    0x79, 0x9f, 0x09, 0x8b, 0x70, 0xa8, 0x09, 0x8b, 0x69, 0xa7, 0x09, 0x8b,
+    0x61, 0xa6, 0x09, 0x8b, 0x53, 0x01, 0xda, 0x3b, 0xa5, 0x09, 0x8b, 0x43,
+    0x01, 0xda, 0x3f, 0xa4, 0x09, 0x8b, 0x39, 0xa3, 0x09, 0x8b, 0x31, 0xa2,
+    0x09, 0x8b, 0x29, 0xa1, 0x09, 0x8b, 0x21, 0xa0, 0x09, 0x8b, 0x19, 0x9f,
+    0x09, 0x8b, 0x10, 0xa8, 0x09, 0x8b, 0x09, 0xa7, 0x09, 0x8b, 0x01, 0xa6,
+    0x09, 0x8a, 0xf9, 0xa5, 0x09, 0x8a, 0xeb, 0x01, 0xda, 0x43, 0xa4, 0x09,
+    0x8a, 0xe1, 0xa3, 0x09, 0x8a, 0xd9, 0xa2, 0x09, 0x8a, 0xd1, 0xa1, 0x09,
+    0x8a, 0xc9, 0xa0, 0x09, 0x8a, 0xc1, 0x9f, 0x09, 0x8a, 0xb2, 0x01, 0xda,
+    0x47, 0xa8, 0x09, 0x8a, 0xa9, 0xa7, 0x09, 0x8a, 0xa1, 0xa6, 0x09, 0x8a,
+    0x99, 0xa5, 0x09, 0x8a, 0x91, 0xa4, 0x09, 0x8a, 0x89, 0xa3, 0x09, 0x8a,
+    0x81, 0xa2, 0x09, 0x8a, 0x79, 0xa1, 0x09, 0x8a, 0x71, 0xa0, 0x09, 0x8a,
+    0x63, 0x01, 0xda, 0x4b, 0x9f, 0x09, 0x8a, 0x58, 0xa8, 0x09, 0x8a, 0x51,
+    0xa7, 0x09, 0x8a, 0x49, 0xa6, 0x09, 0x8a, 0x33, 0x01, 0xda, 0x4f, 0xa5,
+    0x09, 0x8a, 0x23, 0x01, 0xda, 0x57, 0xa4, 0x09, 0x8a, 0x19, 0xa3, 0x09,
+    0x8a, 0x11, 0xa2, 0x09, 0x8a, 0x09, 0xa1, 0x09, 0x8a, 0x01, 0xa0, 0x09,
+    0x89, 0xf8, 0xa2, 0x09, 0x89, 0xf1, 0xa1, 0x09, 0x89, 0xe9, 0xa0, 0x09,
+    0x89, 0xcb, 0x01, 0xda, 0x5b, 0x9f, 0x09, 0x89, 0xc0, 0xa8, 0x09, 0x89,
+    0xb9, 0xa7, 0x09, 0x89, 0xb1, 0xa6, 0x09, 0x89, 0xa3, 0x01, 0xda, 0x67,
+    0xa5, 0x09, 0x89, 0x93, 0x01, 0xda, 0x6b, 0xa4, 0x09, 0x89, 0x83, 0x01,
+    0xda, 0x6f, 0xa3, 0x09, 0x89, 0x79, 0xa2, 0x09, 0x89, 0x71, 0xa1, 0x09,
+    0x89, 0x69, 0xa0, 0x09, 0x89, 0x61, 0x9f, 0x09, 0x89, 0x58, 0xa8, 0x09,
+    0x89, 0x51, 0xa7, 0x09, 0x89, 0x43, 0x01, 0xda, 0x73, 0xa6, 0x09, 0x89,
+    0x33, 0x01, 0xda, 0x77, 0xa5, 0x09, 0x89, 0x29, 0xa4, 0x09, 0x89, 0x21,
+    0xa3, 0x09, 0x89, 0x19, 0xa2, 0x09, 0x89, 0x11, 0xa1, 0x09, 0x89, 0x09,
+    0xa0, 0x09, 0x88, 0xfb, 0x01, 0xda, 0x7b, 0x9f, 0x09, 0x88, 0xf0, 0xa8,
+    0x09, 0x88, 0xe9, 0xa7, 0x09, 0x88, 0xe1, 0xa6, 0x09, 0x88, 0xd9, 0xa5,
+    0x09, 0x88, 0xd1, 0xa4, 0x09, 0x88, 0xc9, 0xa3, 0x09, 0x88, 0xc1, 0xa2,
+    0x09, 0x88, 0xb9, 0xa1, 0x09, 0x88, 0xb1, 0xa0, 0x09, 0x88, 0xa3, 0x01,
+    0xda, 0x7f, 0x9f, 0x09, 0x88, 0x98, 0xa8, 0x09, 0x88, 0x91, 0xa7, 0x09,
+    0x88, 0x89, 0xa6, 0x09, 0x88, 0x81, 0xa5, 0x09, 0x88, 0x79, 0xa4, 0x09,
+    0x88, 0x71, 0xa3, 0x09, 0x88, 0x69, 0xa2, 0x09, 0x88, 0x5b, 0x01, 0xda,
+    0x83, 0xa1, 0x09, 0x88, 0x51, 0xa0, 0x09, 0x88, 0x49, 0x9f, 0x09, 0x88,
+    0x40, 0xa8, 0x09, 0x88, 0x39, 0xa7, 0x09, 0x88, 0x31, 0xa6, 0x09, 0x88,
+    0x29, 0xa5, 0x09, 0x88, 0x21, 0xa4, 0x09, 0x88, 0x19, 0xa3, 0x09, 0x88,
+    0x11, 0xa2, 0x09, 0x88, 0x09, 0xa1, 0x09, 0x88, 0x01, 0xa0, 0x09, 0x87,
+    0xf2, 0x01, 0xda, 0x87, 0xa6, 0x09, 0x86, 0x4b, 0x01, 0xda, 0x8b, 0xa5,
+    0x09, 0x86, 0x41, 0xa4, 0x09, 0x86, 0x39, 0xa3, 0x09, 0x86, 0x31, 0xa2,
+    0x09, 0x86, 0x29, 0xa1, 0x09, 0x86, 0x21, 0xa0, 0x09, 0x86, 0x19, 0x9f,
+    0x09, 0x86, 0x10, 0xa8, 0x09, 0x86, 0x09, 0xa7, 0x09, 0x86, 0x01, 0xa6,
+    0x09, 0x85, 0xf9, 0xa5, 0x09, 0x85, 0xf1, 0xa4, 0x09, 0x85, 0xe9, 0xa3,
+    0x09, 0x85, 0xdb, 0x01, 0xda, 0xab, 0xa2, 0x09, 0x85, 0xd1, 0xa1, 0x09,
+    0x85, 0xc3, 0x01, 0xda, 0xaf, 0xa0, 0x09, 0x85, 0xb9, 0x9f, 0x09, 0x85,
+    0x6a, 0x01, 0xda, 0xb3, 0xa8, 0x09, 0x85, 0x61, 0xa7, 0x09, 0x85, 0x53,
+    0x01, 0xda, 0xd7, 0xa6, 0x09, 0x85, 0x49, 0xa5, 0x09, 0x85, 0x3b, 0x01,
+    0xda, 0xdb, 0xa4, 0x09, 0x85, 0x31, 0xa3, 0x09, 0x85, 0x29, 0xa2, 0x09,
+    0x85, 0x21, 0xa1, 0x09, 0x85, 0x19, 0xa0, 0x09, 0x85, 0x11, 0x9f, 0x09,
+    0x85, 0x08, 0xa8, 0x09, 0x85, 0x01, 0xa7, 0x09, 0x84, 0xf9, 0xa6, 0x09,
+    0x84, 0xf1, 0xa5, 0x09, 0x84, 0xe9, 0xa4, 0x09, 0x84, 0xe1, 0xa3, 0x09,
+    0x84, 0xd3, 0x01, 0xda, 0xdf, 0xa2, 0x09, 0x84, 0xc9, 0xa1, 0x09, 0x84,
+    0xc1, 0xa0, 0x09, 0x84, 0xb3, 0x01, 0xda, 0xe3, 0x9f, 0x09, 0x84, 0xa8,
+    0xa8, 0x09, 0x84, 0xa1, 0xa7, 0x09, 0x84, 0x99, 0xa6, 0x09, 0x84, 0x8b,
+    0x01, 0xda, 0xe7, 0xa5, 0x09, 0x84, 0x81, 0xa4, 0x09, 0x84, 0x79, 0xa3,
+    0x09, 0x84, 0x71, 0xa2, 0x09, 0x84, 0x69, 0xa1, 0x09, 0x84, 0x61, 0xa0,
+    0x09, 0x84, 0x59, 0x9f, 0x09, 0x84, 0x50, 0xa8, 0x09, 0x84, 0x49, 0xa7,
+    0x09, 0x84, 0x41, 0xa6, 0x09, 0x84, 0x39, 0xa5, 0x09, 0x84, 0x31, 0xa4,
+    0x09, 0x84, 0x29, 0xa3, 0x09, 0x84, 0x21, 0xa2, 0x09, 0x84, 0x19, 0xa1,
+    0x09, 0x84, 0x11, 0xa0, 0x09, 0x84, 0x09, 0x9f, 0x09, 0x84, 0x00, 0xa8,
+    0x09, 0x83, 0xf9, 0xa7, 0x09, 0x83, 0xeb, 0x01, 0xda, 0xeb, 0xa6, 0x09,
+    0x83, 0xe1, 0xa5, 0x09, 0x83, 0xd9, 0xa4, 0x09, 0x83, 0xd1, 0xa3, 0x09,
+    0x83, 0xc9, 0xa2, 0x09, 0x83, 0xc1, 0xa1, 0x09, 0x83, 0xb9, 0xa0, 0x09,
+    0x83, 0xb0, 0xa3, 0x09, 0x83, 0xa9, 0xa2, 0x09, 0x83, 0xa1, 0xa1, 0x09,
+    0x83, 0x99, 0xa0, 0x09, 0x83, 0x91, 0x9f, 0x09, 0x83, 0x88, 0xa8, 0x09,
+    0x83, 0x81, 0xa7, 0x09, 0x83, 0x79, 0xa6, 0x09, 0x83, 0x71, 0xa5, 0x09,
+    0x83, 0x69, 0xa4, 0x09, 0x83, 0x61, 0xa3, 0x09, 0x83, 0x59, 0xa2, 0x09,
+    0x83, 0x51, 0xa1, 0x09, 0x83, 0x49, 0xa0, 0x09, 0x83, 0x41, 0x9f, 0x09,
+    0x83, 0x32, 0x01, 0xda, 0xef, 0xa8, 0x09, 0x83, 0x29, 0xa7, 0x09, 0x83,
+    0x21, 0xa6, 0x09, 0x83, 0x19, 0xa5, 0x09, 0x83, 0x11, 0xa4, 0x09, 0x83,
+    0x09, 0xa3, 0x09, 0x83, 0x01, 0xa2, 0x09, 0x82, 0xf9, 0xa1, 0x09, 0x82,
+    0xdb, 0x01, 0xda, 0xf3, 0xa0, 0x09, 0x82, 0xd0, 0xcb, 0x57, 0x87, 0x0f,
+    0xbd, 0x39, 0x46, 0x00, 0xbb, 0xc1, 0xda, 0xff, 0x15, 0xc1, 0xdb, 0x0b,
+    0xd4, 0x3e, 0x46, 0x0f, 0xbd, 0xa0, 0xc4, 0x17, 0xf7, 0x00, 0x37, 0xb9,
+    0xc2, 0x24, 0x36, 0x00, 0x37, 0xb0, 0xc3, 0x0c, 0xf7, 0x00, 0x37, 0xa9,
+    0xc3, 0x04, 0xa0, 0x00, 0x37, 0xa0, 0xc4, 0x03, 0xe0, 0x00, 0x37, 0x99,
+    0xc2, 0x01, 0xa2, 0x00, 0x37, 0x90, 0x97, 0x00, 0x98, 0x4b, 0x01, 0xdb,
+    0x17, 0x47, 0x22, 0xbe, 0xc1, 0xdb, 0x1d, 0x83, 0x00, 0x98, 0x43, 0x01,
+    0xdb, 0x40, 0x8b, 0x00, 0x98, 0x51, 0x87, 0x00, 0x98, 0x6b, 0x01, 0xdb,
+    0x44, 0x91, 0x00, 0x98, 0x73, 0x01, 0xdb, 0x48, 0x19, 0xc1, 0xdb, 0x4c,
+    0x09, 0xc1, 0xdb, 0x5e, 0x1b, 0x41, 0xdb, 0x7c, 0x0a, 0xc1, 0xdb, 0x96,
+    0x83, 0x00, 0x90, 0x03, 0x01, 0xdb, 0xb8, 0x97, 0x00, 0x90, 0x09, 0x8b,
+    0x00, 0x90, 0x11, 0x87, 0x00, 0x90, 0x2b, 0x01, 0xdb, 0xbc, 0x91, 0x00,
+    0x90, 0x32, 0x01, 0xdb, 0xc0, 0x04, 0xc1, 0xdb, 0xc4, 0x83, 0x00, 0x93,
+    0x03, 0x01, 0xdb, 0xde, 0x97, 0x00, 0x93, 0x09, 0x8b, 0x00, 0x93, 0x11,
+    0x87, 0x00, 0x93, 0x2b, 0x01, 0xdb, 0xe2, 0x91, 0x00, 0x93, 0x33, 0x01,
+    0xdb, 0xe6, 0x19, 0x41, 0xdb, 0xea, 0x05, 0xc1, 0xdb, 0xf9, 0x83, 0x00,
+    0x93, 0xc3, 0x01, 0xdc, 0x17, 0x97, 0x00, 0x93, 0xc9, 0x8b, 0x00, 0x93,
+    0xd1, 0x87, 0x00, 0x93, 0xeb, 0x01, 0xdc, 0x1b, 0x91, 0x00, 0x93, 0xf3,
+    0x01, 0xdc, 0x1f, 0xc2, 0x00, 0x71, 0x00, 0x93, 0xf9, 0x0a, 0x41, 0xdc,
+    0x23, 0x1c, 0xc1, 0xdc, 0x46, 0x06, 0xc1, 0xdc, 0x5f, 0x83, 0x00, 0x97,
+    0x83, 0x01, 0xdc, 0x86, 0x97, 0x00, 0x97, 0x89, 0x8b, 0x00, 0x97, 0x91,
+    0x87, 0x00, 0x97, 0xab, 0x01, 0xdc, 0x8a, 0x91, 0x00, 0x97, 0xb3, 0x01,
+    0xdc, 0x8e, 0xc2, 0x00, 0x71, 0x00, 0x97, 0xb8, 0x42, 0x00, 0x60, 0xc1,
+    0xdc, 0x92, 0x83, 0x00, 0x93, 0x83, 0x01, 0xdc, 0xab, 0x97, 0x00, 0x93,
+    0x89, 0x8b, 0x00, 0x93, 0x91, 0x87, 0x00, 0x93, 0xab, 0x01, 0xdc, 0xaf,
+    0x91, 0x00, 0x93, 0xb3, 0x01, 0xdc, 0xb3, 0xc2, 0x00, 0x71, 0x00, 0x93,
+    0xb9, 0x0a, 0xc1, 0xdc, 0xb7, 0x15, 0xc1, 0xdc, 0xda, 0x1c, 0x41, 0xdc,
+    0xfa, 0x83, 0x00, 0x90, 0x43, 0x01, 0xdd, 0x17, 0x97, 0x00, 0x90, 0x49,
+    0x8b, 0x00, 0x90, 0x51, 0x87, 0x00, 0x90, 0x6b, 0x01, 0xdd, 0x1b, 0x91,
+    0x00, 0x90, 0x73, 0x01, 0xdd, 0x1f, 0xc2, 0x00, 0x71, 0x00, 0x90, 0x78,
+    0x83, 0x00, 0x90, 0xc3, 0x01, 0xdd, 0x23, 0x97, 0x00, 0x90, 0xc9, 0x8b,
+    0x00, 0x90, 0xd1, 0x87, 0x00, 0x90, 0xeb, 0x01, 0xdd, 0x27, 0x91, 0x00,
+    0x90, 0xf3, 0x01, 0xdd, 0x2b, 0x19, 0xc1, 0xdd, 0x2f, 0xc2, 0x1a, 0x18,
+    0x00, 0x9a, 0xc8, 0x1c, 0xc1, 0xdd, 0x3e, 0x83, 0x00, 0x91, 0x83, 0x01,
+    0xdd, 0x5e, 0x97, 0x00, 0x91, 0x89, 0x8b, 0x00, 0x91, 0x91, 0x87, 0x00,
+    0x91, 0xab, 0x01, 0xdd, 0x62, 0x91, 0x00, 0x91, 0xb3, 0x01, 0xdd, 0x6c,
+    0xc2, 0x00, 0x71, 0x00, 0x91, 0xb9, 0x0a, 0xc1, 0xdd, 0x70, 0x15, 0x41,
+    0xdd, 0x93, 0x83, 0x00, 0x91, 0x43, 0x01, 0xdd, 0xad, 0x97, 0x00, 0x91,
+    0x49, 0x8b, 0x00, 0x91, 0x51, 0x87, 0x00, 0x91, 0x6b, 0x01, 0xdd, 0xb1,
+    0x91, 0x00, 0x91, 0x73, 0x01, 0xdd, 0xb5, 0xc2, 0x00, 0x71, 0x00, 0x91,
+    0x79, 0xc2, 0x1a, 0x18, 0x00, 0x9a, 0xc0, 0x83, 0x00, 0x92, 0x03, 0x01,
+    0xdd, 0xb9, 0x97, 0x00, 0x92, 0x09, 0x8b, 0x00, 0x92, 0x11, 0x87, 0x00,
+    0x92, 0x2b, 0x01, 0xdd, 0xbd, 0x91, 0x00, 0x92, 0x33, 0x01, 0xdd, 0xc1,
+    0x19, 0xc1, 0xdd, 0xc5, 0x0a, 0xc1, 0xdd, 0xd7, 0x1b, 0x41, 0xdd, 0xf5,
+    0x83, 0x00, 0x93, 0x43, 0x01, 0xde, 0x0f, 0x97, 0x00, 0x93, 0x49, 0x8b,
+    0x00, 0x93, 0x51, 0x87, 0x00, 0x93, 0x6b, 0x01, 0xde, 0x13, 0x91, 0x00,
+    0x93, 0x71, 0xc2, 0x00, 0x71, 0x00, 0x93, 0x78, 0x83, 0x00, 0x94, 0x03,
+    0x01, 0xde, 0x17, 0x97, 0x00, 0x94, 0x09, 0x8b, 0x00, 0x94, 0x11, 0x87,
+    0x00, 0x94, 0x2b, 0x01, 0xde, 0x1b, 0x91, 0x00, 0x94, 0x33, 0x01, 0xde,
+    0x1f, 0x19, 0xc1, 0xde, 0x23, 0x1b, 0x41, 0xde, 0x35, 0x83, 0x00, 0x94,
+    0x83, 0x01, 0xde, 0x4f, 0x97, 0x00, 0x94, 0x89, 0x8b, 0x00, 0x94, 0x91,
+    0x87, 0x00, 0x94, 0xab, 0x01, 0xde, 0x53, 0x91, 0x00, 0x94, 0xb3, 0x01,
+    0xde, 0x57, 0xc2, 0x00, 0x71, 0x00, 0x94, 0xb9, 0x1b, 0x41, 0xde, 0x5b,
+    0x83, 0x00, 0x95, 0x43, 0x01, 0xde, 0x7e, 0x97, 0x00, 0x95, 0x49, 0x8b,
+    0x00, 0x95, 0x51, 0x87, 0x00, 0x95, 0x6b, 0x01, 0xde, 0x82, 0x91, 0x00,
+    0x95, 0x73, 0x01, 0xde, 0x86, 0x19, 0xc1, 0xde, 0x8a, 0x1a, 0xc1, 0xde,
+    0x9c, 0x1b, 0x41, 0xde, 0xba, 0x83, 0x00, 0x96, 0x43, 0x01, 0xde, 0xd4,
+    0x97, 0x00, 0x96, 0x49, 0x8b, 0x00, 0x96, 0x51, 0x87, 0x00, 0x96, 0x6b,
+    0x01, 0xde, 0xd8, 0x91, 0x00, 0x96, 0x72, 0x01, 0xde, 0xdc, 0x0a, 0xc1,
+    0xde, 0xe0, 0x83, 0x00, 0x9a, 0x83, 0x01, 0xdf, 0x03, 0x97, 0x00, 0x9a,
+    0x89, 0x8b, 0x00, 0x9a, 0x91, 0x87, 0x00, 0x9a, 0xab, 0x01, 0xdf, 0x07,
+    0x91, 0x00, 0x9a, 0xb3, 0x01, 0xdf, 0x0b, 0x19, 0x41, 0xdf, 0x0f, 0x83,
+    0x00, 0x96, 0xc3, 0x01, 0xdf, 0x1e, 0x97, 0x00, 0x96, 0xc9, 0x8b, 0x00,
+    0x96, 0xd1, 0x87, 0x00, 0x96, 0xeb, 0x01, 0xdf, 0x22, 0x91, 0x00, 0x96,
+    0xf3, 0x01, 0xdf, 0x26, 0xc2, 0x00, 0x71, 0x00, 0x96, 0xf9, 0x0a, 0xc1,
+    0xdf, 0x2a, 0x1c, 0x41, 0xdf, 0x4a, 0x83, 0x00, 0x97, 0x43, 0x01, 0xdf,
+    0x64, 0x97, 0x00, 0x97, 0x49, 0x8b, 0x00, 0x97, 0x51, 0x87, 0x00, 0x97,
+    0x6b, 0x01, 0xdf, 0x68, 0x91, 0x00, 0x97, 0x72, 0x01, 0xdf, 0x6c, 0x83,
+    0x00, 0x98, 0x03, 0x01, 0xdf, 0x70, 0x97, 0x00, 0x98, 0x09, 0x8b, 0x00,
+    0x98, 0x11, 0x87, 0x00, 0x98, 0x2b, 0x01, 0xdf, 0x74, 0x91, 0x00, 0x98,
+    0x33, 0x01, 0xdf, 0x78, 0xc2, 0x00, 0x71, 0x00, 0x98, 0x38, 0x83, 0x00,
+    0x9a, 0x43, 0x01, 0xdf, 0x7c, 0x97, 0x00, 0x9a, 0x49, 0x8b, 0x00, 0x9a,
+    0x51, 0x87, 0x00, 0x9a, 0x6b, 0x01, 0xdf, 0x80, 0x91, 0x00, 0x9a, 0x71,
+    0x19, 0xc1, 0xdf, 0x84, 0xc2, 0x1a, 0x18, 0x00, 0x9a, 0xd0, 0x4b, 0x64,
+    0x58, 0xc1, 0xdf, 0x93, 0xd1, 0x35, 0x66, 0x00, 0x9a, 0xf0, 0xc9, 0x53,
+    0xcf, 0x00, 0x9b, 0xe0, 0xc6, 0xd3, 0x76, 0x00, 0x9c, 0xc0, 0x48, 0x74,
+    0xd0, 0xc1, 0xdf, 0x9f, 0x45, 0x00, 0x92, 0x41, 0xdf, 0xab, 0xc5, 0x00,
+    0x83, 0x01, 0x18, 0x09, 0xc5, 0xd6, 0xd4, 0x0f, 0xa9, 0x31, 0xc4, 0xe2,
+    0xc8, 0x0f, 0xa8, 0x61, 0xca, 0xa4, 0x5c, 0x0f, 0xa5, 0x08, 0xc2, 0x2f,
+    0x05, 0x08, 0x7f, 0xa9, 0xc3, 0x0a, 0xc8, 0x08, 0x7f, 0x40, 0xc3, 0x11,
+    0x9a, 0x08, 0x7f, 0xa1, 0x03, 0x41, 0xdf, 0xcf, 0xc2, 0x00, 0x60, 0x08,
+    0x7f, 0x38, 0xc4, 0x35, 0x13, 0x08, 0x7f, 0x01, 0xc3, 0x16, 0xc8, 0x08,
+    0x7f, 0x78, 0x87, 0x08, 0x29, 0x29, 0xc4, 0x31, 0xdd, 0x08, 0x29, 0x30,
+    0xd6, 0x2d, 0x4e, 0x01, 0x39, 0xb9, 0xcd, 0x0e, 0x9f, 0x01, 0x39, 0xa9,
+    0xca, 0x23, 0xd3, 0x01, 0x39, 0xa0, 0xc2, 0x02, 0xd5, 0x01, 0x10, 0x71,
+    0xcb, 0x72, 0xf1, 0x00, 0x04, 0xb8, 0xc3, 0x01, 0x41, 0x00, 0x00, 0x19,
+    0xcb, 0x96, 0x4f, 0x00, 0x00, 0x22, 0x01, 0xdf, 0xdb, 0x43, 0x04, 0x74,
+    0xc1, 0xdf, 0xe1, 0xcd, 0x77, 0x4e, 0x01, 0x12, 0xe8, 0x01, 0x41, 0xdf,
+    0xf9, 0xc4, 0x17, 0xf7, 0x08, 0xed, 0x39, 0xc2, 0x24, 0x36, 0x08, 0xed,
+    0x30, 0xc3, 0x0c, 0xf7, 0x08, 0xed, 0x29, 0xc3, 0x04, 0xa0, 0x08, 0xed,
+    0x20, 0xc4, 0x03, 0xe0, 0x08, 0xed, 0x19, 0xc2, 0x01, 0xa2, 0x08, 0xed,
+    0x10, 0x03, 0xc1, 0xe0, 0x03, 0xc2, 0x05, 0x37, 0x08, 0xec, 0x99, 0xc2,
+    0x00, 0xc8, 0x08, 0xec, 0x81, 0x97, 0x08, 0xec, 0x6b, 0x01, 0xe0, 0x0f,
+    0x8b, 0x08, 0xec, 0x5a, 0x01, 0xe0, 0x13, 0xc2, 0x00, 0xce, 0x08, 0xec,
+    0x31, 0x83, 0x08, 0xec, 0x28, 0xc2, 0x00, 0xeb, 0x08, 0xec, 0x21, 0x83,
+    0x08, 0xeb, 0xd0, 0x06, 0xc1, 0xe0, 0x17, 0xc2, 0x00, 0xce, 0x08, 0xeb,
+    0xc9, 0x83, 0x08, 0xeb, 0xc0, 0xc2, 0x00, 0xce, 0x08, 0xec, 0x09, 0x83,
+    0x08, 0xec, 0x00, 0xc2, 0x00, 0x89, 0x08, 0xeb, 0xf9, 0x83, 0x08, 0xeb,
+    0xa8, 0x16, 0xc1, 0xe0, 0x21, 0xc2, 0x00, 0xce, 0x08, 0xeb, 0xa1, 0x83,
+    0x08, 0xeb, 0x98, 0xc2, 0x00, 0xce, 0x08, 0xeb, 0xe1, 0x83, 0x08, 0xeb,
+    0xd8, 0xc2, 0x00, 0xce, 0x08, 0xeb, 0xb9, 0x83, 0x08, 0xeb, 0xb0, 0xc2,
+    0x00, 0xce, 0x08, 0xeb, 0x91, 0x83, 0x08, 0xeb, 0x88, 0xc2, 0x00, 0xce,
+    0x08, 0xeb, 0x79, 0x83, 0x08, 0xeb, 0x70, 0x97, 0x08, 0xeb, 0x59, 0x8b,
+    0x08, 0xeb, 0x41, 0x83, 0x08, 0xeb, 0x08, 0x97, 0x08, 0xeb, 0x28, 0x8b,
+    0x08, 0xeb, 0x18, 0xc5, 0x40, 0xb0, 0x00, 0x50, 0x19, 0xc4, 0x1f, 0xf7,
+    0x00, 0x52, 0x68, 0x83, 0x00, 0x50, 0x31, 0x8b, 0x00, 0x50, 0x81, 0x97,
+    0x00, 0x50, 0xa0, 0x8b, 0x00, 0x50, 0x40, 0x97, 0x00, 0x50, 0x50, 0x83,
+    0x00, 0x50, 0xa9, 0x0a, 0x41, 0xe0, 0x2b, 0x83, 0x00, 0x50, 0xb9, 0x0a,
+    0x41, 0xe0, 0x35, 0xc2, 0x00, 0xeb, 0x00, 0x50, 0xc9, 0xc2, 0x1a, 0x18,
+    0x00, 0x50, 0xf1, 0xc2, 0x03, 0x83, 0x00, 0x51, 0x19, 0x83, 0x00, 0x51,
+    0x40, 0x83, 0x00, 0x50, 0xd1, 0xc2, 0x00, 0xce, 0x00, 0x50, 0xd8, 0x83,
+    0x00, 0x50, 0xe1, 0xc2, 0x00, 0xce, 0x00, 0x50, 0xe8, 0x16, 0xc1, 0xe0,
+    0x3f, 0x83, 0x00, 0x51, 0x21, 0xc2, 0x00, 0xce, 0x00, 0x51, 0x28, 0x06,
+    0xc1, 0xe0, 0x49, 0x83, 0x00, 0x51, 0x31, 0xc2, 0x00, 0xce, 0x00, 0x51,
+    0x38, 0x83, 0x00, 0x51, 0x51, 0xc2, 0x00, 0xce, 0x00, 0x51, 0x58, 0x83,
+    0x00, 0x51, 0x61, 0xc2, 0x00, 0xce, 0x00, 0x51, 0x68, 0x83, 0x00, 0x51,
+    0x81, 0xc2, 0x00, 0x3b, 0x00, 0x52, 0xe0, 0x83, 0x00, 0x51, 0x91, 0xc2,
+    0x00, 0x89, 0x00, 0x51, 0x98, 0xc2, 0x00, 0xce, 0x00, 0x51, 0xb1, 0x83,
+    0x00, 0x51, 0xc0, 0x83, 0x00, 0x51, 0xf1, 0x8b, 0x00, 0x52, 0x41, 0x97,
+    0x00, 0x52, 0x60, 0x8b, 0x00, 0x52, 0x00, 0x97, 0x00, 0x52, 0x10, 0xc2,
+    0x01, 0xa2, 0x00, 0x53, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x53, 0x48, 0xc3,
+    0x04, 0xa0, 0x00, 0x53, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x53, 0x58, 0xc2,
+    0x24, 0x36, 0x00, 0x53, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x53, 0x68, 0xca,
+    0x1f, 0xea, 0x00, 0x54, 0x09, 0xd1, 0x34, 0xd3, 0x00, 0x57, 0xf0, 0xc7,
+    0x14, 0x03, 0x00, 0x54, 0x11, 0xc7, 0x7e, 0x15, 0x00, 0x55, 0xe8, 0xc5,
+    0x40, 0xb0, 0x00, 0x54, 0x19, 0xc4, 0x1f, 0xf7, 0x00, 0x56, 0x68, 0xc4,
+    0xdd, 0xba, 0x00, 0x57, 0xd1, 0xc5, 0xdc, 0xc9, 0x00, 0x57, 0xd8, 0xd4,
+    0x3e, 0xbe, 0x00, 0x57, 0xe9, 0xd5, 0x34, 0xcf, 0x00, 0x57, 0xf8, 0x83,
+    0x00, 0x54, 0x31, 0x8b, 0x00, 0x54, 0x81, 0x97, 0x00, 0x54, 0xa0, 0x8b,
+    0x00, 0x54, 0x40, 0x97, 0x00, 0x54, 0x50, 0x47, 0xaa, 0xd3, 0xc1, 0xe0,
+    0x53, 0x83, 0x00, 0x55, 0xa8, 0x83, 0x00, 0x54, 0xa9, 0xc2, 0x00, 0xce,
+    0x00, 0x54, 0xb0, 0x83, 0x00, 0x54, 0xb9, 0xc2, 0x00, 0xce, 0x00, 0x54,
+    0xc0, 0xc2, 0x00, 0xeb, 0x00, 0x54, 0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x54,
+    0xf1, 0xc2, 0x03, 0x83, 0x00, 0x55, 0x19, 0x83, 0x00, 0x55, 0x40, 0x83,
+    0x00, 0x54, 0xd1, 0xc2, 0x00, 0xce, 0x00, 0x54, 0xd8, 0x83, 0x00, 0x54,
+    0xe1, 0xc2, 0x00, 0xce, 0x00, 0x54, 0xe8, 0x16, 0xc1, 0xe0, 0x61, 0x83,
+    0x00, 0x55, 0x21, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x28, 0x06, 0xc1, 0xe0,
+    0x6b, 0x83, 0x00, 0x55, 0x31, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x38, 0x83,
+    0x00, 0x55, 0x51, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x58, 0x83, 0x00, 0x55,
+    0x61, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x68, 0x83, 0x00, 0x55, 0x91, 0xc2,
+    0x00, 0x89, 0x00, 0x55, 0x98, 0xc2, 0x00, 0xce, 0x00, 0x55, 0xb1, 0xc2,
+    0x0d, 0x01, 0x00, 0x55, 0xb9, 0x83, 0x00, 0x55, 0xc0, 0x87, 0x00, 0x54,
+    0x69, 0x91, 0x00, 0x54, 0x88, 0x03, 0xc1, 0xe0, 0x75, 0x8b, 0x00, 0x55,
+    0xfb, 0x01, 0xe0, 0x81, 0x97, 0x00, 0x56, 0x0b, 0x01, 0xe0, 0x85, 0x48,
+    0xaa, 0xd2, 0xc1, 0xe0, 0x89, 0x47, 0xc3, 0xbf, 0xc1, 0xe0, 0x97, 0x87,
+    0x00, 0x56, 0x39, 0x91, 0x00, 0x56, 0x58, 0xc2, 0x01, 0xa2, 0x00, 0x57,
+    0x41, 0xc4, 0x03, 0xe0, 0x00, 0x57, 0x48, 0xc3, 0x04, 0xa0, 0x00, 0x57,
+    0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x57, 0x58, 0xc2, 0x24, 0x36, 0x00, 0x57,
+    0x61, 0xc4, 0x17, 0xf7, 0x00, 0x57, 0x68, 0xc2, 0x0c, 0xf3, 0x08, 0x1a,
+    0x09, 0xc8, 0x0c, 0xe6, 0x08, 0x1a, 0x50, 0x0f, 0xc1, 0xe0, 0x9f, 0x42,
+    0x00, 0xaf, 0xc1, 0xe0, 0xab, 0x18, 0xc1, 0xe0, 0xb7, 0x06, 0xc1, 0xe0,
+    0xc3, 0x11, 0xc1, 0xe0, 0xd8, 0x48, 0x09, 0x39, 0xc1, 0xe0, 0xf0, 0x15,
+    0xc1, 0xe1, 0x0c, 0x12, 0xc1, 0xe1, 0x24, 0x0d, 0xc1, 0xe1, 0x45, 0x0e,
+    0xc1, 0xe1, 0x55, 0xcc, 0x52, 0xb0, 0x00, 0x1b, 0xa1, 0x1b, 0xc1, 0xe1,
+    0x6d, 0xcd, 0x30, 0xea, 0x00, 0x1b, 0xf1, 0x16, 0xc1, 0xe1, 0x79, 0x03,
+    0xc1, 0xe1, 0x95, 0xcb, 0x95, 0x10, 0x00, 0x1e, 0x81, 0x14, 0xc1, 0xe1,
+    0xa5, 0x08, 0xc1, 0xe1, 0xb1, 0xcb, 0x8c, 0xba, 0x08, 0x0c, 0x29, 0xcb,
+    0x91, 0xf8, 0x08, 0x0c, 0x41, 0xc9, 0xaa, 0x8a, 0x08, 0x0c, 0x51, 0x4d,
+    0x75, 0xc8, 0x41, 0xe1, 0xbd, 0xc4, 0xcf, 0xbf, 0x0f, 0xa6, 0xb9, 0xc5,
+    0x19, 0xbe, 0x0f, 0xa4, 0xd1, 0xc5, 0xd5, 0x94, 0x0f, 0x9a, 0x79, 0xc5,
+    0xda, 0x7b, 0x0f, 0xca, 0xb8, 0x4a, 0x34, 0x28, 0xc1, 0xe1, 0xcf, 0xcf,
+    0x60, 0x89, 0x01, 0x55, 0x28, 0xc3, 0x01, 0xa5, 0x01, 0x16, 0xb9, 0xcd,
+    0x7a, 0x8e, 0x01, 0x53, 0xd1, 0xd3, 0x42, 0x1e, 0x01, 0x53, 0xe0, 0x42,
+    0x00, 0x2d, 0xc1, 0xe1, 0xdb, 0x43, 0x00, 0x98, 0x41, 0xe1, 0xf6, 0x45,
+    0x00, 0xd3, 0xc1, 0xe2, 0x02, 0x43, 0x00, 0x6c, 0x41, 0xe2, 0x14, 0xd4,
+    0x05, 0x55, 0x01, 0x55, 0x48, 0x48, 0xaa, 0xd2, 0xc1, 0xe2, 0x20, 0x03,
+    0xc1, 0xe2, 0x2e, 0xc2, 0x05, 0x37, 0x08, 0x9a, 0x59, 0xc2, 0x00, 0xc8,
+    0x08, 0x9a, 0x39, 0x97, 0x08, 0x9a, 0x0b, 0x01, 0xe2, 0x3a, 0x8b, 0x08,
+    0x99, 0xfa, 0x01, 0xe2, 0x3e, 0x18, 0xc1, 0xe2, 0x42, 0xc2, 0x00, 0xce,
+    0x08, 0x99, 0xc9, 0x15, 0xc1, 0xe2, 0x52, 0x0e, 0xc1, 0xe2, 0x62, 0xc2,
+    0x00, 0x3b, 0x08, 0x99, 0x81, 0xc2, 0x1a, 0x18, 0x08, 0x99, 0x79, 0xc2,
+    0x00, 0xb6, 0x08, 0x99, 0x71, 0x04, 0xc1, 0xe2, 0x6c, 0x12, 0xc1, 0xe2,
+    0x76, 0x06, 0xc1, 0xe2, 0x80, 0x16, 0xc1, 0xe2, 0x8e, 0x10, 0xc1, 0xe2,
+    0x9c, 0x0c, 0xc1, 0xe2, 0xb2, 0x05, 0xc1, 0xe2, 0xbc, 0x09, 0xc1, 0xe2,
+    0xc6, 0x0d, 0xc1, 0xe2, 0xd0, 0x83, 0x08, 0x98, 0x2b, 0x01, 0xe2, 0xda,
+    0xc2, 0x05, 0x37, 0x08, 0x98, 0x99, 0x97, 0x08, 0x98, 0x4b, 0x01, 0xe2,
+    0xe6, 0x8b, 0x08, 0x98, 0x3b, 0x01, 0xe2, 0xea, 0xc2, 0x00, 0xc8, 0x08,
+    0x98, 0x78, 0xc5, 0xd4, 0x54, 0x08, 0x9a, 0xe9, 0x42, 0x06, 0xb4, 0xc1,
+    0xe2, 0xee, 0x03, 0xc1, 0xe2, 0xfa, 0xc5, 0x34, 0xd9, 0x08, 0x99, 0xe1,
+    0x05, 0x41, 0xe3, 0x06, 0x46, 0x00, 0x91, 0x41, 0xe3, 0x12, 0xc5, 0x0b,
+    0x24, 0x01, 0x12, 0x89, 0xca, 0x34, 0x32, 0x01, 0x12, 0x70, 0x42, 0x00,
+    0x89, 0xc1, 0xe3, 0x1c, 0x0a, 0xc1, 0xe3, 0x26, 0x03, 0xc1, 0xe3, 0x3a,
+    0x16, 0xc1, 0xe3, 0x4a, 0x07, 0xc1, 0xe3, 0x54, 0xc2, 0x14, 0xdf, 0x00,
+    0xe5, 0xb9, 0xc2, 0x01, 0x3a, 0x00, 0xe5, 0xb1, 0xc2, 0x00, 0x2b, 0x00,
+    0xe5, 0x99, 0x0c, 0xc1, 0xe3, 0x5e, 0xc3, 0xe5, 0xf5, 0x00, 0xe5, 0x71,
+    0x05, 0xc1, 0xe3, 0x6a, 0x15, 0xc1, 0xe3, 0x7a, 0xc3, 0xe5, 0x8f, 0x00,
+    0xe5, 0x39, 0x09, 0xc1, 0xe3, 0x86, 0x0d, 0xc1, 0xe3, 0x92, 0x12, 0xc1,
+    0xe3, 0x9e, 0xc2, 0x05, 0x1f, 0x00, 0xe5, 0x19, 0xc3, 0x8c, 0x47, 0x00,
+    0xe5, 0x01, 0x1c, 0xc1, 0xe3, 0xaa, 0xc2, 0x00, 0x47, 0x00, 0xe4, 0xe9,
+    0xc3, 0x2a, 0x1b, 0x00, 0xe4, 0xe1, 0xc3, 0x12, 0xf2, 0x00, 0xe4, 0xd9,
+    0xc2, 0x00, 0xaf, 0x00, 0xe4, 0xc1, 0xc3, 0x24, 0x80, 0x00, 0xe4, 0xa9,
+    0xc3, 0x1b, 0x1b, 0x00, 0xe4, 0x99, 0xc3, 0x11, 0x80, 0x00, 0xe4, 0x88,
+    0x03, 0xc1, 0xe3, 0xb6, 0xc3, 0x11, 0x80, 0x00, 0x85, 0x09, 0x09, 0xc1,
+    0xe3, 0xc0, 0xc3, 0x1b, 0x1b, 0x00, 0x85, 0x19, 0xc2, 0x00, 0x79, 0x00,
+    0x85, 0x21, 0xc3, 0x24, 0x80, 0x00, 0x85, 0x29, 0x1c, 0xc1, 0xe3, 0xcc,
+    0x42, 0x00, 0x51, 0xc1, 0xe3, 0xd8, 0xc2, 0x00, 0xaf, 0x00, 0x85, 0x41,
+    0x0d, 0xc1, 0xe3, 0xe0, 0xc3, 0x00, 0xa5, 0x00, 0x85, 0x51, 0xc3, 0x12,
+    0xf2, 0x00, 0x85, 0x59, 0xc3, 0x2a, 0x1b, 0x00, 0x85, 0x61, 0xc2, 0x00,
+    0x47, 0x00, 0x85, 0x69, 0x12, 0xc1, 0xe3, 0xec, 0xc3, 0x8c, 0x47, 0x00,
+    0x85, 0x81, 0x15, 0xc1, 0xe3, 0xf8, 0xc2, 0x05, 0x1f, 0x00, 0x85, 0x99,
+    0xc3, 0xe5, 0x8f, 0x00, 0x85, 0xb9, 0x05, 0xc1, 0xe4, 0x04, 0x0c, 0xc1,
+    0xe4, 0x14, 0xc3, 0xe5, 0xf5, 0x00, 0x85, 0xf1, 0x0a, 0xc1, 0xe4, 0x20,
+    0xc2, 0x00, 0x2b, 0x00, 0x86, 0x19, 0xc2, 0x14, 0xdf, 0x00, 0x86, 0x38,
+    0x03, 0xc1, 0xe4, 0x34, 0xc3, 0x11, 0x80, 0x00, 0x86, 0x89, 0x09, 0xc1,
+    0xe4, 0x44, 0xc3, 0x1b, 0x1b, 0x00, 0x86, 0x99, 0x07, 0xc1, 0xe4, 0x50,
+    0xc3, 0x24, 0x80, 0x00, 0x86, 0xa9, 0x1c, 0xc1, 0xe4, 0x5a, 0x16, 0xc1,
+    0xe4, 0x66, 0xc2, 0x00, 0xaf, 0x00, 0x86, 0xc1, 0x0d, 0xc1, 0xe4, 0x70,
+    0x42, 0x00, 0x89, 0xc1, 0xe4, 0x7c, 0xc3, 0x12, 0xf2, 0x00, 0x86, 0xd9,
+    0xc3, 0x2a, 0x1b, 0x00, 0x86, 0xe1, 0xc2, 0x00, 0x47, 0x00, 0x86, 0xe9,
+    0x12, 0xc1, 0xe4, 0x86, 0xc3, 0x8c, 0x47, 0x00, 0x87, 0x01, 0x15, 0xc1,
+    0xe4, 0x92, 0xc2, 0x05, 0x1f, 0x00, 0x87, 0x19, 0xc3, 0xe5, 0x8f, 0x00,
+    0x87, 0x39, 0x05, 0xc1, 0xe4, 0x9e, 0x0c, 0xc1, 0xe4, 0xae, 0xc3, 0xe5,
+    0xf5, 0x00, 0x87, 0x71, 0x0a, 0xc1, 0xe4, 0xba, 0xc2, 0x00, 0x2b, 0x00,
+    0x87, 0x99, 0xc2, 0x01, 0x3a, 0x00, 0x87, 0xb1, 0xc2, 0x14, 0xdf, 0x00,
+    0x87, 0xb8, 0x03, 0xc1, 0xe4, 0xce, 0xc3, 0x11, 0x80, 0x01, 0x68, 0x09,
+    0x09, 0xc1, 0xe4, 0xd8, 0xc3, 0x1b, 0x1b, 0x01, 0x68, 0x19, 0xc2, 0x00,
+    0x79, 0x01, 0x68, 0x21, 0xc3, 0x24, 0x80, 0x01, 0x68, 0x29, 0x1c, 0xc1,
+    0xe4, 0xe4, 0x42, 0x00, 0x51, 0xc1, 0xe4, 0xf0, 0xc2, 0x00, 0xaf, 0x01,
+    0x68, 0x41, 0x0d, 0xc1, 0xe4, 0xf8, 0xc3, 0x00, 0xa5, 0x01, 0x68, 0x51,
+    0xc3, 0x12, 0xf2, 0x01, 0x68, 0x59, 0xc3, 0x2a, 0x1b, 0x01, 0x68, 0x61,
+    0xc2, 0x00, 0x47, 0x01, 0x68, 0x69, 0x12, 0xc1, 0xe5, 0x04, 0xc3, 0x8c,
+    0x47, 0x01, 0x68, 0x81, 0x15, 0xc1, 0xe5, 0x10, 0xc2, 0x05, 0x1f, 0x01,
+    0x68, 0x99, 0xc3, 0xe5, 0x8f, 0x01, 0x68, 0xb9, 0x05, 0xc1, 0xe5, 0x1c,
+    0x0c, 0xc1, 0xe5, 0x2c, 0xc3, 0xe5, 0xf5, 0x01, 0x68, 0xf1, 0x0a, 0xc1,
+    0xe5, 0x38, 0xc2, 0x00, 0x2b, 0x01, 0x69, 0x19, 0xc2, 0x14, 0xdf, 0x01,
+    0x69, 0x38, 0xc3, 0xe4, 0x92, 0x01, 0x60, 0x01, 0x04, 0xc1, 0xe5, 0x4c,
+    0xc4, 0xde, 0x30, 0x01, 0x60, 0x11, 0xc7, 0xc2, 0xd8, 0x01, 0x60, 0x19,
+    0x06, 0xc1, 0xe5, 0x58, 0x1b, 0xc1, 0xe5, 0x6a, 0x1c, 0xc1, 0xe5, 0x7c,
+    0x8b, 0x01, 0x60, 0x5b, 0x01, 0xe5, 0x88, 0xc4, 0xe0, 0x5c, 0x01, 0x60,
+    0x69, 0x0e, 0xc1, 0xe5, 0x9a, 0xc7, 0x62, 0x35, 0x01, 0x60, 0x79, 0xc5,
+    0xda, 0x58, 0x01, 0x60, 0x81, 0x11, 0xc1, 0xe5, 0xa6, 0x12, 0xc1, 0xe5,
+    0xb2, 0xc5, 0xd3, 0xaf, 0x01, 0x60, 0x99, 0x15, 0xc1, 0xe5, 0xbc, 0x16,
+    0xc1, 0xe5, 0xd5, 0xc3, 0xc6, 0x83, 0x01, 0x60, 0xb1, 0x08, 0xc1, 0xe5,
+    0xe7, 0xc4, 0x5e, 0xcf, 0x01, 0x60, 0xc1, 0x05, 0x41, 0xe5, 0xf3, 0xc3,
+    0xe4, 0x92, 0x01, 0x61, 0x81, 0x04, 0xc1, 0xe5, 0xff, 0xc4, 0xde, 0x30,
+    0x01, 0x61, 0x91, 0xc7, 0xc2, 0xd8, 0x01, 0x61, 0x99, 0x06, 0xc1, 0xe6,
+    0x0b, 0x1b, 0xc1, 0xe6, 0x1d, 0x1c, 0xc1, 0xe6, 0x2f, 0x8b, 0x01, 0x61,
+    0xdb, 0x01, 0xe6, 0x3b, 0xc4, 0xe0, 0x5c, 0x01, 0x61, 0xe9, 0x0e, 0xc1,
+    0xe6, 0x4d, 0xc7, 0x62, 0x35, 0x01, 0x61, 0xf9, 0xc5, 0xda, 0x58, 0x01,
+    0x62, 0x01, 0x11, 0xc1, 0xe6, 0x59, 0x12, 0xc1, 0xe6, 0x65, 0xc5, 0xd3,
+    0xaf, 0x01, 0x62, 0x19, 0x15, 0xc1, 0xe6, 0x6f, 0x16, 0xc1, 0xe6, 0x88,
+    0xc3, 0xc6, 0x83, 0x01, 0x62, 0x31, 0x08, 0xc1, 0xe6, 0x9a, 0xc4, 0x5e,
+    0xcf, 0x01, 0x62, 0x41, 0x05, 0x41, 0xe6, 0xa6, 0xcb, 0x1f, 0xe9, 0x00,
+    0x58, 0x09, 0x03, 0xc1, 0xe6, 0xb2, 0x42, 0x06, 0xb4, 0xc1, 0xe6, 0xbe,
+    0xc5, 0x34, 0xd9, 0x00, 0x59, 0xe1, 0xc8, 0x7b, 0x63, 0x00, 0x5a, 0xa8,
+    0x83, 0x00, 0x58, 0x2b, 0x01, 0xe6, 0xca, 0x8b, 0x00, 0x58, 0x3b, 0x01,
+    0xe6, 0xd6, 0x97, 0x00, 0x58, 0x4b, 0x01, 0xe6, 0xda, 0x18, 0xc1, 0xe6,
+    0xde, 0x87, 0x00, 0x58, 0x79, 0x91, 0x00, 0x58, 0x99, 0x0d, 0xc1, 0xe6,
+    0xe8, 0x09, 0xc1, 0xe6, 0xf2, 0x10, 0xc1, 0xe6, 0xfc, 0x05, 0xc1, 0xe7,
+    0x12, 0x0c, 0xc1, 0xe7, 0x1c, 0x16, 0xc1, 0xe7, 0x26, 0x06, 0xc1, 0xe7,
+    0x34, 0x12, 0xc1, 0xe7, 0x42, 0x04, 0xc1, 0xe7, 0x4c, 0xc2, 0x00, 0xb6,
+    0x00, 0x59, 0x71, 0x1b, 0xc1, 0xe7, 0x56, 0x14, 0xc1, 0xe7, 0x60, 0x0e,
+    0xc1, 0xe7, 0x70, 0x15, 0xc1, 0xe7, 0x7a, 0xc2, 0x00, 0xce, 0x00, 0x59,
+    0xc9, 0xc2, 0x00, 0x71, 0x00, 0x5b, 0x88, 0x03, 0xc1, 0xe7, 0x8a, 0x8b,
+    0x00, 0x59, 0xfb, 0x01, 0xe7, 0x96, 0x97, 0x00, 0x5a, 0x0b, 0x01, 0xe7,
+    0x9a, 0x48, 0xaa, 0xd2, 0xc1, 0xe7, 0x9e, 0x87, 0x00, 0x5a, 0x39, 0x91,
+    0x00, 0x5a, 0x58, 0xcd, 0x74, 0x93, 0x00, 0x5a, 0xb1, 0xcd, 0x73, 0x89,
+    0x00, 0x5a, 0xb8, 0xc4, 0x18, 0xa7, 0x00, 0x5b, 0x31, 0xc3, 0x05, 0x16,
+    0x00, 0x5b, 0x39, 0x16, 0xc1, 0xe7, 0xac, 0x08, 0xc1, 0xe7, 0xb8, 0x15,
+    0xc1, 0xe7, 0xc4, 0xc5, 0x0a, 0xfd, 0x00, 0x5b, 0x71, 0xc4, 0x28, 0x74,
+    0x00, 0x5b, 0x78, 0x44, 0x05, 0x16, 0xc1, 0xe7, 0xd0, 0x46, 0x03, 0xdf,
+    0x41, 0xe7, 0xe8, 0x0b, 0xc1, 0xe7, 0xf4, 0x11, 0x41, 0xe8, 0x06, 0x0a,
+    0xc1, 0xe8, 0x18, 0x19, 0xc1, 0xe8, 0x2a, 0xc2, 0x00, 0x79, 0x0f, 0x68,
+    0x52, 0x01, 0xe8, 0x3a, 0x01, 0x41, 0xe8, 0x40, 0xc2, 0x24, 0x36, 0x0f,
+    0x68, 0x33, 0x01, 0xe8, 0x4c, 0xc4, 0x17, 0xf7, 0x0f, 0x68, 0x3a, 0x01,
+    0xe8, 0x59, 0x9b, 0x0f, 0x68, 0x8b, 0x01, 0xe8, 0x66, 0x01, 0x41, 0xe8,
+    0x6c, 0xc2, 0x0c, 0xf3, 0x0f, 0x68, 0x93, 0x01, 0xe8, 0x78, 0x01, 0x41,
+    0xe8, 0x7e, 0xc2, 0x01, 0xa2, 0x0f, 0x69, 0x7b, 0x01, 0xe8, 0x8a, 0xc4,
+    0x03, 0xe0, 0x0f, 0x69, 0x81, 0xc2, 0x00, 0x79, 0x0f, 0x69, 0xba, 0x01,
+    0xe8, 0x90, 0xc3, 0x04, 0xa0, 0x0f, 0x69, 0x8b, 0x01, 0xe8, 0x96, 0xc3,
+    0x0c, 0xf7, 0x0f, 0x69, 0x90, 0xc2, 0x24, 0x36, 0x0f, 0x69, 0x9b, 0x01,
+    0xe8, 0x9c, 0xc4, 0x17, 0xf7, 0x0f, 0x69, 0xa0, 0xc6, 0x71, 0x52, 0x01,
+    0x01, 0x21, 0xd9, 0x10, 0x35, 0x01, 0x71, 0x58, 0x42, 0x02, 0x0b, 0xc1,
+    0xe8, 0xa2, 0x47, 0x0d, 0xdf, 0xc1, 0xe8, 0xae, 0x42, 0x00, 0xd3, 0xc1,
+    0xe8, 0xc6, 0x08, 0xc1, 0xe8, 0xd0, 0xc4, 0x04, 0x5b, 0x0f, 0xa8, 0x99,
+    0x4d, 0x7a, 0x5a, 0xc1, 0xe8, 0xdc, 0xca, 0x75, 0x22, 0x0f, 0xa2, 0x80,
+    0xd9, 0x1d, 0x8a, 0x01, 0x3d, 0xf1, 0x4f, 0x62, 0xf0, 0x41, 0xe8, 0xe8,
+    0xce, 0x1a, 0x58, 0x0b, 0x7f, 0x19, 0xc9, 0xa8, 0x65, 0x0b, 0x7f, 0x10,
+    0x4c, 0x10, 0x43, 0xc1, 0xe8, 0xf4, 0x4a, 0x57, 0x0d, 0xc1, 0xe9, 0x06,
+    0x47, 0x01, 0x92, 0x41, 0xe9, 0x12, 0x46, 0xc0, 0xef, 0xc1, 0xe9, 0x68,
+    0x4c, 0x8a, 0x18, 0x41, 0xe9, 0x78, 0x47, 0x37, 0xb8, 0xc1, 0xe9, 0x84,
+    0x4d, 0x28, 0xa7, 0xc1, 0xe9, 0x99, 0x4f, 0x09, 0x39, 0x41, 0xe9, 0xd4,
+    0x47, 0xc8, 0x96, 0xc1, 0xea, 0x0f, 0x48, 0xbe, 0xb0, 0x41, 0xea, 0x2e,
+    0x47, 0x37, 0xb8, 0xc1, 0xea, 0x47, 0x47, 0x01, 0x92, 0x41, 0xea, 0x51,
+    0x15, 0xc1, 0xea, 0xb3, 0x4b, 0x52, 0x4b, 0x41, 0xea, 0xbf, 0x47, 0x01,
+    0x92, 0xc1, 0xeb, 0x32, 0x48, 0x52, 0xb0, 0x41, 0xeb, 0x8f, 0xcd, 0x7e,
+    0x5d, 0x00, 0xe3, 0xf9, 0xc6, 0x7e, 0x64, 0x00, 0xe3, 0xf0, 0x8a, 0x00,
+    0xe3, 0xb9, 0x98, 0x00, 0xe3, 0xb1, 0x84, 0x00, 0xe3, 0xa9, 0xc2, 0x01,
+    0x94, 0x00, 0xe3, 0xa0, 0x91, 0x00, 0xe3, 0x99, 0x87, 0x00, 0xe3, 0x71,
+    0x97, 0x00, 0xe3, 0x49, 0x8b, 0x00, 0xe3, 0x21, 0x83, 0x00, 0xe2, 0xd2,
+    0x01, 0xeb, 0xa1, 0xc2, 0x00, 0x84, 0x00, 0xe3, 0x91, 0x90, 0x00, 0xe3,
+    0x89, 0xc2, 0x01, 0x35, 0x00, 0xe3, 0x81, 0x92, 0x00, 0xe3, 0x78, 0x9b,
+    0x00, 0xe3, 0x69, 0xc2, 0x1b, 0xf2, 0x00, 0xe3, 0x61, 0x86, 0x00, 0xe3,
+    0x59, 0x85, 0x00, 0xe3, 0x50, 0x94, 0x00, 0xe3, 0x41, 0xc2, 0x16, 0xc7,
+    0x00, 0xe3, 0x39, 0x8a, 0x00, 0xe3, 0x31, 0x95, 0x00, 0xe3, 0x28, 0x03,
+    0xc1, 0xeb, 0xa5, 0x8e, 0x00, 0xe2, 0xf1, 0xc2, 0x00, 0xb2, 0x00, 0xe2,
+    0xe9, 0x89, 0x00, 0xe2, 0xe1, 0x96, 0x00, 0xe2, 0xd8, 0xc4, 0x17, 0xf7,
+    0x00, 0xe2, 0xb9, 0xc2, 0x24, 0x36, 0x00, 0xe2, 0xb0, 0xc3, 0x0c, 0xf7,
+    0x00, 0xe2, 0xa9, 0xc3, 0x04, 0xa0, 0x00, 0xe2, 0xa0, 0xc4, 0x03, 0xe0,
+    0x00, 0xe2, 0x99, 0xc2, 0x01, 0xa2, 0x00, 0xe2, 0x90, 0x46, 0x00, 0xbb,
+    0xc1, 0xeb, 0xb5, 0xcd, 0x4e, 0xc4, 0x01, 0x5d, 0xe0, 0xc9, 0xb3, 0xa5,
+    0x00, 0xb4, 0xc9, 0xc5, 0xd5, 0x99, 0x00, 0xb4, 0xa9, 0xc5, 0xcc, 0xed,
+    0x00, 0xb4, 0x98, 0xc3, 0x01, 0x3a, 0x00, 0xb4, 0xc1, 0xc6, 0xcc, 0xec,
+    0x00, 0xb4, 0xa0, 0xc7, 0xc6, 0x7b, 0x00, 0xb4, 0xb9, 0x94, 0x00, 0xb4,
+    0x91, 0xc3, 0x03, 0x49, 0x00, 0xb4, 0x30, 0x94, 0x00, 0xb4, 0xb1, 0xc2,
+    0x1b, 0xf2, 0x00, 0xb4, 0x88, 0xc5, 0xd6, 0xed, 0x00, 0xb4, 0x71, 0xc3,
+    0x14, 0xc5, 0x00, 0xb4, 0x20, 0xc6, 0xce, 0x48, 0x00, 0xb4, 0x69, 0xc3,
+    0x00, 0x46, 0x00, 0xb4, 0x28, 0xc4, 0xe0, 0x78, 0x00, 0xb4, 0x51, 0xc3,
+    0x1e, 0xb4, 0x00, 0xb4, 0x48, 0xc3, 0x00, 0x2f, 0x08, 0x24, 0x01, 0x83,
+    0x08, 0x24, 0xd8, 0xc2, 0x00, 0xce, 0x08, 0x24, 0x29, 0xc3, 0xb5, 0xc2,
+    0x08, 0x24, 0x78, 0xc3, 0x0e, 0xa4, 0x08, 0x24, 0x31, 0xc2, 0x00, 0xce,
+    0x08, 0x24, 0x50, 0x83, 0x08, 0x24, 0x41, 0xc4, 0xdf, 0x70, 0x08, 0x24,
+    0x48, 0x87, 0x08, 0x24, 0xe0, 0x91, 0x08, 0x24, 0xe8, 0xc2, 0x01, 0xa2,
+    0x08, 0x25, 0x11, 0xc4, 0x03, 0xe0, 0x08, 0x25, 0x18, 0xc3, 0x04, 0xa0,
+    0x08, 0x25, 0x21, 0xc3, 0x0c, 0xf7, 0x08, 0x25, 0x28, 0xc2, 0x24, 0x36,
+    0x08, 0x25, 0x31, 0xc4, 0x17, 0xf7, 0x08, 0x25, 0x38, 0x8b, 0x08, 0x25,
+    0x8b, 0x01, 0xeb, 0xc1, 0x8a, 0x08, 0x25, 0x98, 0x0a, 0xc1, 0xeb, 0xc5,
+    0xc2, 0x00, 0xaf, 0x08, 0x25, 0xc0, 0x83, 0x08, 0x25, 0xc9, 0xc2, 0x1a,
+    0x18, 0x08, 0x25, 0xd0, 0x83, 0x08, 0x25, 0xe1, 0xc2, 0x1a, 0x18, 0x08,
+    0x25, 0xf1, 0xc2, 0x00, 0xce, 0x08, 0x26, 0x80, 0xc2, 0x00, 0xaf, 0x08,
+    0x26, 0x18, 0x83, 0x08, 0x26, 0x31, 0xc2, 0x00, 0xce, 0x08, 0x26, 0x38,
+    0x83, 0x08, 0x26, 0x41, 0x15, 0x41, 0xeb, 0xdb, 0x83, 0x08, 0x26, 0x91,
+    0xc2, 0x00, 0xce, 0x08, 0x26, 0x98, 0x8b, 0x08, 0x26, 0xcb, 0x01, 0xeb,
+    0xe5, 0x8a, 0x08, 0x26, 0xd8, 0x0a, 0xc1, 0xeb, 0xe9, 0xc2, 0x00, 0xaf,
+    0x08, 0x27, 0x00, 0x83, 0x08, 0x27, 0x09, 0xc2, 0x1a, 0x18, 0x08, 0x27,
+    0x10, 0x83, 0x08, 0x27, 0x21, 0xc2, 0x1a, 0x18, 0x08, 0x27, 0x31, 0xc2,
+    0x00, 0xce, 0x08, 0x27, 0xc0, 0xc2, 0x00, 0xaf, 0x08, 0x27, 0x58, 0x83,
+    0x08, 0x27, 0x71, 0xc2, 0x00, 0xce, 0x08, 0x27, 0x78, 0x83, 0x08, 0x27,
+    0x81, 0x15, 0x41, 0xeb, 0xff, 0x83, 0x08, 0x27, 0xd1, 0xc2, 0x00, 0xce,
+    0x08, 0x27, 0xd8, 0xc2, 0x14, 0x13, 0x0e, 0x7e, 0x19, 0xc3, 0xa3, 0x10,
+    0x0e, 0x7a, 0xe1, 0xc6, 0xd0, 0x70, 0x0e, 0x7a, 0x90, 0xc8, 0xb9, 0x20,
+    0x0e, 0x7c, 0x81, 0xc8, 0x98, 0xfb, 0x0e, 0x7b, 0x80, 0xcf, 0x69, 0x8f,
+    0x0e, 0x7a, 0xc8, 0xd0, 0x5d, 0x82, 0x0e, 0x7b, 0xa9, 0xc6, 0xce, 0xde,
+    0x0e, 0x7b, 0x68, 0x01, 0x41, 0xec, 0x09, 0xc2, 0x25, 0x73, 0x0e, 0x7c,
+    0x09, 0xc2, 0x14, 0x13, 0x0e, 0x7a, 0x82, 0x01, 0xec, 0x19, 0x45, 0xd3,
+    0xdc, 0xc1, 0xec, 0x1f, 0xc4, 0xe1, 0x60, 0x0e, 0x7c, 0x33, 0x01, 0xec,
+    0x43, 0xc6, 0xd3, 0x40, 0x0e, 0x7a, 0xb2, 0x01, 0xec, 0x47, 0x01, 0x41,
+    0xec, 0x4b, 0x4d, 0x7e, 0xb8, 0xc1, 0xec, 0x57, 0x47, 0x85, 0x15, 0xc1,
+    0xec, 0x6f, 0x16, 0xc1, 0xec, 0x7b, 0xc8, 0x4a, 0x93, 0x0e, 0x7b, 0x91,
+    0xc9, 0xb1, 0x65, 0x0e, 0x7b, 0x88, 0x47, 0x85, 0x15, 0xc1, 0xec, 0x87,
+    0xc7, 0xc6, 0x27, 0x0e, 0x7d, 0x40, 0xc7, 0x2e, 0x65, 0x0e, 0x7a, 0xe9,
+    0xc6, 0xcc, 0x56, 0x0e, 0x7a, 0xa8, 0xcb, 0x93, 0xdc, 0x0e, 0x7b, 0x51,
+    0xc8, 0x4a, 0x93, 0x0e, 0x7b, 0x49, 0xc9, 0xb1, 0x65, 0x0e, 0x7b, 0x41,
+    0xc8, 0xbd, 0x80, 0x0e, 0x7b, 0x38, 0xc8, 0xb7, 0x90, 0x0e, 0x7b, 0x11,
+    0xc4, 0xd2, 0xbe, 0x0e, 0x7a, 0xf8, 0xc4, 0x7e, 0xc8, 0x0e, 0x7a, 0x03,
+    0x01, 0xec, 0x99, 0xc5, 0xd8, 0xb4, 0x0e, 0x79, 0x49, 0xc6, 0xcd, 0xbe,
+    0x0e, 0x79, 0x40, 0xca, 0xa2, 0x4a, 0x0e, 0x79, 0xf9, 0xc6, 0xd3, 0x2e,
+    0x0e, 0x79, 0xc2, 0x01, 0xec, 0x9f, 0xc9, 0xaa, 0xc9, 0x0e, 0x79, 0xe9,
+    0xd4, 0x3f, 0x36, 0x0e, 0x79, 0xa0, 0xc5, 0xb5, 0x53, 0x0e, 0x79, 0xe1,
+    0xc6, 0x6f, 0x22, 0x0e, 0x79, 0x19, 0x45, 0xdc, 0x4c, 0x41, 0xec, 0xa5,
+    0xce, 0x3c, 0x6c, 0x0e, 0x79, 0xd9, 0xc4, 0xe0, 0x38, 0x0e, 0x79, 0x59,
+    0xd3, 0x40, 0xee, 0x0e, 0x78, 0xd1, 0x49, 0xb3, 0xe4, 0x41, 0xec, 0xb1,
+    0xc7, 0xc6, 0x0b, 0x0e, 0x79, 0xd1, 0xc7, 0xc6, 0x90, 0x0e, 0x79, 0xa9,
+    0x90, 0x0e, 0x79, 0x08, 0x06, 0xc1, 0xec, 0xbd, 0x46, 0x77, 0xf1, 0x41,
+    0xec, 0xcc, 0xc8, 0x3f, 0x42, 0x0e, 0x79, 0x99, 0x07, 0x41, 0xec, 0xd6,
+    0xc5, 0xd8, 0x8c, 0x0e, 0x79, 0x61, 0xc3, 0xe5, 0x32, 0x0e, 0x79, 0x10,
+    0xc6, 0xc4, 0x67, 0x0e, 0x78, 0xf9, 0x46, 0xce, 0x66, 0x41, 0xec, 0xe2,
+    0x15, 0xc1, 0xec, 0xee, 0x43, 0x00, 0x47, 0x41, 0xec, 0xfa, 0x43, 0x3a,
+    0x9e, 0xc1, 0xed, 0x06, 0x43, 0x00, 0x47, 0x41, 0xed, 0x12, 0x43, 0x00,
+    0x47, 0xc1, 0xed, 0x1e, 0x4d, 0x7e, 0xc5, 0x41, 0xed, 0x2a, 0xc5, 0x40,
+    0xb0, 0x08, 0xd1, 0xc9, 0xc4, 0x1f, 0xf7, 0x08, 0xd1, 0xa0, 0xce, 0x1e,
+    0x44, 0x08, 0xd1, 0xb9, 0xc5, 0x1f, 0xef, 0x08, 0xd1, 0xaa, 0x01, 0xed,
+    0x36, 0xc2, 0x02, 0x63, 0x08, 0xd1, 0xf1, 0xc2, 0x00, 0x89, 0x08, 0xd1,
+    0xe9, 0xc2, 0x00, 0x3b, 0x08, 0xd1, 0xe1, 0xc2, 0x1a, 0x18, 0x08, 0xd1,
+    0xd8, 0xc2, 0x00, 0xce, 0x08, 0xd1, 0x31, 0x83, 0x08, 0xd1, 0x28, 0xc2,
+    0x00, 0xce, 0x08, 0xd0, 0xb9, 0x83, 0x08, 0xd0, 0xb0, 0xc2, 0x00, 0xce,
+    0x08, 0xd1, 0x21, 0x83, 0x08, 0xd1, 0x18, 0xc2, 0x00, 0xce, 0x08, 0xd0,
+    0xa9, 0x83, 0x08, 0xd0, 0xa0, 0x97, 0x08, 0xd0, 0x41, 0x8b, 0x08, 0xd0,
+    0x38, 0x87, 0x08, 0xd0, 0x28, 0x87, 0x08, 0xd0, 0x10, 0xc9, 0xa8, 0x1d,
+    0x01, 0x51, 0x09, 0xc5, 0xdb, 0x34, 0x01, 0x51, 0x00, 0x03, 0xc1, 0xed,
+    0x3c, 0x12, 0xc1, 0xed, 0x4b, 0xc5, 0xd3, 0xb9, 0x05, 0x4e, 0x31, 0x0e,
+    0xc1, 0xed, 0x57, 0xc5, 0xdb, 0xca, 0x05, 0x4e, 0x21, 0xcd, 0x75, 0xd5,
+    0x05, 0x4e, 0xf1, 0xc9, 0xab, 0x62, 0x05, 0x4e, 0xf8, 0xc7, 0xc1, 0x42,
+    0x05, 0x4e, 0x79, 0xc3, 0x1e, 0x9c, 0x05, 0x4e, 0x00, 0xc2, 0x00, 0xeb,
+    0x05, 0x4c, 0x93, 0x01, 0xed, 0x61, 0xc2, 0x00, 0xce, 0x05, 0x4d, 0x91,
+    0xc2, 0x0d, 0x01, 0x05, 0x4d, 0x8b, 0x01, 0xed, 0x67, 0xc2, 0x00, 0x71,
+    0x05, 0x4d, 0x71, 0xc2, 0x00, 0x89, 0x05, 0x4d, 0x69, 0xc2, 0x00, 0x3b,
+    0x05, 0x4d, 0x5b, 0x01, 0xed, 0x6d, 0xc2, 0x1a, 0x18, 0x05, 0x4d, 0x51,
+    0xc2, 0x00, 0xb6, 0x05, 0x4d, 0x49, 0xc2, 0x00, 0xa0, 0x05, 0x4d, 0x3b,
+    0x01, 0xed, 0x73, 0xc2, 0x04, 0xf2, 0x05, 0x4d, 0x2b, 0x01, 0xed, 0x79,
+    0x10, 0xc1, 0xed, 0x7d, 0x06, 0xc1, 0xed, 0x96, 0x16, 0xc1, 0xed, 0xa6,
+    0xc2, 0x21, 0x7d, 0x05, 0x4c, 0xbb, 0x01, 0xed, 0xb6, 0xc2, 0x03, 0xc6,
+    0x05, 0x4c, 0xab, 0x01, 0xed, 0xbc, 0xc2, 0x02, 0x4d, 0x05, 0x4c, 0x7b,
+    0x01, 0xed, 0xc2, 0x91, 0x05, 0x4c, 0x71, 0x83, 0x05, 0x4c, 0x23, 0x01,
+    0xed, 0xc6, 0x87, 0x05, 0x4c, 0x61, 0x97, 0x05, 0x4c, 0x41, 0x8b, 0x05,
+    0x4c, 0x32, 0x01, 0xed, 0xca, 0xc4, 0x03, 0xe0, 0x05, 0x4e, 0x99, 0xc2,
+    0x01, 0xa2, 0x05, 0x4e, 0x90, 0xc3, 0x04, 0xa0, 0x05, 0x4e, 0xa1, 0xc3,
+    0x0c, 0xf7, 0x05, 0x4e, 0xa8, 0xc2, 0x24, 0x36, 0x05, 0x4e, 0xb1, 0xc4,
+    0x17, 0xf7, 0x05, 0x4e, 0xb8, 0x03, 0xc1, 0xed, 0xd4, 0xc5, 0x0d, 0xc8,
+    0x05, 0x4d, 0xa8, 0xc7, 0xc3, 0xe2, 0x05, 0x4d, 0xc8, 0xc6, 0xcd, 0x46,
+    0x05, 0x4d, 0xb8, 0xc5, 0xd8, 0x78, 0x05, 0x4d, 0x98, 0xc5, 0x00, 0x64,
+    0x01, 0x2c, 0xeb, 0x01, 0xed, 0xe0, 0xc4, 0x00, 0x2f, 0x01, 0x2c, 0xc2,
+    0x01, 0xed, 0xe9, 0xc5, 0x00, 0x64, 0x01, 0x2c, 0xb9, 0xc4, 0x00, 0x2f,
+    0x01, 0x2c, 0xb0, 0x0c, 0xc1, 0xed, 0xef, 0x14, 0xc1, 0xee, 0x0b, 0x09,
+    0xc1, 0xee, 0x2e, 0x1c, 0xc1, 0xee, 0x55, 0x1b, 0xc1, 0xee, 0x7c, 0x04,
+    0xc1, 0xee, 0x91, 0x06, 0xc1, 0xee, 0xb4, 0x8b, 0x05, 0x0b, 0xfb, 0x01,
+    0xee, 0xd7, 0x83, 0x05, 0x0c, 0x2b, 0x01, 0xee, 0xea, 0x97, 0x05, 0x0c,
+    0x9b, 0x01, 0xee, 0xf2, 0x91, 0x05, 0x0c, 0x63, 0x01, 0xef, 0x0c, 0x87,
+    0x05, 0x0c, 0x7a, 0x01, 0xef, 0x18, 0x0c, 0xc1, 0xef, 0x20, 0x9b, 0x05,
+    0x1f, 0xc3, 0x01, 0xef, 0x3c, 0x97, 0x05, 0x1f, 0x93, 0x01, 0xef, 0x4f,
+    0x91, 0x05, 0x1f, 0x73, 0x01, 0xef, 0x69, 0x8b, 0x05, 0x1f, 0x12, 0x01,
+    0xef, 0x75, 0x9b, 0x05, 0x20, 0xa3, 0x01, 0xef, 0x88, 0x97, 0x05, 0x20,
+    0x73, 0x01, 0xef, 0x9b, 0x91, 0x05, 0x20, 0x53, 0x01, 0xef, 0xb5, 0x8b,
+    0x05, 0x1f, 0xf2, 0x01, 0xef, 0xc1, 0x9b, 0x05, 0x1e, 0xe3, 0x01, 0xef,
+    0xd4, 0x97, 0x05, 0x1e, 0xb3, 0x01, 0xef, 0xe7, 0x87, 0x05, 0x1e, 0x93,
+    0x01, 0xf0, 0x01, 0x91, 0x05, 0x1e, 0x7b, 0x01, 0xf0, 0x09, 0x83, 0x05,
+    0x1e, 0x43, 0x01, 0xf0, 0x15, 0x14, 0x41, 0xf0, 0x21, 0x0a, 0xc1, 0xf0,
+    0x44, 0x15, 0xc1, 0xf0, 0x67, 0x9b, 0x05, 0x19, 0x33, 0x01, 0xf0, 0x91,
+    0x97, 0x05, 0x19, 0x03, 0x01, 0xf0, 0xa4, 0x8b, 0x05, 0x18, 0x5b, 0x01,
+    0xf0, 0xbe, 0x83, 0x05, 0x18, 0x93, 0x01, 0xf0, 0xd1, 0x91, 0x05, 0x18,
+    0xcb, 0x01, 0xf0, 0xdd, 0x87, 0x05, 0x18, 0xe2, 0x01, 0xf0, 0xe9, 0x0a,
+    0xc1, 0xf0, 0xf1, 0x8b, 0x05, 0x15, 0x83, 0x01, 0xf1, 0x14, 0x83, 0x05,
+    0x15, 0xc3, 0x01, 0xf1, 0x27, 0x97, 0x05, 0x16, 0x33, 0x01, 0xf1, 0x33,
+    0x91, 0x05, 0x15, 0xfb, 0x01, 0xf1, 0x4d, 0x87, 0x05, 0x16, 0x13, 0x01,
+    0xf1, 0x59, 0x9b, 0x05, 0x16, 0x62, 0x01, 0xf1, 0x61, 0x0a, 0xc1, 0xf1,
+    0x74, 0x87, 0x05, 0x15, 0x03, 0x01, 0xf1, 0x97, 0x91, 0x05, 0x14, 0xeb,
+    0x01, 0xf1, 0x9f, 0x97, 0x05, 0x15, 0x23, 0x01, 0xf1, 0xab, 0x83, 0x05,
+    0x14, 0xb3, 0x01, 0xf1, 0xc5, 0x8b, 0x05, 0x14, 0x7b, 0x01, 0xf1, 0xd1,
+    0x9b, 0x05, 0x15, 0x53, 0x01, 0xf1, 0xe4, 0x1c, 0x41, 0xf1, 0xf7, 0x87,
+    0x05, 0x14, 0x5b, 0x01, 0xf2, 0x21, 0x91, 0x05, 0x14, 0x43, 0x01, 0xf2,
+    0x29, 0x97, 0x05, 0x00, 0xab, 0x01, 0xf2, 0x31, 0x83, 0x05, 0x14, 0x12,
+    0x01, 0xf2, 0x38, 0x87, 0x05, 0x13, 0xf3, 0x01, 0xf2, 0x44, 0x91, 0x05,
+    0x13, 0xdb, 0x01, 0xf2, 0x4c, 0xc2, 0x01, 0x5c, 0x05, 0x13, 0xbb, 0x01,
+    0xf2, 0x58, 0x83, 0x05, 0x13, 0x9b, 0x01, 0xf2, 0x64, 0x0b, 0xc1, 0xf2,
+    0x70, 0x1a, 0xc1, 0xf2, 0x7b, 0x0f, 0xc1, 0xf2, 0xa0, 0x10, 0xc1, 0xf2,
+    0xc3, 0x0e, 0x41, 0xf2, 0xe0, 0x09, 0xc1, 0xf3, 0x0a, 0x8b, 0x05, 0x05,
+    0x83, 0x01, 0xf3, 0x2f, 0x83, 0x05, 0x05, 0xbb, 0x01, 0xf3, 0x42, 0x97,
+    0x05, 0x06, 0x2b, 0x01, 0xf3, 0x4e, 0x91, 0x05, 0x05, 0xfb, 0x01, 0xf3,
+    0x68, 0x87, 0x05, 0x06, 0x13, 0x01, 0xf3, 0x74, 0x9b, 0x05, 0x06, 0x5a,
+    0x01, 0xf3, 0x78, 0x09, 0xc1, 0xf3, 0x84, 0x8b, 0x05, 0x0e, 0xe3, 0x01,
+    0xf3, 0xa7, 0x83, 0x05, 0x0f, 0x23, 0x01, 0xf3, 0xba, 0x97, 0x05, 0x0f,
+    0xa3, 0x01, 0xf3, 0xc6, 0x91, 0x05, 0x0f, 0x63, 0x01, 0xf3, 0xe0, 0x87,
+    0x05, 0x0f, 0x82, 0x01, 0xf3, 0xec, 0x8b, 0x05, 0x22, 0xfb, 0x01, 0xf3,
+    0xf8, 0xc2, 0x01, 0x5c, 0x05, 0x23, 0x33, 0x01, 0xf4, 0x0b, 0x91, 0x05,
+    0x23, 0x4b, 0x01, 0xf4, 0x0f, 0x9b, 0x05, 0x23, 0x6a, 0x01, 0xf4, 0x1b,
+    0x8b, 0x05, 0x23, 0x9b, 0x01, 0xf4, 0x2e, 0x97, 0x05, 0x24, 0x1b, 0x01,
+    0xf4, 0x41, 0x91, 0x05, 0x23, 0xfb, 0x01, 0xf4, 0x5b, 0x9b, 0x05, 0x24,
+    0x4a, 0x01, 0xf4, 0x67, 0x96, 0x05, 0x00, 0x03, 0x01, 0xf4, 0x7a, 0x9a,
+    0x05, 0x00, 0x09, 0x92, 0x05, 0x00, 0x19, 0x87, 0x05, 0x00, 0x32, 0x01,
+    0xf4, 0x80, 0x96, 0x05, 0x00, 0x41, 0x9a, 0x05, 0x00, 0x49, 0x92, 0x05,
+    0x00, 0x58, 0x9a, 0x05, 0x00, 0x61, 0x92, 0x05, 0x00, 0x70, 0x96, 0x05,
+    0x00, 0x79, 0x9a, 0x05, 0x00, 0x81, 0x92, 0x05, 0x00, 0x90, 0x9a, 0x05,
+    0x00, 0x98, 0x8b, 0x05, 0x00, 0xc3, 0x01, 0xf4, 0x8c, 0x83, 0x05, 0x01,
+    0x03, 0x01, 0xf4, 0x9f, 0x97, 0x05, 0x01, 0x73, 0x01, 0xf4, 0xab, 0x91,
+    0x05, 0x01, 0x3b, 0x01, 0xf4, 0xc5, 0x87, 0x05, 0x01, 0x53, 0x01, 0xf4,
+    0xd1, 0x9b, 0x05, 0x01, 0xa3, 0x01, 0xf4, 0xd9, 0x04, 0x41, 0xf4, 0xec,
+    0x8b, 0x05, 0x01, 0xd3, 0x01, 0xf5, 0x16, 0x83, 0x05, 0x02, 0x0b, 0x01,
+    0xf5, 0x29, 0x97, 0x05, 0x02, 0x63, 0x01, 0xf5, 0x35, 0x91, 0x05, 0x02,
+    0x43, 0x01, 0xf5, 0x4f, 0x9b, 0x05, 0x02, 0x92, 0x01, 0xf5, 0x5b, 0x8b,
+    0x05, 0x06, 0x7b, 0x01, 0xf5, 0x6e, 0x83, 0x05, 0x06, 0x9b, 0x01, 0xf5,
+    0x7a, 0x91, 0x05, 0x06, 0xb3, 0x01, 0xf5, 0x86, 0x97, 0x05, 0x06, 0xd3,
+    0x01, 0xf5, 0x8e, 0x9b, 0x05, 0x07, 0x02, 0x01, 0xf5, 0xa1, 0x8b, 0x05,
+    0x07, 0x23, 0x01, 0xf5, 0xad, 0x83, 0x05, 0x07, 0x63, 0x01, 0xf5, 0xc0,
+    0x91, 0x05, 0x07, 0x83, 0x01, 0xf5, 0xcc, 0x07, 0xc1, 0xf5, 0xd8, 0x97,
+    0x05, 0x07, 0xb3, 0x01, 0xf5, 0xe0, 0x9b, 0x05, 0x07, 0xe2, 0x01, 0xf5,
+    0xf3, 0x8b, 0x05, 0x08, 0x13, 0x01, 0xf6, 0x06, 0x83, 0x05, 0x08, 0x4b,
+    0x01, 0xf6, 0x19, 0x97, 0x05, 0x08, 0xb3, 0x01, 0xf6, 0x25, 0x91, 0x05,
+    0x08, 0x7b, 0x01, 0xf6, 0x3f, 0x87, 0x05, 0x08, 0x93, 0x01, 0xf6, 0x4b,
+    0x06, 0x41, 0xf6, 0x53, 0x8b, 0x05, 0x08, 0xe3, 0x01, 0xf6, 0x76, 0x83,
+    0x05, 0x09, 0x1b, 0x01, 0xf6, 0x89, 0x97, 0x05, 0x09, 0x93, 0x01, 0xf6,
+    0x95, 0x91, 0x05, 0x09, 0x5b, 0x01, 0xf6, 0xaf, 0x87, 0x05, 0x09, 0x72,
+    0x01, 0xf6, 0xbb, 0x8b, 0x05, 0x0d, 0xcb, 0x01, 0xf6, 0xc3, 0x83, 0x05,
+    0x0e, 0x0b, 0x01, 0xf6, 0xd6, 0x97, 0x05, 0x0e, 0x83, 0x01, 0xf6, 0xe2,
+    0x91, 0x05, 0x0e, 0x4b, 0x01, 0xf6, 0xfc, 0x87, 0x05, 0x0e, 0x63, 0x01,
+    0xf7, 0x08, 0x9b, 0x05, 0x0e, 0xb2, 0x01, 0xf7, 0x10, 0x8b, 0x05, 0x0f,
+    0xd3, 0x01, 0xf7, 0x23, 0x83, 0x05, 0x10, 0x0b, 0x01, 0xf7, 0x36, 0x97,
+    0x05, 0x10, 0x83, 0x01, 0xf7, 0x42, 0x91, 0x05, 0x10, 0x43, 0x01, 0xf7,
+    0x5c, 0x87, 0x05, 0x10, 0x62, 0x01, 0xf7, 0x68, 0x8b, 0x05, 0x24, 0x8b,
+    0x01, 0xf7, 0x74, 0xc2, 0x1e, 0x72, 0x05, 0x24, 0xd0, 0xc2, 0x00, 0x93,
+    0x05, 0x24, 0x91, 0x87, 0x05, 0x26, 0x30, 0x1b, 0xc1, 0xf7, 0x78, 0xc3,
+    0xe4, 0x93, 0x05, 0x25, 0xa1, 0xc3, 0xa9, 0x4b, 0x05, 0x26, 0x28, 0x9b,
+    0x05, 0x25, 0xe3, 0x01, 0xf7, 0x84, 0xc3, 0xd3, 0x3f, 0x05, 0x25, 0xe9,
+    0xc2, 0x02, 0x13, 0x05, 0x25, 0xf1, 0xc2, 0x00, 0x61, 0x05, 0x26, 0x18,
+    0xc2, 0x00, 0x8d, 0x05, 0x24, 0xa9, 0x0a, 0x41, 0xf7, 0x8c, 0x09, 0xc1,
+    0xf7, 0xa2, 0xc2, 0x02, 0x59, 0x05, 0x24, 0xb9, 0x83, 0x05, 0x25, 0x09,
+    0xc2, 0x01, 0x5d, 0x05, 0x25, 0xb0, 0x8b, 0x05, 0x24, 0xc1, 0xc2, 0x00,
+    0x11, 0x05, 0x24, 0xe0, 0x1a, 0xc1, 0xf7, 0xae, 0xc2, 0x08, 0x04, 0x05,
+    0x25, 0x68, 0xc3, 0x06, 0x4c, 0x05, 0x24, 0xd9, 0xc2, 0x00, 0x35, 0x05,
+    0x25, 0x28, 0x91, 0x05, 0x24, 0xe9, 0xc2, 0x00, 0x93, 0x05, 0x25, 0x70,
+    0xc2, 0x06, 0x4d, 0x05, 0x24, 0xf1, 0xc2, 0x62, 0x5e, 0x05, 0x25, 0x60,
+    0xc2, 0x01, 0x17, 0x05, 0x25, 0x01, 0x97, 0x05, 0x25, 0x40, 0x17, 0xc1,
+    0xf7, 0xc0, 0xc2, 0x01, 0x5d, 0x05, 0x25, 0x59, 0x83, 0x05, 0x25, 0x91,
+    0xc4, 0xe3, 0x28, 0x05, 0x26, 0x20, 0xc3, 0x63, 0x6d, 0x05, 0x25, 0x21,
+    0x97, 0x05, 0x25, 0xc8, 0x0c, 0xc1, 0xf7, 0xc8, 0x91, 0x05, 0x25, 0x98,
+    0xc2, 0x00, 0x35, 0x05, 0x25, 0x79, 0xc2, 0x02, 0x59, 0x05, 0x25, 0x88,
+    0xd6, 0x31, 0x58, 0x08, 0x75, 0x88, 0xcf, 0x33, 0x31, 0x08, 0x75, 0x80,
+    0x96, 0x08, 0x75, 0x49, 0x99, 0x08, 0x75, 0x31, 0xc2, 0x14, 0xdf, 0x08,
+    0x74, 0xb9, 0xc3, 0x66, 0x75, 0x08, 0x74, 0x00, 0xc2, 0x0d, 0x1d, 0x08,
+    0x75, 0x39, 0xc2, 0x00, 0xce, 0x08, 0x74, 0x48, 0xc3, 0x47, 0x66, 0x08,
+    0x74, 0xf1, 0xc2, 0x0f, 0xbb, 0x08, 0x74, 0xe8, 0xcf, 0x6a, 0x7f, 0x08,
+    0x74, 0xd8, 0xc4, 0xe1, 0x14, 0x08, 0x74, 0xc1, 0x83, 0x08, 0x74, 0x50,
+    0x87, 0x08, 0x74, 0xb1, 0x83, 0x08, 0x74, 0x7a, 0x01, 0xf7, 0xd8, 0x83,
+    0x08, 0x74, 0xa9, 0xc2, 0x00, 0x61, 0x08, 0x74, 0x20, 0x86, 0x08, 0x74,
+    0xa1, 0x8e, 0x08, 0x74, 0x58, 0xc2, 0x01, 0xe7, 0x08, 0x74, 0x99, 0xc3,
+    0x11, 0x9a, 0x08, 0x74, 0x91, 0xc2, 0x00, 0xaf, 0x08, 0x74, 0x89, 0x87,
+    0x08, 0x74, 0x28, 0xc2, 0x00, 0xce, 0x08, 0x74, 0x71, 0x83, 0x08, 0x74,
+    0x68, 0x0a, 0xc1, 0xf7, 0xdc, 0xc2, 0x00, 0xf0, 0x08, 0x74, 0x30, 0xc2,
+    0x00, 0x61, 0x08, 0x74, 0x19, 0x87, 0x08, 0x74, 0x10, 0x87, 0x05, 0x28,
+    0x03, 0x01, 0xf7, 0xe8, 0x90, 0x05, 0x2f, 0x10, 0x87, 0x05, 0x2f, 0x23,
+    0x01, 0xf7, 0xec, 0x8b, 0x05, 0x29, 0x33, 0x01, 0xf7, 0xf4, 0x83, 0x05,
+    0x2a, 0x63, 0x01, 0xf7, 0xf8, 0x91, 0x05, 0x2d, 0xeb, 0x01, 0xf7, 0xfc,
+    0x97, 0x05, 0x2c, 0xba, 0x01, 0xf8, 0x04, 0x87, 0x05, 0x2f, 0x33, 0x01,
+    0xf8, 0x08, 0x8b, 0x05, 0x29, 0x43, 0x01, 0xf8, 0x13, 0x83, 0x05, 0x2a,
+    0x73, 0x01, 0xf8, 0x17, 0x91, 0x05, 0x2d, 0xfb, 0x01, 0xf8, 0x1b, 0x97,
+    0x05, 0x2c, 0xca, 0x01, 0xf8, 0x26, 0x87, 0x05, 0x2f, 0x43, 0x01, 0xf8,
+    0x2a, 0x8b, 0x05, 0x29, 0x51, 0x83, 0x05, 0x2a, 0x81, 0x91, 0x05, 0x2e,
+    0x0b, 0x01, 0xf8, 0x2e, 0x97, 0x05, 0x2c, 0xd8, 0x0a, 0xc1, 0xf8, 0x32,
+    0x87, 0x05, 0x2f, 0x53, 0x01, 0xf8, 0x4c, 0x8b, 0x05, 0x29, 0x61, 0x83,
+    0x05, 0x2a, 0x91, 0x91, 0x05, 0x2e, 0x1b, 0x01, 0xf8, 0x50, 0x97, 0x05,
+    0x2c, 0xe8, 0x04, 0xc1, 0xf8, 0x54, 0x42, 0x51, 0x45, 0xc1, 0xf8, 0x6e,
+    0x87, 0x05, 0x30, 0x43, 0x01, 0xf8, 0x88, 0x8b, 0x05, 0x2a, 0x31, 0x83,
+    0x05, 0x2b, 0x71, 0x91, 0x05, 0x2e, 0xf3, 0x01, 0xf8, 0x8c, 0x97, 0x05,
+    0x2d, 0xb8, 0x12, 0xc1, 0xf8, 0x90, 0x87, 0x05, 0x30, 0x1b, 0x01, 0xf8,
+    0xad, 0x8b, 0x05, 0x2a, 0x19, 0x83, 0x05, 0x2b, 0x53, 0x01, 0xf8, 0xb1,
+    0x91, 0x05, 0x2e, 0xdb, 0x01, 0xf8, 0xb5, 0x97, 0x05, 0x2d, 0xa0, 0x04,
+    0xc1, 0xf8, 0xb9, 0x87, 0x05, 0x30, 0x33, 0x01, 0xf8, 0xd3, 0x8b, 0x05,
+    0x2a, 0x29, 0x83, 0x05, 0x2b, 0x69, 0x91, 0x05, 0x2e, 0xeb, 0x01, 0xf8,
+    0xdb, 0x97, 0x05, 0x2d, 0xb0, 0x87, 0x05, 0x2f, 0x8b, 0x01, 0xf8, 0xdf,
+    0x8b, 0x05, 0x29, 0x89, 0x83, 0x05, 0x2a, 0xc1, 0x91, 0x05, 0x2e, 0x4b,
+    0x01, 0xf8, 0xe3, 0x97, 0x05, 0x2d, 0x10, 0x87, 0x05, 0x2f, 0x93, 0x01,
+    0xf8, 0xe7, 0x8b, 0x05, 0x29, 0x91, 0x83, 0x05, 0x2a, 0xc9, 0x91, 0x05,
+    0x2e, 0x53, 0x01, 0xf8, 0xeb, 0x97, 0x05, 0x2d, 0x18, 0x87, 0x05, 0x2f,
+    0x9b, 0x01, 0xf8, 0xef, 0x0a, 0xc1, 0xf8, 0xf3, 0x8b, 0x05, 0x29, 0x99,
+    0x83, 0x05, 0x2a, 0xd1, 0x91, 0x05, 0x2e, 0x5b, 0x01, 0xf9, 0x0d, 0x97,
+    0x05, 0x2d, 0x20, 0x0a, 0xc1, 0xf9, 0x11, 0x87, 0x05, 0x2f, 0xcb, 0x01,
+    0xf9, 0x2f, 0x8b, 0x05, 0x29, 0xc9, 0x83, 0x05, 0x2b, 0x01, 0x91, 0x05,
+    0x2e, 0x8b, 0x01, 0xf9, 0x33, 0x97, 0x05, 0x2d, 0x50, 0x87, 0x05, 0x2f,
+    0xbb, 0x01, 0xf9, 0x37, 0x8b, 0x05, 0x29, 0xb9, 0x83, 0x05, 0x2a, 0xf1,
+    0x91, 0x05, 0x2e, 0x7b, 0x01, 0xf9, 0x41, 0x97, 0x05, 0x2d, 0x40, 0x87,
+    0x05, 0x2f, 0xc3, 0x01, 0xf9, 0x45, 0x8b, 0x05, 0x29, 0xc1, 0x83, 0x05,
+    0x2a, 0xf9, 0x91, 0x05, 0x2e, 0x83, 0x01, 0xf9, 0x49, 0x97, 0x05, 0x2d,
+    0x48, 0x06, 0xc1, 0xf9, 0x4d, 0x0c, 0xc1, 0xf9, 0x67, 0x89, 0x05, 0x30,
+    0x5b, 0x01, 0xf9, 0x81, 0x87, 0x05, 0x30, 0x4b, 0x01, 0xf9, 0x97, 0x1b,
+    0xc1, 0xf9, 0x9b, 0x8b, 0x05, 0x2a, 0x39, 0x83, 0x05, 0x2b, 0x79, 0x91,
+    0x05, 0x2e, 0xfb, 0x01, 0xf9, 0xb5, 0x97, 0x05, 0x2d, 0xc0, 0x87, 0x05,
+    0x2f, 0xdb, 0x01, 0xf9, 0xb9, 0x0a, 0xc1, 0xf9, 0xbd, 0x8b, 0x05, 0x29,
+    0xd9, 0x83, 0x05, 0x2b, 0x11, 0x91, 0x05, 0x2e, 0x9b, 0x01, 0xf9, 0xd7,
+    0x97, 0x05, 0x2d, 0x60, 0x87, 0x05, 0x2f, 0xeb, 0x01, 0xf9, 0xdb, 0x0a,
+    0xc1, 0xf9, 0xdf, 0x8b, 0x05, 0x29, 0xe9, 0x83, 0x05, 0x2b, 0x21, 0x91,
+    0x05, 0x2e, 0xab, 0x01, 0xf9, 0xf9, 0x97, 0x05, 0x2d, 0x70, 0x87, 0x05,
+    0x2f, 0xfb, 0x01, 0xf9, 0xfd, 0x8b, 0x05, 0x29, 0xf9, 0x83, 0x05, 0x2b,
+    0x31, 0x91, 0x05, 0x2e, 0xbb, 0x01, 0xfa, 0x01, 0x97, 0x05, 0x2d, 0x80,
+    0x87, 0x05, 0x30, 0x03, 0x01, 0xfa, 0x05, 0x8b, 0x05, 0x2a, 0x01, 0x83,
+    0x05, 0x2b, 0x39, 0x91, 0x05, 0x2e, 0xc3, 0x01, 0xfa, 0x09, 0x97, 0x05,
+    0x2d, 0x88, 0x87, 0x05, 0x30, 0x13, 0x01, 0xfa, 0x0d, 0x8b, 0x05, 0x2a,
+    0x11, 0x83, 0x05, 0x2b, 0x49, 0x91, 0x05, 0x2e, 0xd3, 0x01, 0xfa, 0x11,
+    0x97, 0x05, 0x2d, 0x98, 0x90, 0x05, 0x29, 0x28, 0x90, 0x05, 0x2a, 0x50,
+    0x91, 0x05, 0x2b, 0x8b, 0x01, 0xfa, 0x15, 0x90, 0x05, 0x2d, 0xd8, 0x90,
+    0x05, 0x2c, 0xb0, 0xc4, 0xe0, 0x98, 0x05, 0x30, 0x99, 0xc2, 0x12, 0x99,
+    0x05, 0x30, 0xc0, 0xc4, 0xe0, 0x98, 0x05, 0x30, 0xa1, 0xc3, 0x38, 0x9c,
+    0x05, 0x30, 0xe0, 0xc3, 0x00, 0xb1, 0x05, 0x30, 0xa9, 0xc2, 0x12, 0x99,
+    0x05, 0x30, 0xc9, 0xc3, 0x01, 0x0a, 0x05, 0x30, 0xe8, 0xc3, 0x00, 0xc4,
+    0x05, 0x30, 0xd1, 0x11, 0x41, 0xfa, 0x19, 0xc9, 0x54, 0x6d, 0x01, 0x1e,
+    0x81, 0x45, 0x00, 0x92, 0x41, 0xfa, 0x25, 0xc7, 0x37, 0x14, 0x00, 0x00,
+    0x5b, 0x01, 0xfa, 0x31, 0xc4, 0x3e, 0x8b, 0x01, 0x5b, 0xf8, 0x01, 0x41,
+    0xfa, 0x37, 0xcb, 0x94, 0xad, 0x01, 0x81, 0xa0, 0xcf, 0x17, 0x39, 0x0f,
+    0xbd, 0xf9, 0xd2, 0x23, 0xcb, 0x0f, 0xbe, 0x80, 0xc6, 0x00, 0x7c, 0x0f,
+    0xbc, 0x41, 0xc6, 0x09, 0x2b, 0x0f, 0xbc, 0x90, 0xc6, 0x2a, 0x12, 0x0f,
+    0xb3, 0xe1, 0xc6, 0x13, 0x38, 0x0f, 0xbd, 0x69, 0xd2, 0x4c, 0xa5, 0x0f,
+    0xbd, 0xc8, 0xce, 0x6b, 0xb6, 0x00, 0xe7, 0x89, 0xcb, 0x96, 0xf4, 0x00,
+    0xe7, 0x5b, 0x01, 0xfa, 0x43, 0xcc, 0x89, 0x04, 0x00, 0xe7, 0x51, 0xcc,
+    0x14, 0x0b, 0x00, 0xe7, 0x48, 0xc8, 0x6c, 0x2c, 0x00, 0xe7, 0x31, 0xc6,
+    0x6c, 0x2e, 0x00, 0xe7, 0x20, 0xca, 0x9f, 0xa2, 0x00, 0xe7, 0x40, 0xca,
+    0x9f, 0xa2, 0x00, 0xe7, 0x38, 0xca, 0xa6, 0x82, 0x00, 0xe7, 0xc9, 0xc7,
+    0x02, 0x62, 0x00, 0xe6, 0xd0, 0xe0, 0x02, 0x49, 0x00, 0xe7, 0x00, 0xca,
+    0x9f, 0x2a, 0x00, 0xe6, 0xc8, 0x43, 0x00, 0x31, 0xc1, 0xfa, 0x49, 0xcc,
+    0x81, 0xcc, 0x70, 0x01, 0xe0, 0x4f, 0x09, 0x39, 0xc1, 0xfa, 0x5b, 0x4d,
+    0x28, 0xa7, 0x41, 0xfa, 0xc3, 0x42, 0x04, 0x0e, 0xc1, 0xfb, 0x2b, 0xc3,
+    0x0d, 0xc9, 0x70, 0x01, 0xd0, 0xce, 0x22, 0x37, 0x70, 0x02, 0xe9, 0xcb,
+    0x1a, 0x38, 0x70, 0x01, 0x49, 0xcd, 0x00, 0x34, 0x70, 0x03, 0xe8, 0xc4,
+    0x28, 0x74, 0x70, 0x01, 0xc9, 0xc5, 0x0a, 0xfd, 0x70, 0x01, 0xc1, 0x15,
+    0xc1, 0xfb, 0x35, 0x08, 0xc1, 0xfb, 0x41, 0x16, 0xc1, 0xfb, 0x4d, 0xc3,
+    0x05, 0x16, 0x70, 0x01, 0x89, 0xc4, 0x18, 0xa7, 0x70, 0x01, 0x80, 0x83,
+    0x00, 0xbb, 0x41, 0xc2, 0x00, 0xeb, 0x00, 0xbb, 0x28, 0xc9, 0xaa, 0x6f,
+    0x00, 0xb8, 0xf8, 0x83, 0x00, 0xb8, 0x41, 0xc2, 0x00, 0xeb, 0x00, 0xb8,
+    0x28, 0x26, 0xc1, 0xfb, 0x59, 0x25, 0xc1, 0xfb, 0x75, 0x24, 0xc1, 0xfb,
+    0x9d, 0x23, 0xc1, 0xfb, 0xc5, 0x22, 0xc1, 0xfb, 0xed, 0x21, 0xc1, 0xfc,
+    0x15, 0x20, 0xc1, 0xfc, 0x3d, 0x1f, 0x41, 0xfc, 0x65, 0xc4, 0x28, 0x74,
+    0x0b, 0x56, 0x49, 0xc5, 0x0a, 0xfd, 0x0b, 0x56, 0x41, 0x15, 0xc1, 0xfc,
+    0x8d, 0x08, 0xc1, 0xfc, 0x99, 0x16, 0xc1, 0xfc, 0xa5, 0xc3, 0x05, 0x16,
+    0x0b, 0x56, 0x09, 0xc4, 0x18, 0xa7, 0x0b, 0x56, 0x00, 0xc2, 0x01, 0x16,
+    0x0b, 0x55, 0xf1, 0x05, 0xc1, 0xfc, 0xb1, 0x06, 0xc1, 0xfc, 0xbb, 0x08,
+    0xc1, 0xfc, 0xc5, 0xc2, 0x66, 0x73, 0x0b, 0x55, 0xd1, 0x16, 0xc1, 0xfc,
+    0xcf, 0x0a, 0xc1, 0xfc, 0xdf, 0x09, 0xc1, 0xfc, 0xe7, 0x15, 0xc1, 0xfc,
+    0xf1, 0x10, 0xc1, 0xfc, 0xf9, 0xc2, 0x00, 0x3b, 0x0b, 0x55, 0x91, 0x0e,
+    0xc1, 0xfd, 0x0f, 0x0f, 0xc1, 0xfd, 0x19, 0xc2, 0x00, 0xa0, 0x0b, 0x55,
+    0x51, 0x12, 0xc1, 0xfd, 0x2d, 0xc2, 0x00, 0x71, 0x0b, 0x55, 0x31, 0xc2,
+    0x1a, 0x18, 0x0b, 0x55, 0x29, 0x0d, 0xc1, 0xfd, 0x37, 0x17, 0xc1, 0xfd,
+    0x41, 0x03, 0xc1, 0xfd, 0x59, 0x0b, 0xc1, 0xfd, 0x6d, 0x07, 0xc1, 0xfd,
+    0x7d, 0x18, 0xc1, 0xfd, 0x8d, 0x11, 0x41, 0xfd, 0x9d, 0x18, 0xc1, 0xfd,
+    0xad, 0x42, 0x14, 0x12, 0xc1, 0xfd, 0xbb, 0x0d, 0xc1, 0xfd, 0xcd, 0x12,
+    0xc1, 0xfd, 0xd7, 0xc7, 0xae, 0x8e, 0x08, 0xfe, 0xc1, 0x03, 0xc1, 0xfd,
+    0xe1, 0xc6, 0xcc, 0x32, 0x08, 0xfe, 0xb1, 0xc3, 0xa8, 0xc7, 0x08, 0xfe,
+    0xa8, 0xcb, 0x8f, 0xb1, 0x08, 0xff, 0x49, 0xcb, 0x96, 0xd3, 0x08, 0xff,
+    0x40, 0x83, 0x00, 0x5c, 0x2b, 0x01, 0xfd, 0xed, 0x8b, 0x00, 0x5c, 0x3b,
+    0x01, 0xfd, 0xf9, 0x97, 0x00, 0x5c, 0x4b, 0x01, 0xfd, 0xfd, 0x87, 0x00,
+    0x5c, 0x73, 0x01, 0xfe, 0x01, 0x91, 0x00, 0x5c, 0x93, 0x01, 0xfe, 0x05,
+    0xc2, 0x02, 0x4d, 0x00, 0x5c, 0xa9, 0x10, 0xc1, 0xfe, 0x09, 0xc2, 0x03,
+    0xc6, 0x00, 0x5c, 0xd1, 0xc2, 0x21, 0x7d, 0x00, 0x5c, 0xe1, 0x16, 0xc1,
+    0xfe, 0x1d, 0xc2, 0x04, 0xf2, 0x00, 0x5d, 0x51, 0xc2, 0x00, 0xb6, 0x00,
+    0x5d, 0x71, 0xc2, 0x1a, 0x18, 0x00, 0x5d, 0x79, 0x14, 0xc1, 0xfe, 0x27,
+    0x0e, 0xc1, 0xfe, 0x31, 0xc2, 0x02, 0x63, 0x00, 0x5d, 0xa9, 0x15, 0xc1,
+    0xfe, 0x39, 0xc2, 0x00, 0xce, 0x00, 0x5d, 0xc8, 0xc4, 0x18, 0xa7, 0x00,
+    0x5f, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x5f, 0x39, 0x16, 0xc1, 0xfe, 0x49,
+    0x08, 0xc1, 0xfe, 0x55, 0x15, 0xc1, 0xfe, 0x61, 0xc5, 0x0a, 0xfd, 0x00,
+    0x5f, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x5f, 0x78, 0xc8, 0x06, 0x7b, 0x08,
+    0xfe, 0x99, 0x44, 0x24, 0x35, 0xc1, 0xfe, 0x6d, 0xca, 0x9c, 0xaa, 0x08,
+    0xfe, 0x69, 0xca, 0xa6, 0xd2, 0x08, 0xfe, 0x30, 0x45, 0x28, 0xd5, 0xc1,
+    0xfe, 0x79, 0xc7, 0x06, 0x7b, 0x08, 0xfe, 0x81, 0x08, 0xc1, 0xfe, 0x81,
+    0x45, 0x0a, 0xfd, 0xc1, 0xfe, 0x8d, 0x16, 0xc1, 0xfe, 0x97, 0x44, 0x24,
+    0x35, 0xc1, 0xfe, 0xa7, 0xd8, 0x24, 0x25, 0x08, 0xfe, 0x08, 0x83, 0x00,
+    0x5d, 0xf1, 0x8b, 0x00, 0x5e, 0x41, 0x97, 0x00, 0x5e, 0x60, 0x8b, 0x00,
+    0x5e, 0x00, 0x97, 0x00, 0x5e, 0x10, 0x87, 0x00, 0x5e, 0x38, 0x91, 0x00,
+    0x5e, 0x58, 0xc7, 0x0c, 0xe7, 0x00, 0x5f, 0x89, 0xc8, 0x53, 0xd0, 0x00,
+    0x5f, 0x90, 0xc4, 0x17, 0xf7, 0x08, 0xb6, 0x39, 0xc2, 0x24, 0x36, 0x08,
+    0xb6, 0x30, 0xc3, 0x0c, 0xf7, 0x08, 0xb6, 0x29, 0xc3, 0x04, 0xa0, 0x08,
+    0xb6, 0x20, 0xc4, 0x03, 0xe0, 0x08, 0xb6, 0x19, 0xc2, 0x01, 0xa2, 0x08,
+    0xb6, 0x10, 0xca, 0xa4, 0x2a, 0x08, 0xb5, 0xc1, 0x97, 0x08, 0xb4, 0x49,
+    0x8b, 0x08, 0xb4, 0x39, 0x83, 0x08, 0xb4, 0x08, 0xc2, 0x00, 0x3b, 0x08,
+    0xb5, 0x51, 0x83, 0x08, 0xb5, 0x20, 0x83, 0x08, 0xb5, 0x41, 0xc2, 0x00,
+    0xce, 0x08, 0xb5, 0x38, 0xc2, 0x00, 0xce, 0x08, 0xb5, 0x09, 0x83, 0x08,
+    0xb5, 0x00, 0xc2, 0x00, 0xce, 0x08, 0xb4, 0xf9, 0x83, 0x08, 0xb4, 0xf0,
+    0x83, 0x08, 0xb4, 0xe9, 0xc2, 0x03, 0x83, 0x08, 0xb4, 0xc1, 0xc2, 0x1a,
+    0x18, 0x08, 0xb4, 0x99, 0xc2, 0x00, 0xeb, 0x08, 0xb4, 0x70, 0xc2, 0x00,
+    0xce, 0x08, 0xb4, 0xe1, 0x83, 0x08, 0xb4, 0xd9, 0x06, 0x41, 0xfe, 0xb3,
+    0xc2, 0x00, 0xce, 0x08, 0xb4, 0xd1, 0x83, 0x08, 0xb4, 0xc9, 0x16, 0x41,
+    0xfe, 0xbd, 0xc2, 0x00, 0xce, 0x08, 0xb4, 0x91, 0x83, 0x08, 0xb4, 0x88,
+    0xc2, 0x00, 0xce, 0x08, 0xb4, 0x81, 0x83, 0x08, 0xb4, 0x78, 0xc2, 0x00,
+    0xce, 0x08, 0xb4, 0x69, 0x83, 0x08, 0xb4, 0x60, 0xc2, 0x00, 0xce, 0x08,
+    0xb4, 0x59, 0x83, 0x08, 0xb4, 0x50, 0x97, 0x08, 0xb4, 0x28, 0x8b, 0x08,
+    0xb4, 0x18, 0xc4, 0x1f, 0xf7, 0x08, 0xb5, 0xb1, 0xc5, 0x40, 0xb0, 0x08,
+    0xb5, 0x60, 0x97, 0x08, 0xb5, 0xa9, 0x8b, 0x08, 0xb5, 0x99, 0x83, 0x08,
+    0xb5, 0x68, 0x97, 0x08, 0xb5, 0x88, 0x8b, 0x08, 0xb5, 0x78, 0xc3, 0x00,
+    0xc4, 0x00, 0xd5, 0x61, 0xc2, 0x69, 0x96, 0x00, 0xd5, 0x20, 0xc5, 0xd6,
+    0x16, 0x00, 0xd5, 0x53, 0x01, 0xfe, 0xc7, 0xc3, 0x0e, 0x51, 0x00, 0xd5,
+    0x11, 0xc3, 0x72, 0x7d, 0x00, 0xd3, 0x00, 0xc3, 0x3a, 0xed, 0x00, 0xd5,
+    0x43, 0x01, 0xfe, 0xcd, 0xc3, 0xc4, 0x27, 0x00, 0xd5, 0x19, 0x44, 0xdf,
+    0x88, 0x41, 0xfe, 0xd3, 0xc5, 0xd6, 0x6b, 0x00, 0xd5, 0x39, 0xc3, 0x55,
+    0x1f, 0x00, 0xd3, 0xd9, 0xc4, 0x3e, 0xe5, 0x00, 0xd3, 0xa2, 0x01, 0xfe,
+    0xdf, 0xd4, 0x3a, 0x86, 0x00, 0xd5, 0x31, 0xc6, 0xd1, 0x96, 0x00, 0xd3,
+    0xd0, 0xc4, 0xce, 0x2e, 0x00, 0xd5, 0x08, 0xa1, 0x00, 0xd3, 0xb1, 0xa0,
+    0x00, 0xd3, 0xa8, 0xc4, 0x17, 0xf7, 0x00, 0xd4, 0xb9, 0xc2, 0x24, 0x36,
+    0x00, 0xd4, 0xb0, 0xc3, 0x0c, 0xf7, 0x00, 0xd4, 0xa9, 0xc3, 0x04, 0xa0,
+    0x00, 0xd4, 0xa0, 0xc4, 0x03, 0xe0, 0x00, 0xd4, 0x99, 0xc2, 0x01, 0xa2,
+    0x00, 0xd4, 0x90, 0xc4, 0x17, 0xf7, 0x00, 0xd4, 0x39, 0xc2, 0x24, 0x36,
+    0x00, 0xd4, 0x30, 0xc3, 0x0c, 0xf7, 0x00, 0xd4, 0x29, 0xc3, 0x04, 0xa0,
+    0x00, 0xd4, 0x20, 0xc4, 0x03, 0xe0, 0x00, 0xd4, 0x19, 0xc2, 0x01, 0xa2,
+    0x00, 0xd4, 0x10, 0xc2, 0x0d, 0x01, 0x00, 0xd2, 0xf1, 0xc2, 0x00, 0xa0,
+    0x00, 0xd2, 0xe9, 0x0f, 0xc1, 0xfe, 0xe5, 0xd4, 0x3b, 0xb2, 0x00, 0xd2,
+    0xd9, 0x0e, 0xc1, 0xfe, 0xef, 0xc9, 0xb2, 0x85, 0x00, 0xd2, 0xc8, 0x42,
+    0x02, 0x68, 0xc1, 0xfe, 0xfb, 0x91, 0x00, 0xd3, 0x81, 0x9b, 0x00, 0xd3,
+    0x68, 0xc6, 0xd2, 0x1a, 0x00, 0xd3, 0x91, 0xc6, 0xc4, 0xb5, 0x00, 0xd3,
+    0x20, 0x8b, 0x00, 0xd3, 0x89, 0x87, 0x00, 0xd3, 0x79, 0x83, 0x00, 0xd3,
+    0x18, 0x97, 0x00, 0xd3, 0x53, 0x01, 0xff, 0x07, 0x87, 0x00, 0xd3, 0x38,
+    0x8b, 0x00, 0xd3, 0x30, 0x83, 0x00, 0xd2, 0x1b, 0x01, 0xff, 0x0b, 0x43,
+    0x01, 0x81, 0xc1, 0xff, 0x0f, 0xc2, 0x00, 0x89, 0x00, 0xd2, 0x51, 0xc2,
+    0x0e, 0x21, 0x00, 0xd2, 0x20, 0x97, 0x00, 0xd2, 0x80, 0x8b, 0x00, 0xd2,
+    0x70, 0xc2, 0x00, 0xce, 0x00, 0xd2, 0x49, 0x15, 0xc1, 0xff, 0x3d, 0xc2,
+    0x1a, 0x18, 0x00, 0xd2, 0x01, 0xc2, 0x04, 0x70, 0x00, 0xd1, 0xd1, 0x12,
+    0xc1, 0xff, 0x4d, 0x16, 0xc1, 0xff, 0x57, 0xc5, 0x3b, 0xb7, 0x00, 0xd1,
+    0x71, 0x05, 0xc1, 0xff, 0x61, 0x0d, 0x41, 0xff, 0x6b, 0xc2, 0x0e, 0x21,
+    0x00, 0xd2, 0x11, 0x83, 0x00, 0xd2, 0x0a, 0x01, 0xff, 0x7b, 0x83, 0x00,
+    0xd1, 0xb1, 0xc2, 0x1a, 0x18, 0x00, 0xd1, 0x61, 0xc2, 0x00, 0xeb, 0x00,
+    0xd1, 0x30, 0xa5, 0x00, 0xcb, 0xa1, 0xa4, 0x00, 0xcb, 0x99, 0xa3, 0x00,
+    0xcb, 0x91, 0xa2, 0x00, 0xcb, 0x89, 0xa1, 0x00, 0xcb, 0x80, 0xc2, 0x00,
+    0xce, 0x00, 0xcb, 0x09, 0x83, 0x00, 0xca, 0x98, 0xc5, 0xdd, 0xb4, 0x05,
+    0x56, 0xf9, 0x90, 0x05, 0x56, 0xd8, 0x8f, 0x05, 0x55, 0xf1, 0x90, 0x05,
+    0x55, 0xe9, 0x9b, 0x05, 0x55, 0xe1, 0xc2, 0x0e, 0x21, 0x05, 0x55, 0xd9,
+    0x83, 0x05, 0x55, 0x88, 0x83, 0x05, 0x55, 0xd1, 0x87, 0x05, 0x55, 0x9a,
+    0x01, 0xff, 0x87, 0x83, 0x05, 0x55, 0xc0, 0x91, 0x05, 0x55, 0x79, 0xc2,
+    0x00, 0x4a, 0x05, 0x55, 0x69, 0xc2, 0x14, 0xe6, 0x05, 0x55, 0x59, 0xc2,
+    0x00, 0x29, 0x05, 0x55, 0x49, 0xc2, 0x00, 0x57, 0x05, 0x55, 0x39, 0xc2,
+    0x31, 0xda, 0x05, 0x55, 0x29, 0xc2, 0x08, 0x04, 0x05, 0x55, 0x19, 0xc2,
+    0x02, 0x25, 0x05, 0x55, 0x09, 0x12, 0xc1, 0xff, 0x8b, 0xc2, 0x00, 0xd3,
+    0x05, 0x54, 0xd9, 0x10, 0xc1, 0xff, 0x95, 0x16, 0xc1, 0xff, 0xa5, 0xc2,
+    0x00, 0xd8, 0x05, 0x54, 0x99, 0x05, 0xc1, 0xff, 0xaf, 0xc2, 0x14, 0x10,
+    0x05, 0x54, 0x39, 0x0d, 0xc1, 0xff, 0xb9, 0xc2, 0x02, 0x1d, 0x05, 0x54,
+    0x78, 0x91, 0x05, 0x55, 0x71, 0xc2, 0x00, 0x4a, 0x05, 0x55, 0x61, 0xc2,
+    0x14, 0xe6, 0x05, 0x55, 0x51, 0xc2, 0x00, 0x29, 0x05, 0x55, 0x41, 0xc2,
+    0x00, 0x57, 0x05, 0x55, 0x31, 0xc2, 0x31, 0xda, 0x05, 0x55, 0x21, 0xc2,
+    0x08, 0x04, 0x05, 0x55, 0x11, 0xc2, 0x02, 0x25, 0x05, 0x55, 0x01, 0x12,
+    0xc1, 0xff, 0xc1, 0xc2, 0x00, 0xd3, 0x05, 0x54, 0xd1, 0x10, 0xc1, 0xff,
+    0xcb, 0x16, 0xc1, 0xff, 0xdb, 0xc2, 0x00, 0xd8, 0x05, 0x54, 0x91, 0x05,
+    0xc1, 0xff, 0xe5, 0xc2, 0x14, 0x10, 0x05, 0x54, 0x31, 0x0d, 0xc1, 0xff,
+    0xef, 0xc2, 0x02, 0x1d, 0x05, 0x54, 0x70, 0xd2, 0x4d, 0x6b, 0x0f, 0xb2,
+    0xa1, 0xd2, 0x4e, 0x31, 0x0f, 0xb2, 0xb0, 0xc4, 0x03, 0xe0, 0x01, 0x0c,
+    0x59, 0xc2, 0x01, 0xa2, 0x01, 0x0c, 0x50, 0x9b, 0x01, 0x0a, 0x21, 0x8e,
+    0x01, 0x0a, 0x11, 0x89, 0x01, 0x0a, 0x08, 0xd2, 0x4d, 0x6b, 0x0f, 0xb2,
+    0xa9, 0xd2, 0x4e, 0x31, 0x0f, 0xb2, 0xb8, 0xc4, 0x00, 0x2f, 0x01, 0x34,
+    0xf9, 0xc5, 0x00, 0x64, 0x01, 0x34, 0xf0, 0xc5, 0x01, 0x24, 0x0f, 0xaf,
+    0x29, 0xc5, 0x00, 0xd2, 0x0f, 0xaf, 0x21, 0xc4, 0x00, 0x2f, 0x0f, 0xaf,
+    0x31, 0xc5, 0x00, 0x64, 0x0f, 0xaf, 0x38, 0x4b, 0x02, 0xf9, 0xc1, 0xff,
+    0xf7, 0xdf, 0x0c, 0x29, 0x01, 0x5c, 0xc0, 0xe0, 0x01, 0xc9, 0x01, 0x5c,
+    0xc8, 0xe0, 0x0a, 0x89, 0x01, 0x3d, 0x18, 0xe0, 0x05, 0xe9, 0x01, 0x5c,
+    0xd8, 0xc6, 0x13, 0x38, 0x0f, 0xbd, 0x41, 0xc4, 0x40, 0x52, 0x01, 0x00,
+    0x48, 0xc2, 0x12, 0x99, 0x00, 0x3c, 0x01, 0xc3, 0x3a, 0xec, 0x00, 0x3c,
+    0xc8, 0x0a, 0xc2, 0x00, 0x03, 0xc5, 0xd8, 0xc3, 0x00, 0x3c, 0xf1, 0xc4,
+    0xe0, 0x94, 0x00, 0x3c, 0x80, 0xc4, 0xe1, 0xe4, 0x00, 0x3c, 0x11, 0xc2,
+    0x12, 0x99, 0x00, 0x3d, 0x88, 0xc8, 0xb2, 0x47, 0x00, 0x3c, 0x29, 0xc4,
+    0xe0, 0x50, 0x00, 0x3c, 0x68, 0xc4, 0xd3, 0x83, 0x00, 0x3c, 0x31, 0xc3,
+    0x3a, 0xec, 0x00, 0x3c, 0xd0, 0xc4, 0xdf, 0xec, 0x00, 0x3c, 0x39, 0xc3,
+    0x15, 0x15, 0x00, 0x3d, 0x10, 0xc5, 0xdc, 0xce, 0x00, 0x3c, 0x59, 0x03,
+    0x42, 0x00, 0x0f, 0xc3, 0x3a, 0xec, 0x00, 0x3c, 0x63, 0x02, 0x00, 0x1b,
+    0xc7, 0xb2, 0x48, 0x00, 0x3c, 0x99, 0x91, 0x00, 0x3d, 0x01, 0xc3, 0x3a,
+    0xf7, 0x00, 0x3c, 0xc0, 0xc4, 0xd3, 0x83, 0x00, 0x3c, 0x71, 0xc8, 0xb8,
+    0x98, 0x00, 0x3c, 0x79, 0xc5, 0xdc, 0xc4, 0x00, 0x3d, 0x18, 0x03, 0xc2,
+    0x00, 0x21, 0x91, 0x00, 0x3d, 0x08, 0x0d, 0xc2, 0x00, 0x2b, 0x10, 0xc2,
+    0x00, 0x37, 0x46, 0xcd, 0x10, 0xc2, 0x00, 0x49, 0x15, 0xc2, 0x00, 0x5e,
+    0x1b, 0xc2, 0x00, 0x6a, 0x43, 0x5f, 0xe5, 0xc2, 0x00, 0x76, 0x16, 0xc2,
+    0x00, 0x82, 0xc9, 0xb4, 0x3e, 0x00, 0x70, 0xd1, 0x12, 0xc2, 0x00, 0x8c,
+    0x42, 0x02, 0x25, 0xc2, 0x00, 0x9c, 0x0f, 0xc2, 0x00, 0xab, 0x14, 0xc2,
+    0x00, 0xb7, 0x0e, 0xc2, 0x00, 0xc1, 0xc7, 0xc6, 0xd6, 0x00, 0x71, 0x39,
+    0x43, 0x61, 0x7d, 0xc2, 0x00, 0xd1, 0xc5, 0xdc, 0x92, 0x00, 0x71, 0x69,
+    0xca, 0x9a, 0x84, 0x00, 0x72, 0xd0, 0xc2, 0x01, 0xa2, 0x00, 0x72, 0x91,
+    0xc4, 0x03, 0xe0, 0x00, 0x72, 0x98, 0xc3, 0x04, 0xa0, 0x00, 0x72, 0xa1,
+    0xc3, 0x0c, 0xf7, 0x00, 0x72, 0xa8, 0xc2, 0x24, 0x36, 0x00, 0x72, 0xb1,
+    0xc4, 0x17, 0xf7, 0x00, 0x72, 0xb8, 0x87, 0x0f, 0x15, 0x58, 0x47, 0xc0,
+    0x5b, 0xc2, 0x00, 0xdd, 0x83, 0x0f, 0x14, 0x88, 0x91, 0x0f, 0x15, 0x40,
+    0x97, 0x0f, 0x15, 0x18, 0xc2, 0x00, 0xeb, 0x0f, 0x14, 0xc1, 0x83, 0x0f,
+    0x14, 0xb8, 0xd0, 0x5a, 0xc2, 0x01, 0x4e, 0x69, 0xc8, 0x50, 0x50, 0x01,
+    0x4e, 0x59, 0xc9, 0x18, 0x17, 0x01, 0x4e, 0x51, 0xcf, 0x13, 0x44, 0x0f,
+    0xb6, 0x30, 0xc4, 0x5d, 0x76, 0x0e, 0x9a, 0x49, 0xc9, 0xac, 0x8b, 0x0e,
+    0x99, 0xe0, 0xc5, 0xb6, 0xc3, 0x0e, 0x9a, 0x91, 0xc5, 0x5b, 0x2d, 0x0e,
+    0x9a, 0x70, 0xc6, 0xcc, 0x86, 0x0e, 0x99, 0xc1, 0x16, 0x42, 0x00, 0xf1,
+    0xc7, 0xc8, 0x18, 0x0e, 0x99, 0xe9, 0xc4, 0x1f, 0x53, 0x0e, 0x99, 0x30,
+    0xc5, 0xd4, 0x95, 0x0e, 0x9a, 0x61, 0xc2, 0x00, 0x98, 0x0e, 0x99, 0x88,
+    0xc5, 0xd3, 0x8c, 0x0e, 0x99, 0x71, 0x0b, 0x42, 0x01, 0x03, 0xc5, 0x7d,
+    0x4f, 0x01, 0x18, 0xa9, 0xc5, 0x35, 0x1e, 0x0f, 0xa6, 0xf2, 0x02, 0x01,
+    0x0f, 0x49, 0x2a, 0xe0, 0xc2, 0x01, 0x15, 0xca, 0x1f, 0xea, 0x00, 0x60,
+    0x08, 0xc7, 0x14, 0x03, 0x00, 0x60, 0x11, 0xc7, 0x7e, 0x15, 0x00, 0x61,
+    0xe8, 0xc5, 0x40, 0xb0, 0x00, 0x60, 0x19, 0xc4, 0x1f, 0xf7, 0x00, 0x62,
+    0x68, 0x83, 0x00, 0x60, 0x2b, 0x02, 0x01, 0x21, 0x8b, 0x00, 0x60, 0x3b,
+    0x02, 0x01, 0x2d, 0x97, 0x00, 0x60, 0x4b, 0x02, 0x01, 0x31, 0x18, 0xc2,
+    0x01, 0x35, 0x87, 0x00, 0x60, 0x73, 0x02, 0x01, 0x3f, 0x91, 0x00, 0x60,
+    0x93, 0x02, 0x01, 0x43, 0x0d, 0xc2, 0x01, 0x47, 0x09, 0xc2, 0x01, 0x51,
+    0x10, 0xc2, 0x01, 0x5b, 0x05, 0xc2, 0x01, 0x74, 0x0c, 0xc2, 0x01, 0x7e,
+    0x16, 0xc2, 0x01, 0x88, 0x06, 0xc2, 0x01, 0x9c, 0x12, 0xc2, 0x01, 0xb0,
+    0x04, 0xc2, 0x01, 0xba, 0xc2, 0x00, 0xb6, 0x00, 0x61, 0x71, 0xc2, 0x1a,
+    0x18, 0x00, 0x61, 0x79, 0x14, 0xc2, 0x01, 0xc4, 0x0e, 0xc2, 0x01, 0xcc,
+    0x15, 0xc2, 0x01, 0xd4, 0xc2, 0x00, 0xce, 0x00, 0x61, 0xc8, 0x83, 0x00,
+    0x61, 0xf1, 0x8b, 0x00, 0x62, 0x41, 0x97, 0x00, 0x62, 0x60, 0x8b, 0x00,
+    0x62, 0x00, 0x97, 0x00, 0x62, 0x10, 0x94, 0x00, 0x62, 0x1b, 0x02, 0x01,
+    0xe4, 0x8e, 0x00, 0x63, 0x12, 0x02, 0x01, 0xe8, 0x87, 0x00, 0x62, 0x38,
+    0x91, 0x00, 0x62, 0x58, 0xc2, 0x01, 0xa2, 0x00, 0x63, 0x41, 0xc4, 0x03,
+    0xe0, 0x00, 0x63, 0x48, 0xc3, 0x04, 0xa0, 0x00, 0x63, 0x51, 0xc3, 0x0c,
+    0xf7, 0x00, 0x63, 0x58, 0xc2, 0x24, 0x36, 0x00, 0x63, 0x61, 0xc4, 0x17,
+    0xf7, 0x00, 0x63, 0x68, 0xd2, 0x18, 0xb0, 0x00, 0x63, 0xc9, 0xd3, 0x46,
+    0x6c, 0x00, 0x63, 0xe0, 0x47, 0xc1, 0x73, 0xc2, 0x01, 0xec, 0x49, 0xae,
+    0x83, 0x42, 0x01, 0xf8, 0x46, 0x00, 0xd2, 0xc2, 0x02, 0x04, 0x45, 0x00,
+    0x92, 0x42, 0x02, 0x10, 0xc5, 0x00, 0xd2, 0x01, 0x70, 0xf1, 0xc5, 0x01,
+    0x24, 0x01, 0x70, 0xf8, 0xc4, 0x17, 0xf7, 0x08, 0xa6, 0xb9, 0xc2, 0x24,
+    0x36, 0x08, 0xa6, 0xb0, 0xc3, 0x0c, 0xf7, 0x08, 0xa6, 0xa9, 0xc3, 0x04,
+    0xa0, 0x08, 0xa6, 0xa0, 0xc4, 0x03, 0xe0, 0x08, 0xa6, 0x99, 0xc2, 0x01,
+    0xa2, 0x08, 0xa6, 0x90, 0xc7, 0x7e, 0x15, 0x08, 0xa6, 0x21, 0xc7, 0x14,
+    0x03, 0x08, 0xa6, 0x00, 0xc5, 0x40, 0xb0, 0x08, 0xa6, 0x09, 0xc4, 0x1f,
+    0xf7, 0x08, 0xa6, 0x10, 0x97, 0x08, 0xa5, 0xf1, 0x8b, 0x08, 0xa5, 0xd9,
+    0x83, 0x08, 0xa5, 0x80, 0x91, 0x08, 0xa5, 0xe9, 0x87, 0x08, 0xa5, 0xd0,
+    0x8e, 0x08, 0xa5, 0xbb, 0x02, 0x02, 0x1c, 0x94, 0x08, 0xa5, 0xaa, 0x02,
+    0x02, 0x20, 0x97, 0x08, 0xa5, 0xa0, 0x8b, 0x08, 0xa5, 0x90, 0x83, 0x08,
+    0xa5, 0x71, 0xc2, 0x0d, 0x01, 0x08, 0xa5, 0x69, 0xc2, 0x00, 0xce, 0x08,
+    0xa5, 0x60, 0x83, 0x08, 0xa5, 0x59, 0x47, 0xaa, 0xd3, 0x42, 0x02, 0x24,
+    0xc2, 0x00, 0xce, 0x08, 0xa5, 0x31, 0x83, 0x08, 0xa5, 0x28, 0xc2, 0x00,
+    0xce, 0x08, 0xa5, 0x21, 0x83, 0x08, 0xa5, 0x18, 0x83, 0x08, 0xa5, 0x11,
+    0xc2, 0x03, 0x83, 0x08, 0xa4, 0xe9, 0xc2, 0x1a, 0x18, 0x08, 0xa4, 0xc1,
+    0xc2, 0x00, 0xeb, 0x08, 0xa4, 0x98, 0xc2, 0x00, 0xce, 0x08, 0xa5, 0x09,
+    0x83, 0x08, 0xa5, 0x01, 0x06, 0x42, 0x02, 0x32, 0xc2, 0x00, 0xce, 0x08,
+    0xa4, 0xf9, 0x83, 0x08, 0xa4, 0xf1, 0x16, 0x42, 0x02, 0x3c, 0xc2, 0x00,
+    0xce, 0x08, 0xa4, 0xb9, 0x83, 0x08, 0xa4, 0xb0, 0xc2, 0x00, 0xce, 0x08,
+    0xa4, 0xa9, 0x83, 0x08, 0xa4, 0xa0, 0xc2, 0x00, 0xce, 0x08, 0xa4, 0x91,
+    0x83, 0x08, 0xa4, 0x88, 0xc2, 0x00, 0xce, 0x08, 0xa4, 0x81, 0x83, 0x08,
+    0xa4, 0x78, 0x97, 0x08, 0xa4, 0x71, 0x8b, 0x08, 0xa4, 0x61, 0x83, 0x08,
+    0xa4, 0x10, 0x97, 0x08, 0xa4, 0x30, 0x8b, 0x08, 0xa4, 0x20, 0xc7, 0xc5,
+    0xb7, 0x00, 0x7e, 0x21, 0xc7, 0xbf, 0x97, 0x00, 0x7e, 0x2b, 0x02, 0x02,
+    0x46, 0x12, 0xc2, 0x02, 0x4c, 0xc6, 0xce, 0x06, 0x00, 0x7e, 0x4a, 0x02,
+    0x02, 0x58, 0x44, 0xaa, 0x3a, 0xc2, 0x02, 0x5c, 0xcd, 0x77, 0x27, 0x00,
+    0x7b, 0xf1, 0xc8, 0x88, 0x09, 0x00, 0x7b, 0xf8, 0xc7, 0xbc, 0xd9, 0x00,
+    0x79, 0xf1, 0xc8, 0xb9, 0xf8, 0x00, 0x7c, 0x38, 0xc8, 0xbc, 0xd8, 0x00,
+    0x79, 0xf9, 0xc7, 0x51, 0x94, 0x00, 0x7c, 0x48, 0xc7, 0xc7, 0xb6, 0x00,
+    0x7c, 0x31, 0xc9, 0x8d, 0x09, 0x00, 0x7c, 0x40, 0xcb, 0x97, 0x6d, 0x00,
+    0x7c, 0x51, 0xcb, 0x8e, 0x5c, 0x00, 0x7c, 0x58, 0xcb, 0x8d, 0x07, 0x00,
+    0x7c, 0x69, 0xc8, 0x51, 0x93, 0x00, 0x7c, 0x71, 0xd1, 0x51, 0x8a, 0x00,
+    0x7c, 0x78, 0x0d, 0xc2, 0x02, 0x68, 0x09, 0xc2, 0x02, 0x78, 0x10, 0xc2,
+    0x02, 0x82, 0x05, 0xc2, 0x02, 0x98, 0xc2, 0x21, 0x7d, 0x00, 0x7c, 0xb9,
+    0x16, 0xc2, 0x02, 0xa2, 0x06, 0xc2, 0x02, 0xb4, 0x12, 0xc2, 0x02, 0xc6,
+    0x04, 0xc2, 0x02, 0xd0, 0xc2, 0x00, 0xb6, 0x00, 0x7d, 0x41, 0xc2, 0x00,
+    0x71, 0x00, 0x7d, 0x69, 0x1c, 0xc2, 0x02, 0xda, 0xc2, 0x1e, 0x12, 0x00,
+    0x7d, 0x81, 0xc2, 0x1a, 0x18, 0x00, 0x7d, 0x89, 0xc2, 0x00, 0x3b, 0x00,
+    0x7d, 0x91, 0xc2, 0x00, 0x89, 0x00, 0x7d, 0x99, 0x15, 0xc2, 0x02, 0xe4,
+    0xc2, 0x00, 0xce, 0x00, 0x7d, 0xb9, 0x83, 0x00, 0x7d, 0xc1, 0x4b, 0x79,
+    0x56, 0x42, 0x02, 0xf4, 0x48, 0x16, 0xcd, 0xc2, 0x03, 0x06, 0xc5, 0x33,
+    0x0b, 0x00, 0x78, 0xa0, 0xc2, 0x00, 0x47, 0x00, 0x79, 0xd1, 0xc2, 0x00,
+    0xa6, 0x00, 0x79, 0xd8, 0xcf, 0x16, 0xcd, 0x00, 0x78, 0x21, 0xdb, 0x16,
+    0xc1, 0x00, 0x7e, 0x98, 0xcf, 0x18, 0x2c, 0x00, 0x78, 0x29, 0xdb, 0x18,
+    0x20, 0x00, 0x7e, 0xa0, 0xd4, 0x3d, 0xce, 0x00, 0x78, 0x31, 0x4c, 0x8b,
+    0x20, 0x42, 0x03, 0x12, 0x0d, 0xc2, 0x03, 0x1e, 0xc9, 0xb2, 0xbb, 0x00,
+    0x79, 0xa0, 0xc7, 0x16, 0xcd, 0x00, 0x78, 0x51, 0xcc, 0x2c, 0x7c, 0x00,
+    0x7e, 0x80, 0xc4, 0x02, 0xea, 0x00, 0x78, 0x71, 0xc5, 0x33, 0x0b, 0x00,
+    0x7e, 0x92, 0x02, 0x03, 0x2a, 0xc7, 0x6f, 0xc2, 0x00, 0x79, 0xa9, 0xca,
+    0xa4, 0xd4, 0x00, 0x79, 0xb8, 0xc8, 0x36, 0xfb, 0x00, 0x78, 0x79, 0xc7,
+    0xc7, 0x5b, 0x00, 0x79, 0xc8, 0x83, 0x00, 0x7a, 0x01, 0xc2, 0x00, 0xce,
+    0x00, 0x7a, 0x09, 0xc3, 0x1b, 0xb1, 0x00, 0x7b, 0x49, 0xc2, 0x02, 0x4d,
+    0x00, 0x7b, 0x58, 0x83, 0x00, 0x7a, 0x11, 0xc2, 0x00, 0xce, 0x00, 0x7a,
+    0x18, 0xc2, 0x00, 0xeb, 0x00, 0x7a, 0x21, 0xc2, 0x1a, 0x18, 0x00, 0x7a,
+    0x49, 0xc2, 0x03, 0x83, 0x00, 0x7a, 0x71, 0x83, 0x00, 0x7a, 0x98, 0x83,
+    0x00, 0x7a, 0x29, 0xc2, 0x00, 0xce, 0x00, 0x7a, 0x30, 0x16, 0xc2, 0x03,
+    0x30, 0x83, 0x00, 0x7a, 0x79, 0xc2, 0x00, 0xce, 0x00, 0x7a, 0x81, 0x15,
+    0x42, 0x03, 0x3a, 0x06, 0xc2, 0x03, 0x44, 0x83, 0x00, 0x7a, 0x89, 0xc2,
+    0x00, 0xce, 0x00, 0x7a, 0x91, 0x1c, 0x42, 0x03, 0x4e, 0x83, 0x00, 0x7a,
+    0xa1, 0xc2, 0x00, 0xce, 0x00, 0x7a, 0xa8, 0x83, 0x00, 0x7a, 0xb1, 0xc2,
+    0x00, 0xce, 0x00, 0x7a, 0xb8, 0xc2, 0x00, 0xce, 0x00, 0x7a, 0xf1, 0x83,
+    0x00, 0x7a, 0xf8, 0x83, 0x00, 0x7b, 0x11, 0xc2, 0x00, 0x3b, 0x00, 0x7b,
+    0x60, 0xc2, 0x00, 0xce, 0x00, 0x7b, 0x21, 0xc2, 0x0d, 0x01, 0x00, 0x7b,
+    0x29, 0x83, 0x00, 0x7b, 0x30, 0xc2, 0x01, 0xa2, 0x00, 0x79, 0x59, 0xc4,
+    0x03, 0xe0, 0x00, 0x79, 0x60, 0xc3, 0x04, 0xa0, 0x00, 0x79, 0x69, 0xc3,
+    0x0c, 0xf7, 0x00, 0x79, 0x70, 0xc2, 0x24, 0x36, 0x00, 0x79, 0x79, 0xc4,
+    0x17, 0xf7, 0x00, 0x79, 0x80, 0x94, 0x00, 0x7b, 0xb8, 0x8e, 0x00, 0x7b,
+    0xc8, 0x84, 0x01, 0x69, 0x8b, 0x02, 0x03, 0x58, 0x89, 0x01, 0x69, 0x9b,
+    0x02, 0x03, 0x5c, 0x8c, 0x01, 0x69, 0xb1, 0x86, 0x01, 0x69, 0xbb, 0x02,
+    0x03, 0x63, 0x88, 0x01, 0x69, 0xe1, 0x8d, 0x01, 0x69, 0xeb, 0x02, 0x03,
+    0x6e, 0x8a, 0x01, 0x6a, 0x03, 0x02, 0x03, 0x75, 0x83, 0x01, 0x6a, 0x21,
+    0x93, 0x01, 0x6a, 0x39, 0x9c, 0x01, 0x6b, 0x1b, 0x02, 0x03, 0x79, 0x8e,
+    0x01, 0x6a, 0x69, 0x8f, 0x01, 0x6a, 0x71, 0x90, 0x01, 0x6a, 0x79, 0x92,
+    0x01, 0x6a, 0x91, 0x94, 0x01, 0x6a, 0xa3, 0x02, 0x03, 0x81, 0x95, 0x01,
+    0x6a, 0xcb, 0x02, 0x03, 0x85, 0x96, 0x01, 0x6a, 0xe3, 0x02, 0x03, 0x8d,
+    0xc2, 0x11, 0x99, 0x01, 0x6a, 0xf1, 0x98, 0x01, 0x6b, 0x01, 0x99, 0x01,
+    0x6b, 0x09, 0x9b, 0x01, 0x6b, 0x10, 0x9b, 0x01, 0x69, 0xd8, 0x8d, 0x01,
+    0x69, 0xf3, 0x02, 0x03, 0x95, 0x8a, 0x01, 0x6a, 0x11, 0x93, 0x01, 0x6a,
+    0x41, 0xc2, 0x25, 0x73, 0x01, 0x6a, 0x61, 0x09, 0xc2, 0x03, 0x99, 0xc2,
+    0x00, 0xb2, 0x01, 0x6a, 0x88, 0xcb, 0x05, 0x1e, 0x01, 0x02, 0xd1, 0xc6,
+    0x71, 0x52, 0x01, 0x01, 0x28, 0xc7, 0xc5, 0xe8, 0x01, 0x39, 0x09, 0xc7,
+    0x16, 0x69, 0x01, 0x16, 0x30, 0xcf, 0x66, 0x47, 0x01, 0x5f, 0x51, 0xd0,
+    0x59, 0x82, 0x01, 0x5f, 0x58, 0xcc, 0x79, 0x30, 0x00, 0x04, 0x31, 0xc5,
+    0x58, 0x43, 0x00, 0x04, 0xc0, 0xc4, 0x28, 0x74, 0x05, 0x46, 0xc9, 0xc5,
+    0x0a, 0xfd, 0x05, 0x46, 0xc1, 0x15, 0xc2, 0x03, 0xa1, 0x08, 0xc2, 0x03,
+    0xad, 0x16, 0xc2, 0x03, 0xb9, 0xc3, 0x05, 0x16, 0x05, 0x46, 0x89, 0xc4,
+    0x18, 0xa7, 0x05, 0x46, 0x80, 0xc4, 0x1f, 0xf7, 0x05, 0x46, 0x21, 0xc5,
+    0x40, 0xb0, 0x05, 0x44, 0x08, 0x97, 0x05, 0x46, 0x19, 0x8b, 0x05, 0x46,
+    0x01, 0x83, 0x05, 0x45, 0xa8, 0x91, 0x05, 0x46, 0x10, 0x87, 0x05, 0x45,
+    0xf8, 0x8e, 0x05, 0x45, 0xe3, 0x02, 0x03, 0xc5, 0x94, 0x05, 0x45, 0xd2,
+    0x02, 0x03, 0xc9, 0x97, 0x05, 0x45, 0xc8, 0x8b, 0x05, 0x45, 0xb8, 0xc2,
+    0x00, 0x89, 0x05, 0x45, 0x99, 0x83, 0x05, 0x45, 0x68, 0x83, 0x05, 0x45,
+    0x89, 0xc2, 0x0d, 0x01, 0x05, 0x45, 0x81, 0xc2, 0x00, 0xce, 0x05, 0x45,
+    0x78, 0x83, 0x05, 0x45, 0x71, 0x47, 0xaa, 0xd3, 0x42, 0x03, 0xcd, 0xc2,
+    0x00, 0xce, 0x05, 0x45, 0x49, 0x83, 0x05, 0x45, 0x40, 0xc2, 0x00, 0xce,
+    0x05, 0x45, 0x39, 0x83, 0x05, 0x45, 0x30, 0x83, 0x05, 0x45, 0x29, 0xc2,
+    0x03, 0x83, 0x05, 0x45, 0x01, 0xc2, 0x1a, 0x18, 0x05, 0x44, 0xd9, 0xc2,
+    0x00, 0xeb, 0x05, 0x44, 0xb0, 0xc2, 0x00, 0xce, 0x05, 0x45, 0x21, 0x83,
+    0x05, 0x45, 0x19, 0x06, 0x42, 0x03, 0xdb, 0xc2, 0x00, 0xce, 0x05, 0x45,
+    0x11, 0x83, 0x05, 0x45, 0x09, 0x16, 0x42, 0x03, 0xe5, 0xc2, 0x00, 0xce,
+    0x05, 0x44, 0xd1, 0x83, 0x05, 0x44, 0xc8, 0x91, 0x05, 0x44, 0x80, 0x97,
+    0x05, 0x44, 0x89, 0x83, 0x05, 0x44, 0x19, 0x8b, 0x05, 0x44, 0x70, 0x83,
+    0x05, 0x44, 0x91, 0xc2, 0x00, 0xce, 0x05, 0x44, 0x98, 0x83, 0x05, 0x44,
+    0xa1, 0xc2, 0x00, 0xce, 0x05, 0x44, 0xa8, 0x83, 0x05, 0x44, 0xb9, 0xc2,
+    0x00, 0xce, 0x05, 0x44, 0xc0, 0x8b, 0x05, 0x44, 0x28, 0x97, 0x05, 0x44,
+    0x38, 0x87, 0x05, 0x44, 0x68, 0xdd, 0x04, 0x0c, 0x0f, 0xb3, 0xb9, 0x44,
+    0x05, 0x80, 0x42, 0x03, 0xef, 0xe0, 0x06, 0xc9, 0x0f, 0xb3, 0xc0, 0xc4,
+    0xe3, 0x8c, 0x00, 0x41, 0xf1, 0xc3, 0x0d, 0xcc, 0x00, 0x41, 0x90, 0xc5,
+    0xd8, 0x6e, 0x00, 0x40, 0xb8, 0x83, 0x00, 0x40, 0xf0, 0x83, 0x00, 0x40,
+    0xf8, 0xd0, 0x5d, 0x02, 0x01, 0x54, 0xb8, 0xd0, 0x5d, 0x02, 0x01, 0x54,
+    0xc0, 0x07, 0xc2, 0x03, 0xf5, 0x44, 0x00, 0x8e, 0xc2, 0x04, 0x01, 0xc9,
+    0xae, 0xb0, 0x08, 0x8e, 0x69, 0xca, 0x9a, 0x16, 0x08, 0x8e, 0x48, 0xc3,
+    0x52, 0x66, 0x08, 0x8e, 0xd1, 0xd5, 0x35, 0x38, 0x08, 0x8e, 0x60, 0x45,
+    0x04, 0x9a, 0xc2, 0x04, 0x2f, 0xcb, 0x8c, 0xe6, 0x08, 0x8e, 0x31, 0xc4,
+    0x19, 0xf1, 0x08, 0x8e, 0x28, 0x45, 0x00, 0x8d, 0xc2, 0x04, 0x53, 0xcd,
+    0x79, 0xd8, 0x08, 0x8e, 0x58, 0xc2, 0x00, 0xce, 0x08, 0x8d, 0x91, 0x15,
+    0xc2, 0x04, 0x79, 0x18, 0xc2, 0x04, 0x89, 0x0e, 0xc2, 0x04, 0x93, 0xc2,
+    0x00, 0x3b, 0x08, 0x8d, 0x59, 0xc2, 0x1a, 0x18, 0x08, 0x8d, 0x51, 0xc2,
+    0x00, 0xb6, 0x08, 0x8d, 0x49, 0x04, 0xc2, 0x04, 0x9d, 0x12, 0xc2, 0x04,
+    0xa7, 0x10, 0xc2, 0x04, 0xb1, 0x06, 0xc2, 0x04, 0xc7, 0x16, 0xc2, 0x04,
+    0xd5, 0x0c, 0xc2, 0x04, 0xe3, 0x05, 0xc2, 0x04, 0xed, 0x09, 0xc2, 0x04,
+    0xf7, 0x0d, 0xc2, 0x05, 0x01, 0x83, 0x08, 0x8c, 0x1b, 0x02, 0x05, 0x0b,
+    0x91, 0x08, 0x8c, 0x79, 0x87, 0x08, 0x8c, 0x69, 0x97, 0x08, 0x8c, 0x3b,
+    0x02, 0x05, 0x17, 0x8b, 0x08, 0x8c, 0x2a, 0x02, 0x05, 0x1b, 0xc2, 0x01,
+    0x5d, 0x08, 0x22, 0x89, 0x0a, 0x42, 0x05, 0x1f, 0x91, 0x08, 0x22, 0xa9,
+    0xc3, 0x13, 0xb2, 0x08, 0x22, 0xb0, 0x83, 0x08, 0x22, 0xc1, 0x99, 0x08,
+    0x23, 0xf8, 0xc3, 0x38, 0x9c, 0x08, 0x22, 0xc9, 0xc4, 0xdf, 0xfc, 0x08,
+    0x23, 0x18, 0xc6, 0x13, 0xaf, 0x08, 0x23, 0x01, 0xc3, 0x00, 0xf0, 0x08,
+    0x23, 0x28, 0x87, 0x08, 0x23, 0x11, 0xc2, 0x02, 0x1e, 0x08, 0x23, 0x58,
+    0x88, 0x08, 0x23, 0x31, 0xc2, 0x01, 0x0e, 0x08, 0x23, 0x91, 0xc2, 0x00,
+    0x6b, 0x08, 0x23, 0xf0, 0xc2, 0x0f, 0x25, 0x08, 0x23, 0x39, 0x03, 0xc2,
+    0x05, 0x2b, 0xc2, 0x00, 0x84, 0x08, 0x23, 0xd8, 0xc2, 0x00, 0xa7, 0x08,
+    0x23, 0x41, 0xc2, 0x00, 0xd8, 0x08, 0x23, 0x49, 0x8a, 0x08, 0x23, 0x69,
+    0xc2, 0x01, 0x3d, 0x08, 0x23, 0x89, 0xc2, 0x00, 0x2b, 0x08, 0x23, 0xb9,
+    0x14, 0xc2, 0x05, 0x33, 0xc2, 0x00, 0x7d, 0x08, 0x23, 0xd0, 0x90, 0x08,
+    0x23, 0x51, 0xc2, 0x06, 0x4d, 0x08, 0x23, 0x61, 0xc2, 0x07, 0x42, 0x08,
+    0x23, 0xa1, 0xc3, 0x0a, 0x43, 0x08, 0x23, 0xa9, 0xc2, 0x01, 0xd7, 0x08,
+    0x23, 0xb1, 0x94, 0x08, 0x23, 0xc8, 0xe0, 0x09, 0x49, 0x01, 0x4a, 0x20,
+    0xcd, 0x78, 0xa0, 0x01, 0x57, 0x38, 0x01, 0x42, 0x05, 0x3d, 0xd6, 0x2e,
+    0x98, 0x01, 0x5a, 0x79, 0x4c, 0x84, 0xfc, 0x42, 0x05, 0x49, 0x01, 0x42,
+    0x05, 0x4f, 0xc7, 0x10, 0x64, 0x01, 0x5b, 0xc8, 0xc4, 0x4d, 0x79, 0x0f,
+    0xb2, 0x89, 0xc9, 0xab, 0x1a, 0x0f, 0xb2, 0xc9, 0xc3, 0x95, 0xf5, 0x0f,
+    0xb3, 0x08, 0x01, 0x42, 0x05, 0x5b, 0xc7, 0x10, 0x64, 0x01, 0x5b, 0xc0,
+    0xc4, 0x4d, 0x79, 0x0f, 0xb2, 0x99, 0xc9, 0xab, 0x1a, 0x0f, 0xb2, 0xd9,
+    0xc3, 0x95, 0xf5, 0x0f, 0xb3, 0x18, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0x49,
+    0x83, 0x08, 0xd3, 0x40, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0xb1, 0x83, 0x08,
+    0xd3, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0xd3, 0x39, 0x83, 0x08, 0xd3, 0x30,
+    0x8e, 0x08, 0xd2, 0xd1, 0x94, 0x08, 0xd2, 0xc8, 0x97, 0x08, 0xd2, 0xc1,
+    0x8b, 0x08, 0xd2, 0xb8, 0x87, 0x08, 0xd2, 0xb0, 0x87, 0x08, 0xd2, 0x90,
+    0xca, 0x52, 0x3b, 0x08, 0x7a, 0xb0, 0xc3, 0x17, 0x62, 0x08, 0x79, 0xf9,
+    0xc4, 0xd9, 0x0f, 0x08, 0x79, 0xe0, 0xc5, 0xd1, 0xa3, 0x0f, 0xbc, 0xb1,
+    0xc2, 0x00, 0x47, 0x01, 0x99, 0x39, 0xc2, 0xe6, 0x14, 0x01, 0x9c, 0xa0,
+    0x11, 0xc2, 0x05, 0x73, 0x8f, 0x01, 0x9c, 0xc8, 0x44, 0x00, 0x93, 0xc2,
+    0x05, 0x7f, 0xc4, 0x87, 0x60, 0x01, 0x9a, 0xb9, 0x84, 0x01, 0x9e, 0xe8,
+    0x11, 0xc2, 0x05, 0xb9, 0xd5, 0x35, 0x4d, 0x01, 0x56, 0x69, 0x8f, 0x01,
+    0x9e, 0x81, 0x90, 0x01, 0x9e, 0x89, 0x9a, 0x01, 0x9e, 0x98, 0xca, 0x29,
+    0x5a, 0x01, 0x14, 0x83, 0x02, 0x05, 0xc3, 0xc3, 0x67, 0x98, 0x01, 0x98,
+    0x49, 0xc3, 0x14, 0x11, 0x01, 0x98, 0x51, 0x98, 0x01, 0x9b, 0xa8, 0xc7,
+    0x3d, 0x7f, 0x01, 0x14, 0x7b, 0x02, 0x05, 0xc9, 0x90, 0x01, 0x9e, 0x63,
+    0x02, 0x05, 0xcf, 0x97, 0x01, 0x9b, 0xd0, 0xc2, 0x00, 0x6f, 0x01, 0x14,
+    0xa1, 0x03, 0xc2, 0x05, 0xdb, 0x85, 0x01, 0x9e, 0x21, 0xc8, 0xb9, 0x90,
+    0x01, 0x9e, 0x31, 0x91, 0x01, 0x9e, 0x3b, 0x02, 0x05, 0xe3, 0x8f, 0x01,
+    0x9c, 0xeb, 0x02, 0x05, 0xe9, 0x86, 0x01, 0x9e, 0x28, 0xc3, 0x60, 0x46,
+    0x01, 0x10, 0xd1, 0x0b, 0xc2, 0x05, 0xed, 0x17, 0xc2, 0x05, 0xff, 0x07,
+    0xc2, 0x06, 0x0b, 0xc2, 0x01, 0xe7, 0x01, 0x9d, 0x6a, 0x02, 0x06, 0x17,
+    0xcc, 0x81, 0x24, 0x0f, 0x90, 0x01, 0x89, 0x01, 0x96, 0x61, 0x83, 0x01,
+    0x9e, 0x53, 0x02, 0x06, 0x20, 0x17, 0xc2, 0x06, 0x26, 0x07, 0xc2, 0x06,
+    0x38, 0x11, 0xc2, 0x06, 0x44, 0x92, 0x01, 0x9e, 0x5b, 0x02, 0x06, 0x4c,
+    0x9c, 0x01, 0x9c, 0x80, 0x8c, 0x0f, 0x8c, 0x81, 0x83, 0x01, 0x9b, 0x93,
+    0x02, 0x06, 0x50, 0xc3, 0x14, 0x88, 0x01, 0x99, 0x29, 0xc3, 0x2b, 0x56,
+    0x01, 0x99, 0x31, 0x84, 0x01, 0x9e, 0x41, 0x8f, 0x01, 0x9b, 0xbb, 0x02,
+    0x06, 0x56, 0x8e, 0x01, 0x9c, 0xb8, 0x11, 0xc2, 0x06, 0x5a, 0x83, 0x01,
+    0x9d, 0x4b, 0x02, 0x06, 0x6c, 0x0b, 0xc2, 0x06, 0x76, 0x07, 0xc2, 0x06,
+    0x80, 0x8a, 0x01, 0x9e, 0xb9, 0x8f, 0x01, 0x9e, 0xc1, 0xc2, 0xa8, 0x96,
+    0x01, 0x9e, 0xc9, 0x94, 0x01, 0x9e, 0xd1, 0x85, 0x01, 0x9b, 0xb1, 0x88,
+    0x01, 0x9c, 0x51, 0x95, 0x01, 0x9d, 0x81, 0x98, 0x01, 0x9d, 0xa1, 0x99,
+    0x01, 0x9d, 0xd0, 0x14, 0xc2, 0x06, 0x90, 0x98, 0x01, 0x96, 0x71, 0xc7,
+    0xc6, 0x82, 0x01, 0x98, 0x39, 0xc4, 0xe0, 0x70, 0x01, 0x98, 0x40, 0xc5,
+    0xd4, 0x0e, 0x01, 0x98, 0x01, 0xc5, 0xdd, 0x73, 0x01, 0x98, 0x09, 0xc4,
+    0xe2, 0xa4, 0x01, 0x98, 0x11, 0xc3, 0x3b, 0x4b, 0x01, 0x98, 0x19, 0x97,
+    0x01, 0x9b, 0x99, 0x8f, 0x01, 0x9e, 0x11, 0xc7, 0x21, 0xc2, 0x01, 0x9e,
+    0xf8, 0x83, 0x01, 0x9c, 0x23, 0x02, 0x06, 0x9a, 0xc5, 0xda, 0x0d, 0x01,
+    0x98, 0x91, 0xc3, 0x19, 0x6b, 0x01, 0x98, 0xa3, 0x02, 0x06, 0xa4, 0x42,
+    0x00, 0x35, 0xc2, 0x06, 0xb6, 0xc4, 0x12, 0xc4, 0x01, 0x98, 0xe1, 0x11,
+    0xc2, 0x06, 0xc2, 0x89, 0x01, 0x9c, 0x79, 0x8d, 0x01, 0x9e, 0x69, 0x8f,
+    0x01, 0x9c, 0xf3, 0x02, 0x06, 0xce, 0x96, 0x01, 0x9e, 0x79, 0x84, 0x01,
+    0x9c, 0x29, 0xc3, 0x03, 0xc6, 0x01, 0x9c, 0x49, 0xc2, 0xe6, 0x14, 0x01,
+    0x9c, 0x89, 0x8e, 0x01, 0x9c, 0xc1, 0xc2, 0x04, 0xf2, 0x01, 0x9d, 0x51,
+    0x98, 0x01, 0x9d, 0xc1, 0x99, 0x01, 0x9d, 0xf1, 0xc4, 0xe2, 0xb8, 0x01,
+    0x9e, 0x00, 0x03, 0xc2, 0x06, 0xd2, 0x0b, 0xc2, 0x06, 0xe2, 0xc5, 0xd2,
+    0x51, 0x01, 0x98, 0xc3, 0x02, 0x06, 0xf4, 0x9b, 0x01, 0x9e, 0x49, 0x84,
+    0x01, 0x9c, 0x39, 0xc2, 0xe6, 0x14, 0x01, 0x9c, 0x99, 0xc2, 0x04, 0xf2,
+    0x01, 0x9d, 0x60, 0x03, 0xc2, 0x06, 0xfa, 0xc6, 0xcd, 0xb8, 0x01, 0x99,
+    0x09, 0x43, 0x01, 0x0f, 0xc2, 0x07, 0x06, 0x94, 0x01, 0x9e, 0xd9, 0x98,
+    0x01, 0x9e, 0xe0, 0x83, 0x01, 0x9c, 0x0b, 0x02, 0x07, 0x0e, 0xc4, 0x0b,
+    0xfd, 0x01, 0x99, 0x49, 0x88, 0x01, 0x9c, 0x59, 0x8f, 0x01, 0x9c, 0xd1,
+    0x95, 0x01, 0x9d, 0x89, 0x98, 0x01, 0x9d, 0xa9, 0x99, 0x01, 0x9d, 0xd8,
+    0x03, 0xc2, 0x07, 0x14, 0xc3, 0xce, 0x4f, 0x01, 0x99, 0x89, 0xc7, 0xc6,
+    0x5f, 0x01, 0x99, 0xa1, 0xc4, 0xe0, 0x88, 0x01, 0x99, 0xe1, 0xc5, 0xd4,
+    0x81, 0x01, 0x99, 0xf1, 0x93, 0x01, 0x9e, 0x18, 0x83, 0x01, 0x9c, 0x1b,
+    0x02, 0x07, 0x1e, 0x0b, 0xc2, 0x07, 0x34, 0x07, 0xc2, 0x07, 0x47, 0x42,
+    0x00, 0xf5, 0xc2, 0x07, 0x56, 0x89, 0x01, 0x9c, 0x71, 0x01, 0xc2, 0x07,
+    0x76, 0x84, 0x01, 0x9c, 0x33, 0x02, 0x07, 0x86, 0xc2, 0x02, 0x1e, 0x01,
+    0x9e, 0xb1, 0xc2, 0xe6, 0x14, 0x01, 0x9c, 0x91, 0x8e, 0x01, 0x9c, 0xb1,
+    0x8f, 0x01, 0x9c, 0xe3, 0x02, 0x07, 0x8c, 0xc2, 0x04, 0xf2, 0x01, 0x9d,
+    0x59, 0x95, 0x01, 0x9d, 0x99, 0x98, 0x01, 0x9d, 0xbb, 0x02, 0x07, 0x90,
+    0x99, 0x01, 0x9d, 0xea, 0x02, 0x07, 0x96, 0x42, 0x12, 0x99, 0xc2, 0x07,
+    0x9c, 0xc3, 0x97, 0xe3, 0x01, 0x9a, 0x80, 0x11, 0xc2, 0x07, 0xa8, 0x45,
+    0x09, 0x34, 0x42, 0x07, 0xb4, 0xc6, 0x13, 0x38, 0x01, 0x36, 0xe9, 0xc2,
+    0x6d, 0x83, 0x0f, 0x8d, 0x51, 0xc6, 0xcb, 0x72, 0x0f, 0x8d, 0x19, 0x07,
+    0xc2, 0x07, 0xc0, 0xc2, 0x0c, 0x05, 0x0f, 0x8c, 0xc1, 0x95, 0x0f, 0x8a,
+    0x69, 0x86, 0x0f, 0x8a, 0x61, 0xc5, 0x09, 0x2c, 0x01, 0x4e, 0x41, 0xcb,
+    0x11, 0xf6, 0x01, 0x4e, 0x38, 0xc2, 0x18, 0xf5, 0x01, 0x35, 0xf9, 0x48,
+    0xbd, 0xa8, 0x42, 0x07, 0xcc, 0xc4, 0x00, 0xf0, 0x01, 0x15, 0x01, 0x19,
+    0xc2, 0x07, 0xde, 0xc6, 0x03, 0xe0, 0x0f, 0x8c, 0xd8, 0xc4, 0x19, 0x44,
+    0x01, 0x14, 0xf9, 0x98, 0x0f, 0x8a, 0x58, 0xc3, 0x23, 0xe0, 0x01, 0x14,
+    0xf1, 0xc2, 0xc5, 0x4d, 0x0f, 0x8a, 0x70, 0x55, 0x2e, 0x2b, 0xc2, 0x07,
+    0xea, 0xc3, 0x96, 0xaf, 0x0f, 0x8c, 0x91, 0x8e, 0x0f, 0x8c, 0x88, 0xc2,
+    0x04, 0x84, 0x0f, 0x8d, 0x61, 0x95, 0x0f, 0x8c, 0xd0, 0xc2, 0x02, 0x48,
+    0x0f, 0x8d, 0x59, 0xd7, 0x27, 0x31, 0x0f, 0x8c, 0xc8, 0xc5, 0xdd, 0xdc,
+    0x0f, 0x8d, 0x41, 0xc2, 0x06, 0x5e, 0x0f, 0x8d, 0x39, 0x98, 0x0f, 0x8a,
+    0x51, 0x85, 0x0f, 0x8d, 0x30, 0xd3, 0x43, 0xd3, 0x0f, 0x8d, 0x21, 0x8d,
+    0x0f, 0x8c, 0xb8, 0xcd, 0x75, 0xe2, 0x0f, 0x8d, 0x01, 0x44, 0x04, 0xa0,
+    0xc2, 0x08, 0x04, 0xc3, 0x03, 0xe1, 0x0f, 0x8c, 0x99, 0xd5, 0x36, 0x88,
+    0x01, 0x4e, 0x28, 0x89, 0x0f, 0x8c, 0xb1, 0xc2, 0x05, 0x88, 0x0f, 0x8c,
+    0xa8, 0xc9, 0x2a, 0x36, 0x01, 0x21, 0x30, 0xc2, 0x00, 0xaf, 0x01, 0x20,
+    0x79, 0xc3, 0x08, 0x05, 0x01, 0x20, 0x70, 0xc4, 0x26, 0xff, 0x01, 0x20,
+    0x11, 0xc7, 0xc0, 0x7e, 0x01, 0x20, 0x08, 0xc4, 0x70, 0x5d, 0x01, 0x21,
+    0x0b, 0x02, 0x08, 0x0e, 0x4d, 0x77, 0x34, 0x42, 0x08, 0x14, 0xc5, 0xda,
+    0x99, 0x01, 0x21, 0x21, 0xd2, 0x4b, 0x19, 0x01, 0x20, 0xa8, 0x45, 0x02,
+    0xd3, 0xc2, 0x08, 0x24, 0xc5, 0xd4, 0x22, 0x01, 0x20, 0x28, 0x49, 0xad,
+    0x2d, 0xc2, 0x08, 0x2e, 0xc2, 0x00, 0xf0, 0x00, 0x39, 0x08, 0xc3, 0x0a,
+    0xc8, 0x00, 0x38, 0xdb, 0x02, 0x08, 0x56, 0xc2, 0x2f, 0x05, 0x00, 0x39,
+    0x60, 0xc2, 0x00, 0x60, 0x00, 0x38, 0xd0, 0xd2, 0x4c, 0x15, 0x00, 0x38,
+    0xb1, 0xc5, 0x4c, 0x1d, 0x00, 0x38, 0xa8, 0xc9, 0xb3, 0x03, 0x00, 0x38,
+    0xa0, 0xd0, 0x59, 0xb2, 0x00, 0x38, 0x89, 0xc3, 0x11, 0x9a, 0x00, 0x39,
+    0x59, 0xc6, 0x7a, 0xbc, 0x00, 0x39, 0x19, 0xc4, 0x8f, 0x78, 0x00, 0x39,
+    0x41, 0x47, 0xc0, 0xee, 0x42, 0x08, 0x5c, 0x46, 0xcc, 0x20, 0x42, 0x08,
+    0x6e, 0xc3, 0x02, 0x3c, 0x00, 0x39, 0x51, 0xca, 0xa7, 0x68, 0x00, 0x39,
+    0x38, 0xc3, 0x10, 0xa0, 0x00, 0x38, 0xf0, 0xca, 0x9d, 0xc2, 0x00, 0x38,
+    0x69, 0xc9, 0xb4, 0x35, 0x00, 0x38, 0x61, 0xc6, 0xb4, 0x38, 0x00, 0x38,
+    0x58, 0x01, 0xc2, 0x08, 0x80, 0xcd, 0x77, 0xc3, 0x00, 0x39, 0xe0, 0xc5,
+    0x00, 0x64, 0x00, 0x38, 0x39, 0xc4, 0x00, 0x2f, 0x00, 0x38, 0x30, 0xc5,
+    0x36, 0xec, 0x00, 0x38, 0x23, 0x02, 0x08, 0x8c, 0xc9, 0x11, 0xa1, 0x00,
+    0x38, 0x10, 0xc5, 0x36, 0xec, 0x00, 0x38, 0x1b, 0x02, 0x08, 0x92, 0xc9,
+    0x11, 0xa1, 0x00, 0x38, 0x08, 0xc5, 0x00, 0xd2, 0x00, 0x39, 0xe9, 0xc5,
+    0x01, 0x24, 0x00, 0x39, 0xf0, 0xc5, 0x01, 0x24, 0x00, 0x39, 0xb9, 0xc5,
+    0x00, 0xd2, 0x00, 0x39, 0xb0, 0xc5, 0x00, 0xd2, 0x00, 0x3a, 0x19, 0xc5,
+    0x01, 0x24, 0x00, 0x3a, 0x20, 0xc5, 0x00, 0xd2, 0x00, 0x3a, 0x29, 0xc5,
+    0x01, 0x24, 0x00, 0x3a, 0x30, 0xc2, 0x00, 0x4a, 0x05, 0x40, 0x89, 0x91,
+    0x05, 0x40, 0x80, 0x91, 0x05, 0x40, 0x91, 0xc2, 0x00, 0x4a, 0x05, 0x40,
+    0x98, 0xd1, 0x54, 0xba, 0x0f, 0xa8, 0x51, 0xce, 0x71, 0x12, 0x0f, 0xa8,
+    0x49, 0xd3, 0x23, 0x3a, 0x0f, 0xa8, 0x38, 0x4a, 0x87, 0x4a, 0xc2, 0x08,
+    0x98, 0x1e, 0x42, 0x08, 0xbc, 0xc7, 0x02, 0x6a, 0x0e, 0xc8, 0x99, 0xc8,
+    0x3b, 0x12, 0x0e, 0xc8, 0x91, 0xc6, 0x23, 0x4d, 0x0e, 0xc8, 0x88, 0x4c,
+    0x87, 0x48, 0xc2, 0x08, 0xc8, 0xc4, 0x01, 0x3c, 0x0e, 0xd3, 0xf0, 0xda,
+    0x1c, 0x3a, 0x0e, 0xd3, 0x81, 0x44, 0x06, 0x32, 0x42, 0x08, 0xdc, 0xc8,
+    0xb5, 0xb8, 0x0e, 0xd0, 0x99, 0xc7, 0xc5, 0x24, 0x0e, 0xd0, 0x91, 0xc7,
+    0x81, 0xb9, 0x0e, 0xd0, 0x88, 0xca, 0x9a, 0x66, 0x0e, 0xd0, 0x43, 0x02,
+    0x08, 0xe6, 0xcf, 0x63, 0x95, 0x0e, 0xd0, 0x38, 0xc3, 0x0d, 0xc9, 0x0e,
+    0xd4, 0x51, 0xc3, 0x04, 0x0e, 0x0e, 0xd4, 0x38, 0xc6, 0xcf, 0x50, 0x0e,
+    0xd1, 0x61, 0xc7, 0x81, 0xb9, 0x0e, 0xd1, 0x59, 0xc6, 0xcf, 0x92, 0x0e,
+    0xd1, 0x50, 0xd2, 0x48, 0x49, 0x0e, 0xd3, 0x89, 0x44, 0x08, 0x3f, 0x42,
+    0x08, 0xec, 0xd1, 0x51, 0x35, 0x0e, 0xc9, 0x01, 0x15, 0xc2, 0x08, 0xf8,
+    0x46, 0x16, 0x70, 0x42, 0x09, 0x04, 0xc7, 0x02, 0x6a, 0x0e, 0xc8, 0xa9,
+    0xc7, 0x07, 0xf3, 0x0e, 0xc8, 0xa0, 0xc7, 0x02, 0x6a, 0x0e, 0xc8, 0x69,
+    0xc8, 0x3b, 0x12, 0x0e, 0xc8, 0x61, 0xc6, 0x23, 0x4d, 0x0e, 0xc8, 0x58,
+    0x01, 0xc2, 0x09, 0x10, 0x1e, 0x42, 0x09, 0x2e, 0x43, 0x0e, 0xb5, 0xc2,
+    0x09, 0x3a, 0x12, 0x42, 0x09, 0x46, 0x44, 0xde, 0x8c, 0xc2, 0x09, 0x50,
+    0x45, 0xda, 0xc6, 0xc2, 0x09, 0x5c, 0x44, 0x5d, 0x8f, 0x42, 0x09, 0x80,
+    0xc3, 0x0a, 0xc8, 0x0e, 0xd3, 0x0b, 0x02, 0x09, 0x92, 0x4b, 0x8c, 0x57,
+    0x42, 0x09, 0x96, 0x4b, 0x45, 0x03, 0xc2, 0x09, 0xa8, 0x4a, 0x15, 0xe9,
+    0x42, 0x09, 0xb4, 0x45, 0xdc, 0x9c, 0xc2, 0x09, 0xc6, 0x47, 0xc9, 0x06,
+    0xc2, 0x09, 0xd2, 0x01, 0xc2, 0x09, 0xe4, 0x42, 0x00, 0x5b, 0xc2, 0x09,
+    0xf0, 0x4f, 0x60, 0x98, 0x42, 0x0a, 0x0e, 0xc2, 0x00, 0x7d, 0x0e, 0xd3,
+    0x59, 0x43, 0x14, 0xa5, 0x42, 0x0a, 0x20, 0x01, 0x42, 0x0a, 0x3e, 0x19,
+    0xc2, 0x0a, 0x4a, 0xc7, 0xc5, 0x24, 0x0e, 0xd1, 0x91, 0xc7, 0x81, 0xb9,
+    0x0e, 0xd1, 0x88, 0x4b, 0x45, 0x03, 0xc2, 0x0a, 0x56, 0x4a, 0x15, 0xe9,
+    0xc2, 0x0a, 0x9c, 0x49, 0x1f, 0xcf, 0xc2, 0x0a, 0xe2, 0x46, 0xce, 0xe4,
+    0x42, 0x0a, 0xf4, 0x49, 0xaf, 0x88, 0xc2, 0x0b, 0x06, 0x05, 0xc2, 0x0b,
+    0x12, 0xc5, 0xdc, 0x8d, 0x0e, 0xd2, 0x83, 0x02, 0x0b, 0x1e, 0xc4, 0x64,
+    0x45, 0x0e, 0xd2, 0x6b, 0x02, 0x0b, 0x22, 0x45, 0x00, 0x77, 0xc2, 0x0b,
+    0x26, 0xc5, 0x75, 0x46, 0x0e, 0xd2, 0x0b, 0x02, 0x0b, 0x4a, 0xc5, 0xac,
+    0x86, 0x0e, 0xd1, 0xf2, 0x02, 0x0b, 0x4e, 0xc6, 0xd2, 0x32, 0x0e, 0xd1,
+    0xd1, 0xc6, 0xcb, 0xfc, 0x0e, 0xd1, 0xc8, 0xc7, 0x02, 0x6a, 0x0e, 0xc8,
+    0x81, 0xc8, 0x3b, 0x12, 0x0e, 0xc8, 0x79, 0xc6, 0x23, 0x4d, 0x0e, 0xc8,
+    0x70, 0xd0, 0x5b, 0xb2, 0x0e, 0xd1, 0xc1, 0xc6, 0x09, 0x93, 0x0e, 0xd1,
+    0xb0, 0xd0, 0x5b, 0xb2, 0x0e, 0xd1, 0xb9, 0xc7, 0x59, 0xa7, 0x0e, 0xd1,
+    0xa8, 0x48, 0xba, 0x58, 0xc2, 0x0b, 0x52, 0xca, 0x9a, 0x2a, 0x0e, 0xd0,
+    0x79, 0xcc, 0x81, 0xb4, 0x0e, 0xd0, 0x70, 0xc7, 0xc3, 0x4f, 0x0e, 0xcf,
+    0xf1, 0xd0, 0x5c, 0xf2, 0x0e, 0xcf, 0xe9, 0x15, 0xc2, 0x0b, 0x5e, 0xc7,
+    0x38, 0xef, 0x0e, 0xcf, 0xd1, 0xc5, 0xdc, 0x8d, 0x0e, 0xcf, 0xc9, 0xc4,
+    0xe1, 0x4c, 0x0e, 0xcf, 0xb9, 0x4a, 0x20, 0xa1, 0x42, 0x0b, 0x6d, 0xca,
+    0xa4, 0xb6, 0x08, 0xae, 0xe3, 0x02, 0x0b, 0x79, 0x97, 0x08, 0xad, 0xd9,
+    0x8b, 0x08, 0xad, 0xc9, 0x83, 0x08, 0xad, 0x78, 0x94, 0x08, 0xad, 0xa8,
+    0x97, 0x08, 0xad, 0x98, 0x8b, 0x08, 0xad, 0x88, 0xca, 0xa4, 0xb6, 0x08,
+    0xae, 0xd9, 0x97, 0x08, 0xac, 0x69, 0x8b, 0x08, 0xac, 0x59, 0x83, 0x08,
+    0xac, 0x08, 0xd5, 0x34, 0xa5, 0x08, 0xae, 0xcb, 0x02, 0x0b, 0x7d, 0x0a,
+    0xc2, 0x0b, 0x81, 0x83, 0x08, 0xac, 0xe9, 0x16, 0x42, 0x0b, 0x8b, 0x83,
+    0x08, 0xad, 0x69, 0xc2, 0x0d, 0x01, 0x08, 0xad, 0x61, 0xc2, 0x00, 0xce,
+    0x08, 0xad, 0x58, 0x83, 0x08, 0xad, 0x51, 0x47, 0xaa, 0xd3, 0x42, 0x0b,
+    0x95, 0xc2, 0x00, 0xce, 0x08, 0xad, 0x29, 0x83, 0x08, 0xad, 0x20, 0xc2,
+    0x00, 0xce, 0x08, 0xad, 0x19, 0x83, 0x08, 0xad, 0x10, 0x83, 0x08, 0xad,
+    0x09, 0xc2, 0x03, 0x83, 0x08, 0xac, 0xe1, 0xc2, 0x1a, 0x18, 0x08, 0xac,
+    0xb9, 0xc2, 0x00, 0xeb, 0x08, 0xac, 0x90, 0xc2, 0x00, 0xce, 0x08, 0xad,
+    0x01, 0x83, 0x08, 0xac, 0xf9, 0x06, 0x42, 0x0b, 0xa3, 0xc2, 0x00, 0xce,
+    0x08, 0xac, 0xb1, 0x83, 0x08, 0xac, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0xac,
+    0xa1, 0x83, 0x08, 0xac, 0x98, 0xc2, 0x00, 0xce, 0x08, 0xac, 0x89, 0x83,
+    0x08, 0xac, 0x80, 0xc2, 0x00, 0xce, 0x08, 0xac, 0x79, 0x83, 0x08, 0xac,
+    0x70, 0x97, 0x08, 0xac, 0x28, 0x8b, 0x08, 0xac, 0x18, 0x4b, 0x97, 0x41,
+    0xc2, 0x0b, 0xad, 0x48, 0x1b, 0x42, 0x42, 0x0b, 0xbc, 0xc7, 0xc8, 0xf1,
+    0x08, 0xae, 0x09, 0xc5, 0x34, 0xd9, 0x08, 0xae, 0x01, 0x42, 0x06, 0xb4,
+    0xc2, 0x0b, 0xc8, 0xc8, 0x14, 0x02, 0x08, 0xad, 0xe9, 0xcb, 0x1f, 0xe9,
+    0x08, 0xad, 0xe0, 0xe0, 0x0b, 0x49, 0x01, 0x01, 0xd0, 0x07, 0xc2, 0x0b,
+    0xd4, 0xd3, 0x44, 0x58, 0x01, 0x00, 0xd0, 0xc2, 0x01, 0xa2, 0x00, 0x04,
+    0x71, 0xc4, 0x03, 0xe0, 0x00, 0x04, 0x78, 0x44, 0x05, 0x16, 0xc2, 0x0b,
+    0xda, 0xc6, 0x2a, 0x48, 0x08, 0x8f, 0x91, 0xc6, 0xcf, 0x44, 0x08, 0x8f,
+    0x89, 0x15, 0xc2, 0x0b, 0xe6, 0x08, 0xc2, 0x0b, 0xf2, 0x16, 0x42, 0x0b,
+    0xfe, 0xc4, 0x28, 0x74, 0x08, 0x8f, 0x49, 0xc5, 0x0a, 0xfd, 0x08, 0x8f,
+    0x41, 0x15, 0xc2, 0x0c, 0x10, 0x08, 0xc2, 0x0c, 0x1c, 0x16, 0xc2, 0x0c,
+    0x28, 0xc3, 0x05, 0x16, 0x08, 0x8f, 0x08, 0xc9, 0xb2, 0x19, 0x00, 0x6c,
+    0x11, 0xc8, 0xbb, 0x68, 0x00, 0x6e, 0x50, 0x03, 0xc2, 0x0c, 0x34, 0x0b,
+    0xc2, 0x0c, 0x5c, 0x17, 0xc2, 0x0c, 0x74, 0x07, 0xc2, 0x0c, 0x80, 0x11,
+    0xc2, 0x0c, 0x8c, 0x0f, 0xc2, 0x0c, 0x98, 0xd2, 0x48, 0xc7, 0x00, 0x6c,
+    0xf1, 0x48, 0xb8, 0xd0, 0xc2, 0x0c, 0xa2, 0x48, 0xbe, 0x30, 0xc2, 0x0c,
+    0xb2, 0x48, 0xbb, 0x30, 0xc2, 0x0c, 0xbe, 0xc7, 0xc4, 0xd7, 0x00, 0x6d,
+    0xd1, 0xc7, 0xc2, 0x06, 0x00, 0x6d, 0xd9, 0xc7, 0xc1, 0xc0, 0x00, 0x6e,
+    0x01, 0xc7, 0xc0, 0xb6, 0x00, 0x6e, 0x21, 0xc7, 0xc3, 0xfe, 0x00, 0x6e,
+    0x30, 0xc4, 0x18, 0xa7, 0x00, 0x6f, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x6f,
+    0x39, 0x16, 0xc2, 0x0c, 0xd0, 0x08, 0xc2, 0x0c, 0xdc, 0x15, 0xc2, 0x0c,
+    0xe8, 0xc5, 0x0a, 0xfd, 0x00, 0x6f, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x6f,
+    0x78, 0x45, 0xae, 0x7a, 0xc2, 0x0c, 0xf4, 0x44, 0xc7, 0xc5, 0x42, 0x0d,
+    0x06, 0xca, 0xa3, 0x4e, 0x00, 0x6e, 0x89, 0xc8, 0xb5, 0x28, 0x00, 0x6e,
+    0x99, 0xc9, 0xac, 0x5e, 0x00, 0x6e, 0xb1, 0xc7, 0xc7, 0xc4, 0x00, 0x6e,
+    0xd1, 0x42, 0x00, 0xeb, 0x42, 0x0d, 0x15, 0xca, 0xa7, 0xa4, 0x00, 0x6e,
+    0xc1, 0xc9, 0x8f, 0xf5, 0x00, 0x6e, 0xf8, 0x01, 0x42, 0x0d, 0x21, 0xcf,
+    0x09, 0x5a, 0x01, 0x4b, 0xd9, 0x42, 0x02, 0x0b, 0x42, 0x0d, 0x36, 0xc3,
+    0x01, 0xa5, 0x01, 0x55, 0xf1, 0xcf, 0x64, 0xb2, 0x01, 0x56, 0x01, 0xd9,
+    0x1d, 0xa3, 0x01, 0x56, 0x10, 0xc6, 0x0e, 0x6a, 0x01, 0x56, 0xb9, 0xde,
+    0x0e, 0x52, 0x01, 0x56, 0xc0, 0x52, 0x4c, 0x4b, 0xc2, 0x0d, 0x42, 0xcf,
+    0x1e, 0xb7, 0x01, 0x03, 0xe8, 0xca, 0x0f, 0xb0, 0x01, 0x03, 0xe1, 0xc4,
+    0x00, 0x65, 0x01, 0x03, 0xc0, 0xc4, 0x17, 0xf7, 0x01, 0x03, 0xb9, 0xc2,
+    0x24, 0x36, 0x01, 0x03, 0xb0, 0xc3, 0x0c, 0xf7, 0x01, 0x03, 0xa9, 0xc3,
+    0x04, 0xa0, 0x01, 0x03, 0xa0, 0xc2, 0x01, 0xa2, 0x00, 0x05, 0x91, 0xc4,
+    0x03, 0xe0, 0x00, 0x05, 0x98, 0xc6, 0xd2, 0x02, 0x00, 0xe6, 0x11, 0xc7,
+    0xc7, 0x2a, 0x00, 0xe6, 0x08, 0x45, 0x22, 0x67, 0xc2, 0x0d, 0x4a, 0x83,
+    0x00, 0xdc, 0xb0, 0xc2, 0x00, 0xce, 0x00, 0xdd, 0xe9, 0x83, 0x00, 0xdc,
+    0xc0, 0xc2, 0x27, 0xff, 0x00, 0xdd, 0xe1, 0x83, 0x00, 0xdc, 0xe0, 0xc2,
+    0x27, 0xff, 0x00, 0xdd, 0xd9, 0x83, 0x00, 0xdc, 0xd8, 0xc2, 0x1a, 0x18,
+    0x00, 0xdd, 0x79, 0x83, 0x00, 0xdc, 0xf0, 0xc2, 0x00, 0xce, 0x00, 0xdd,
+    0x71, 0x83, 0x00, 0xdc, 0x50, 0x83, 0x00, 0xdc, 0xa1, 0xc2, 0x1a, 0x18,
+    0x00, 0xdc, 0x89, 0xc2, 0x00, 0xeb, 0x00, 0xdc, 0x68, 0x97, 0x00, 0xdc,
+    0x48, 0x87, 0x00, 0xdc, 0x30, 0xc4, 0x17, 0xf7, 0x00, 0xdd, 0xb9, 0xc2,
+    0x24, 0x36, 0x00, 0xdd, 0xb0, 0xc3, 0x0c, 0xf7, 0x00, 0xdd, 0xa9, 0xc3,
+    0x04, 0xa0, 0x00, 0xdd, 0xa0, 0xc4, 0x03, 0xe0, 0x00, 0xdd, 0x99, 0xc2,
+    0x01, 0xa2, 0x00, 0xdd, 0x90, 0xc2, 0x00, 0x71, 0x00, 0xdd, 0x69, 0xc2,
+    0x00, 0xb6, 0x00, 0xdd, 0x60, 0xc3, 0xda, 0xfd, 0x00, 0xdd, 0x19, 0xc4,
+    0x89, 0x7d, 0x00, 0xdd, 0x10, 0xc5, 0xdb, 0xd9, 0x00, 0xdd, 0x51, 0x10,
+    0x42, 0x0d, 0x52, 0xc7, 0xc1, 0xce, 0x00, 0xdd, 0x49, 0xc5, 0x0d, 0xc8,
+    0x00, 0xdd, 0x39, 0xc7, 0xc6, 0xb3, 0x00, 0xdd, 0x31, 0xc4, 0xdf, 0xf0,
+    0x00, 0xdd, 0x29, 0xc5, 0xdc, 0x6f, 0x00, 0xdd, 0x20, 0xcb, 0x0f, 0xaf,
+    0x01, 0x55, 0x81, 0xcc, 0x23, 0x59, 0x01, 0x55, 0x90, 0xc8, 0x0b, 0x21,
+    0x01, 0x55, 0xb1, 0xcf, 0x66, 0x0b, 0x01, 0x55, 0xd0, 0xd1, 0x55, 0xa8,
+    0x01, 0x14, 0x51, 0xcb, 0x24, 0x62, 0x01, 0x14, 0x33, 0x02, 0x0d, 0x5c,
+    0x46, 0x00, 0xd2, 0x42, 0x0d, 0x62, 0xc6, 0x2f, 0xa0, 0x01, 0x56, 0x99,
+    0xc4, 0x0e, 0x6c, 0x01, 0x56, 0xa8, 0xca, 0x21, 0x63, 0x0f, 0xb0, 0x1b,
+    0x02, 0x0d, 0x7a, 0x0a, 0xc2, 0x0d, 0x80, 0x15, 0xc2, 0x0d, 0x92, 0xc4,
+    0x25, 0x8d, 0x0f, 0xcb, 0x90, 0xca, 0x21, 0x63, 0x0f, 0xb1, 0xd1, 0xd1,
+    0x55, 0xec, 0x0f, 0xb1, 0xd8, 0x47, 0x6a, 0xb5, 0xc2, 0x0d, 0xa1, 0x42,
+    0x04, 0x0e, 0xc2, 0x0d, 0xad, 0xc3, 0x0d, 0xc9, 0x07, 0xf2, 0xa8, 0xc9,
+    0x82, 0x83, 0x01, 0x10, 0x53, 0x02, 0x0d, 0xb7, 0xcf, 0x0e, 0xee, 0x07,
+    0xf2, 0xb9, 0xc6, 0xb7, 0xe2, 0x07, 0xf2, 0xc1, 0xca, 0x0f, 0xb0, 0x07,
+    0xf3, 0x30, 0x4d, 0x76, 0x09, 0xc2, 0x0d, 0xbd, 0x45, 0x01, 0x79, 0xc2,
+    0x0d, 0xdc, 0xce, 0x69, 0x63, 0x07, 0xf3, 0x40, 0xe0, 0x05, 0x09, 0x08,
+    0x59, 0xd9, 0xc4, 0x20, 0x42, 0x00, 0x16, 0xe0, 0xc7, 0x2c, 0x55, 0x0f,
+    0xb7, 0x49, 0xc8, 0x33, 0xd7, 0x07, 0xf3, 0x01, 0xc7, 0x09, 0x82, 0x07,
+    0xf3, 0x08, 0x43, 0x00, 0x31, 0xc2, 0x0d, 0xee, 0xcc, 0x81, 0xcc, 0x07,
+    0xf3, 0x20, 0xc8, 0x64, 0xb3, 0x07, 0xf3, 0x11, 0xcb, 0x8f, 0xfe, 0x07,
+    0xf3, 0x50, 0x49, 0xac, 0x70, 0xc2, 0x0e, 0x00, 0x15, 0xc2, 0x0e, 0x34,
+    0x03, 0xc2, 0x0e, 0x48, 0x14, 0xc2, 0x0e, 0x5e, 0x16, 0xc2, 0x0e, 0x68,
+    0x0a, 0xc2, 0x0e, 0x76, 0x4a, 0x69, 0xcb, 0xc2, 0x0e, 0x82, 0x0f, 0xc2,
+    0x0e, 0xb6, 0x49, 0x0f, 0xc3, 0xc2, 0x0e, 0xc2, 0x0d, 0xc2, 0x0e, 0xe4,
+    0x13, 0xc2, 0x0e, 0xf0, 0x49, 0xb3, 0x1e, 0xc2, 0x0e, 0xfa, 0x4b, 0x93,
+    0x21, 0xc2, 0x0f, 0x1e, 0x4e, 0x6c, 0x42, 0xc2, 0x0f, 0x36, 0x49, 0xaf,
+    0x52, 0xc2, 0x0f, 0x40, 0x0c, 0xc2, 0x0f, 0x6a, 0x04, 0xc2, 0x0f, 0x76,
+    0x56, 0x31, 0x6e, 0xc2, 0x0f, 0x82, 0xd6, 0x2b, 0xee, 0x07, 0xef, 0xc0,
+    0x4d, 0x75, 0x2c, 0xc2, 0x0f, 0x88, 0x45, 0x01, 0x94, 0x42, 0x0f, 0x94,
+    0x4a, 0xa1, 0x8c, 0xc2, 0x10, 0x15, 0xcc, 0x28, 0xda, 0x00, 0x46, 0x88,
+    0xd4, 0x3f, 0x5e, 0x00, 0x47, 0xf9, 0xcb, 0x3f, 0x67, 0x00, 0x32, 0xc0,
+    0xc7, 0xc4, 0xec, 0x00, 0x44, 0xe1, 0xc7, 0x27, 0xe2, 0x00, 0x32, 0x98,
+    0x06, 0xc2, 0x10, 0x27, 0x49, 0x34, 0xea, 0xc2, 0x10, 0x2f, 0x03, 0xc2,
+    0x10, 0x3b, 0xc3, 0x88, 0x5c, 0x0f, 0x70, 0x09, 0xc4, 0x30, 0x3f, 0x0f,
+    0x70, 0x11, 0xc3, 0x76, 0xe6, 0x0f, 0x70, 0x29, 0x42, 0x01, 0x16, 0xc2,
+    0x10, 0x47, 0xc3, 0x14, 0x15, 0x0f, 0x70, 0x39, 0x16, 0xc2, 0x10, 0x51,
+    0xc3, 0x2d, 0x8d, 0x0f, 0x70, 0x49, 0x0d, 0xc2, 0x10, 0x5f, 0x0e, 0xc2,
+    0x10, 0x6b, 0xc4, 0x1b, 0xb8, 0x0f, 0x70, 0x61, 0xc4, 0x3f, 0x67, 0x0f,
+    0x70, 0x69, 0x15, 0xc2, 0x10, 0x77, 0xc3, 0x0f, 0xba, 0x0f, 0x70, 0x91,
+    0xc3, 0x6e, 0xc6, 0x0f, 0x70, 0x99, 0x48, 0x11, 0x2a, 0xc2, 0x10, 0x8f,
+    0xc3, 0xb3, 0x1e, 0x0f, 0x70, 0x81, 0xc5, 0x93, 0x21, 0x0f, 0x70, 0xd8,
+    0xc3, 0x04, 0x0e, 0x00, 0x32, 0x7b, 0x02, 0x10, 0xe1, 0xcc, 0x89, 0x34,
+    0x00, 0x30, 0x68, 0xd6, 0x2d, 0x38, 0x00, 0x47, 0xdb, 0x02, 0x10, 0xee,
+    0xc7, 0xc8, 0x5e, 0x00, 0x44, 0xf0, 0xc5, 0x00, 0xd2, 0x00, 0x47, 0xc3,
+    0x02, 0x10, 0xf4, 0xc5, 0x01, 0x24, 0x00, 0x47, 0xd0, 0xce, 0x72, 0x9a,
+    0x00, 0x44, 0x41, 0x9b, 0x00, 0x30, 0x40, 0xe0, 0x08, 0xa9, 0x00, 0x37,
+    0x60, 0xce, 0x6e, 0xe2, 0x00, 0x47, 0xb1, 0xcd, 0x02, 0x1c, 0x07, 0xf3,
+    0xd1, 0xcb, 0x64, 0x20, 0x07, 0xf3, 0xd8, 0xce, 0x02, 0x1b, 0x07, 0xf3,
+    0xa0, 0x01, 0xc2, 0x10, 0xfa, 0xc3, 0x0c, 0x85, 0x00, 0x32, 0x5a, 0x02,
+    0x11, 0x0c, 0x45, 0x08, 0xad, 0xc2, 0x11, 0x12, 0x44, 0x0a, 0x78, 0xc2,
+    0x11, 0x66, 0x42, 0x04, 0x70, 0xc2, 0x11, 0x7c, 0xc3, 0x2d, 0x8d, 0x00,
+    0x37, 0x31, 0xc3, 0x76, 0xe6, 0x00, 0x37, 0x29, 0xc5, 0x4b, 0xa4, 0x00,
+    0x30, 0xd1, 0xc5, 0x4e, 0xd7, 0x00, 0x30, 0xc8, 0xc3, 0x31, 0x90, 0x00,
+    0x32, 0x93, 0x02, 0x11, 0x88, 0xd8, 0x23, 0x95, 0x00, 0x44, 0xe9, 0xcc,
+    0x85, 0x8c, 0x00, 0x32, 0xb0, 0x4a, 0xa3, 0xc6, 0xc2, 0x11, 0x8c, 0xc4,
+    0x02, 0x7d, 0x07, 0xdd, 0xf9, 0x16, 0xc2, 0x11, 0x98, 0x42, 0x00, 0xd8,
+    0xc2, 0x11, 0xa4, 0x4a, 0x3c, 0xcf, 0xc2, 0x11, 0xb0, 0xcb, 0x95, 0xcb,
+    0x07, 0xde, 0x10, 0x15, 0xc2, 0x11, 0xbc, 0xc9, 0xaa, 0x15, 0x00, 0x30,
+    0xa1, 0x42, 0x00, 0x3b, 0xc2, 0x11, 0xc6, 0xcf, 0x65, 0x0c, 0x00, 0x30,
+    0x89, 0xc5, 0xdb, 0x66, 0x00, 0x30, 0x78, 0x01, 0x42, 0x11, 0xd2, 0x45,
+    0xdb, 0x7f, 0xc2, 0x11, 0xde, 0x49, 0x03, 0x1b, 0xc2, 0x11, 0xea, 0x48,
+    0x05, 0x16, 0x42, 0x11, 0xf6, 0xc5, 0x1b, 0xcd, 0x00, 0x32, 0x03, 0x02,
+    0x12, 0x02, 0xcb, 0x8e, 0xe0, 0x07, 0xf3, 0x98, 0xc5, 0x4b, 0xa4, 0x00,
+    0x47, 0x33, 0x02, 0x12, 0x08, 0xc5, 0x4e, 0xd7, 0x00, 0x47, 0x2b, 0x02,
+    0x12, 0x0e, 0xc5, 0x63, 0x27, 0x00, 0x47, 0x22, 0x02, 0x12, 0x14, 0xc5,
+    0x00, 0xd2, 0x00, 0x32, 0xa1, 0xc5, 0x01, 0x24, 0x00, 0x32, 0xa8, 0xce,
+    0x74, 0x76, 0x00, 0x44, 0x81, 0xcf, 0x61, 0x1f, 0x00, 0x30, 0x70, 0xc9,
+    0x0f, 0x7e, 0x00, 0x32, 0xe1, 0xd6, 0x2f, 0x1c, 0x00, 0x32, 0xd9, 0xcd,
+    0x2f, 0x25, 0x00, 0x32, 0xd0, 0xc9, 0x08, 0xad, 0x00, 0x37, 0x59, 0xc8,
+    0xbb, 0x58, 0x00, 0x37, 0x50, 0xc4, 0x40, 0x19, 0x00, 0x36, 0xe9, 0xc9,
+    0x5c, 0x19, 0x00, 0x30, 0xe8, 0xc4, 0x17, 0xf7, 0x00, 0x33, 0x39, 0xc2,
+    0x24, 0x36, 0x00, 0x33, 0x30, 0xc3, 0x0c, 0xf7, 0x00, 0x33, 0x29, 0xc3,
+    0x04, 0xa0, 0x00, 0x33, 0x20, 0xc4, 0x03, 0xe0, 0x00, 0x33, 0x19, 0xc2,
+    0x01, 0xa2, 0x00, 0x33, 0x10, 0xc3, 0x60, 0x2e, 0x07, 0xd8, 0xb9, 0xc3,
+    0x00, 0xaf, 0x07, 0xd8, 0xa9, 0xc3, 0x5f, 0x34, 0x07, 0xd8, 0xa1, 0xc3,
+    0x07, 0xa8, 0x07, 0xd8, 0x98, 0xcc, 0x22, 0xc9, 0x00, 0x2c, 0x41, 0xc2,
+    0x04, 0x68, 0x00, 0x2c, 0x10, 0x8a, 0x00, 0x2c, 0x21, 0x90, 0x00, 0x2b,
+    0x78, 0xc3, 0xb5, 0xb7, 0x00, 0x2c, 0x19, 0xc2, 0x07, 0x28, 0x00, 0x2b,
+    0xd0, 0x91, 0x00, 0x2c, 0x09, 0x0a, 0xc2, 0x12, 0x1a, 0x83, 0x00, 0x2b,
+    0x70, 0xc2, 0x07, 0x28, 0x00, 0x2c, 0x01, 0x83, 0x00, 0x2b, 0xe0, 0xc3,
+    0xb9, 0xad, 0x00, 0x2b, 0xf9, 0x91, 0x00, 0x2b, 0x49, 0xc9, 0xaf, 0xbe,
+    0x00, 0x2b, 0x00, 0xc2, 0x05, 0x88, 0x00, 0x2b, 0xf1, 0x91, 0x00, 0x2b,
+    0xc0, 0xc2, 0x07, 0x28, 0x00, 0x2b, 0xe9, 0xc2, 0x00, 0xce, 0x00, 0x2b,
+    0xb8, 0xc3, 0x64, 0x1c, 0x00, 0x2b, 0xd9, 0x83, 0x00, 0x2b, 0x88, 0xc3,
+    0x02, 0xeb, 0x00, 0x2b, 0x91, 0xc2, 0x00, 0xf0, 0x00, 0x2b, 0x18, 0xc2,
+    0x00, 0x61, 0x00, 0x2b, 0x51, 0x83, 0x00, 0x2b, 0x30, 0x96, 0x00, 0x2b,
+    0x41, 0x8a, 0x00, 0x2b, 0x39, 0xc2, 0x11, 0x99, 0x00, 0x2b, 0x28, 0x8a,
+    0x00, 0x2a, 0xa1, 0x90, 0x00, 0x29, 0xf8, 0xc3, 0xb5, 0xb7, 0x00, 0x2a,
+    0x99, 0xc2, 0x07, 0x28, 0x00, 0x2a, 0x50, 0xc2, 0x04, 0x68, 0x00, 0x2a,
+    0x90, 0x91, 0x00, 0x2a, 0x89, 0x0a, 0xc2, 0x12, 0x24, 0x83, 0x00, 0x29,
+    0xf0, 0xc2, 0x07, 0x28, 0x00, 0x2a, 0x81, 0x83, 0x00, 0x2a, 0x60, 0xc3,
+    0xb9, 0xad, 0x00, 0x2a, 0x79, 0x91, 0x00, 0x29, 0xc8, 0xc2, 0x05, 0x88,
+    0x00, 0x2a, 0x71, 0x91, 0x00, 0x2a, 0x40, 0xc2, 0x07, 0x28, 0x00, 0x2a,
+    0x69, 0xc2, 0x00, 0xce, 0x00, 0x2a, 0x38, 0xc3, 0x64, 0x1c, 0x00, 0x2a,
+    0x59, 0x83, 0x00, 0x2a, 0x08, 0xc3, 0x02, 0xeb, 0x00, 0x2a, 0x11, 0xc2,
+    0x00, 0xf0, 0x00, 0x29, 0x98, 0xc2, 0x00, 0x61, 0x00, 0x29, 0xd1, 0x83,
+    0x00, 0x29, 0xb0, 0x96, 0x00, 0x29, 0xc1, 0x8a, 0x00, 0x29, 0xb9, 0xc2,
+    0x11, 0x99, 0x00, 0x29, 0xa8, 0xc4, 0x12, 0x9a, 0x0f, 0x48, 0x09, 0xc2,
+    0x00, 0xce, 0x0f, 0x48, 0x68, 0x83, 0x0f, 0x48, 0x21, 0xc2, 0x00, 0x61,
+    0x0f, 0x48, 0x38, 0xc9, 0xad, 0xab, 0x0f, 0x48, 0x29, 0xc2, 0x00, 0xce,
+    0x0f, 0x49, 0x08, 0xc2, 0x00, 0x61, 0x0f, 0x48, 0x71, 0x83, 0x0f, 0x48,
+    0x90, 0xc2, 0x05, 0x1f, 0x0f, 0x48, 0x81, 0xc2, 0x1a, 0x18, 0x0f, 0x48,
+    0xc9, 0xc2, 0x00, 0xce, 0x0f, 0x48, 0xd8, 0xc2, 0x0f, 0xbb, 0x0f, 0x48,
+    0x89, 0xc2, 0x00, 0xce, 0x0f, 0x48, 0xe9, 0xc2, 0x01, 0x4c, 0x0f, 0x49,
+    0x00, 0x83, 0x0f, 0x48, 0xc1, 0xc2, 0x01, 0x24, 0x0f, 0x48, 0xf0, 0xa1,
+    0x0f, 0xba, 0x19, 0xa2, 0x0f, 0xba, 0x20, 0x1e, 0x42, 0x12, 0x2e, 0xc4,
+    0x19, 0x6b, 0x0f, 0xb8, 0xf1, 0xc6, 0x48, 0xeb, 0x0f, 0xb9, 0x1a, 0x02,
+    0x12, 0x3e, 0xc2, 0xe4, 0xe8, 0x0f, 0xbb, 0x10, 0xc8, 0xba, 0x60, 0x0f,
+    0xba, 0xd0, 0x1e, 0xc2, 0x12, 0x44, 0x44, 0x02, 0xd4, 0x42, 0x12, 0x50,
+    0xc2, 0xe4, 0xe8, 0x0f, 0xb9, 0xe0, 0xcc, 0x83, 0x10, 0x0f, 0xb9, 0x79,
+    0x1e, 0x42, 0x12, 0x5f, 0xc2, 0xe4, 0xe8, 0x0f, 0xb8, 0xb8, 0x45, 0x3d,
+    0x82, 0xc2, 0x12, 0x67, 0xc3, 0x00, 0x46, 0x0f, 0xba, 0xf0, 0x44, 0x02,
+    0xd4, 0x42, 0x12, 0x79, 0xc2, 0xe4, 0xe8, 0x0f, 0xba, 0xe8, 0xc5, 0xd7,
+    0x4c, 0x0f, 0xb8, 0x43, 0x02, 0x12, 0x85, 0xc5, 0xd4, 0x5e, 0x0f, 0xb8,
+    0x32, 0x02, 0x12, 0x8b, 0xc2, 0xe4, 0xe8, 0x0f, 0xb9, 0xb8, 0xa2, 0x0f,
+    0xb8, 0x91, 0xa1, 0x0f, 0xb8, 0x88, 0xa0, 0x0a, 0x21, 0xc9, 0x9f, 0x0a,
+    0x21, 0xc1, 0xa1, 0x0a, 0x21, 0xd1, 0xa2, 0x0a, 0x21, 0xd9, 0xa3, 0x0a,
+    0x21, 0xe1, 0xa4, 0x0a, 0x21, 0xe9, 0xa5, 0x0a, 0x21, 0xf1, 0xa6, 0x0a,
+    0x21, 0xf9, 0xa7, 0x0a, 0x22, 0x01, 0xa8, 0x0a, 0x22, 0x08, 0xa8, 0x0a,
+    0x21, 0xb9, 0xa7, 0x0a, 0x21, 0xb1, 0xa6, 0x0a, 0x21, 0xa9, 0xa5, 0x0a,
+    0x21, 0x93, 0x02, 0x12, 0x91, 0xa4, 0x0a, 0x21, 0x83, 0x02, 0x12, 0x99,
+    0xa3, 0x0a, 0x21, 0x79, 0xa2, 0x0a, 0x21, 0x71, 0xa1, 0x0a, 0x21, 0x69,
+    0xa0, 0x0a, 0x21, 0x5b, 0x02, 0x12, 0x9d, 0x9f, 0x0a, 0x21, 0x50, 0xa8,
+    0x0a, 0x21, 0x43, 0x02, 0x12, 0xa1, 0xa7, 0x0a, 0x21, 0x39, 0xa6, 0x0a,
+    0x21, 0x31, 0xa5, 0x0a, 0x21, 0x29, 0xa4, 0x0a, 0x21, 0x21, 0xa3, 0x0a,
+    0x21, 0x19, 0xa2, 0x0a, 0x21, 0x11, 0xa1, 0x0a, 0x21, 0x09, 0xa0, 0x0a,
+    0x21, 0x01, 0x9f, 0x0a, 0x20, 0xf8, 0xa8, 0x0a, 0x20, 0xf1, 0xa7, 0x0a,
+    0x20, 0xe9, 0xa6, 0x0a, 0x20, 0xe1, 0xa5, 0x0a, 0x20, 0xd3, 0x02, 0x12,
+    0xa5, 0xa4, 0x0a, 0x20, 0xc9, 0xa3, 0x0a, 0x20, 0xc1, 0xa2, 0x0a, 0x20,
+    0xb9, 0xa1, 0x0a, 0x20, 0xb1, 0xa0, 0x0a, 0x20, 0xa9, 0x9f, 0x0a, 0x20,
+    0xa0, 0xa8, 0x0a, 0x20, 0x99, 0xa7, 0x0a, 0x20, 0x91, 0xa6, 0x0a, 0x20,
+    0x89, 0xa5, 0x0a, 0x20, 0x81, 0xa4, 0x0a, 0x20, 0x79, 0xa3, 0x0a, 0x20,
+    0x71, 0xa2, 0x0a, 0x20, 0x69, 0xa1, 0x0a, 0x20, 0x61, 0xa0, 0x0a, 0x20,
+    0x59, 0x9f, 0x0a, 0x20, 0x4a, 0x02, 0x12, 0xa9, 0xa8, 0x0a, 0x20, 0x41,
+    0xa7, 0x0a, 0x20, 0x39, 0xa6, 0x0a, 0x20, 0x31, 0xa5, 0x0a, 0x20, 0x29,
+    0xa4, 0x0a, 0x20, 0x21, 0xa3, 0x0a, 0x20, 0x19, 0xa2, 0x0a, 0x20, 0x11,
+    0xa1, 0x0a, 0x20, 0x09, 0xa0, 0x0a, 0x20, 0x00, 0x9f, 0x0a, 0x22, 0x11,
+    0xa0, 0x0a, 0x22, 0x19, 0xa1, 0x0a, 0x22, 0x21, 0xa2, 0x0a, 0x22, 0x29,
+    0xa3, 0x0a, 0x22, 0x31, 0xa4, 0x0a, 0x22, 0x39, 0xa5, 0x0a, 0x22, 0x43,
+    0x02, 0x12, 0xad, 0xa6, 0x0a, 0x22, 0x61, 0xa7, 0x0a, 0x22, 0x69, 0xa8,
+    0x0a, 0x22, 0x70, 0x9f, 0x0a, 0x22, 0x79, 0xa0, 0x0a, 0x22, 0x81, 0xa1,
+    0x0a, 0x22, 0x89, 0xa2, 0x0a, 0x22, 0x91, 0xa3, 0x0a, 0x22, 0x99, 0xa4,
+    0x0a, 0x22, 0xa1, 0xa5, 0x0a, 0x22, 0xa9, 0xa6, 0x0a, 0x22, 0xb1, 0xa7,
+    0x0a, 0x22, 0xb9, 0xa8, 0x0a, 0x22, 0xc0, 0x9f, 0x0a, 0x22, 0xc9, 0xa0,
+    0x0a, 0x22, 0xd1, 0xa1, 0x0a, 0x22, 0xd9, 0xa2, 0x0a, 0x22, 0xe1, 0xa3,
+    0x0a, 0x22, 0xe9, 0xa4, 0x0a, 0x22, 0xf1, 0xa5, 0x0a, 0x22, 0xf9, 0xa6,
+    0x0a, 0x23, 0x01, 0xa7, 0x0a, 0x23, 0x09, 0xa8, 0x0a, 0x23, 0x10, 0x9f,
+    0x0a, 0x23, 0x19, 0xa0, 0x0a, 0x23, 0x21, 0xa1, 0x0a, 0x23, 0x29, 0xa2,
+    0x0a, 0x23, 0x31, 0xa3, 0x0a, 0x23, 0x39, 0xa4, 0x0a, 0x23, 0x41, 0xa5,
+    0x0a, 0x23, 0x49, 0xa6, 0x0a, 0x23, 0x53, 0x02, 0x12, 0xb9, 0xa7, 0x0a,
+    0x23, 0x63, 0x02, 0x12, 0xbd, 0xa8, 0x0a, 0x23, 0x70, 0x9f, 0x0a, 0x23,
+    0x7b, 0x02, 0x12, 0xc1, 0xa0, 0x0a, 0x23, 0x8b, 0x02, 0x12, 0xc5, 0xa1,
+    0x0a, 0x23, 0x9b, 0x02, 0x12, 0xc9, 0xa2, 0x0a, 0x23, 0xa9, 0xa3, 0x0a,
+    0x23, 0xb3, 0x02, 0x12, 0xcd, 0xa4, 0x0a, 0x23, 0xd3, 0x02, 0x12, 0xd9,
+    0xa5, 0x0a, 0x23, 0xe9, 0xa6, 0x0a, 0x23, 0xf3, 0x02, 0x12, 0xe1, 0xa7,
+    0x0a, 0x24, 0x11, 0xa8, 0x0a, 0x24, 0x18, 0x9f, 0x0a, 0x24, 0x23, 0x02,
+    0x12, 0xed, 0xa0, 0x0a, 0x24, 0x39, 0xa1, 0x0a, 0x24, 0x41, 0xa2, 0x0a,
+    0x24, 0x49, 0xa3, 0x0a, 0x24, 0x51, 0xa4, 0x0a, 0x24, 0x5b, 0x02, 0x12,
+    0xf5, 0xa5, 0x0a, 0x24, 0x69, 0xa6, 0x0a, 0x24, 0x71, 0xa7, 0x0a, 0x24,
+    0x79, 0xa8, 0x0a, 0x24, 0x80, 0x9f, 0x0a, 0x24, 0x89, 0xa0, 0x0a, 0x24,
+    0x91, 0xa1, 0x0a, 0x24, 0x99, 0xa2, 0x0a, 0x24, 0xa1, 0xa3, 0x0a, 0x24,
+    0xa9, 0xa4, 0x0a, 0x24, 0xb3, 0x02, 0x12, 0xf9, 0xa5, 0x0a, 0x24, 0xc1,
+    0xa6, 0x0a, 0x24, 0xc9, 0xa7, 0x0a, 0x24, 0xd1, 0xa8, 0x0a, 0x24, 0xd8,
+    0x9f, 0x0a, 0x24, 0xe1, 0xa0, 0x0a, 0x24, 0xe9, 0xa1, 0x0a, 0x24, 0xf1,
+    0xa2, 0x0a, 0x24, 0xf9, 0xa3, 0x0a, 0x25, 0x01, 0xa4, 0x0a, 0x25, 0x0b,
+    0x02, 0x12, 0xfd, 0xa5, 0x0a, 0x25, 0x19, 0xa6, 0x0a, 0x25, 0x21, 0xa7,
+    0x0a, 0x25, 0x29, 0xa8, 0x0a, 0x25, 0x30, 0x9f, 0x0a, 0x25, 0x39, 0xa0,
+    0x0a, 0x25, 0x41, 0xa1, 0x0a, 0x25, 0x49, 0xa2, 0x0a, 0x25, 0x51, 0xa3,
+    0x0a, 0x25, 0x59, 0xa4, 0x0a, 0x25, 0x61, 0xa5, 0x0a, 0x25, 0x69, 0xa6,
+    0x0a, 0x25, 0x71, 0xa7, 0x0a, 0x25, 0x79, 0xa8, 0x0a, 0x25, 0x80, 0x9f,
+    0x0a, 0x25, 0x89, 0xa0, 0x0a, 0x25, 0x91, 0xa1, 0x0a, 0x25, 0x99, 0xa2,
+    0x0a, 0x25, 0xa1, 0xa3, 0x0a, 0x25, 0xa9, 0xa4, 0x0a, 0x25, 0xb1, 0xa5,
+    0x0a, 0x25, 0xb9, 0xa6, 0x0a, 0x25, 0xc1, 0xa7, 0x0a, 0x25, 0xc9, 0xa8,
+    0x0a, 0x25, 0xd0, 0x9f, 0x0a, 0x25, 0xd9, 0xa0, 0x0a, 0x25, 0xe1, 0xa1,
+    0x0a, 0x25, 0xe9, 0xa2, 0x0a, 0x25, 0xf1, 0xa3, 0x0a, 0x25, 0xf9, 0xa4,
+    0x0a, 0x26, 0x01, 0xa5, 0x0a, 0x26, 0x09, 0xa6, 0x0a, 0x26, 0x11, 0xa7,
+    0x0a, 0x26, 0x19, 0xa8, 0x0a, 0x26, 0x20, 0x9f, 0x0a, 0x26, 0x29, 0xa0,
+    0x0a, 0x26, 0x31, 0xa1, 0x0a, 0x26, 0x39, 0xa2, 0x0a, 0x26, 0x41, 0xa3,
+    0x0a, 0x26, 0x49, 0xa4, 0x0a, 0x26, 0x51, 0xa5, 0x0a, 0x26, 0x59, 0xa6,
+    0x0a, 0x26, 0x61, 0xa7, 0x0a, 0x26, 0x69, 0xa8, 0x0a, 0x26, 0x70, 0x9f,
+    0x0a, 0x26, 0x79, 0xa0, 0x0a, 0x26, 0x81, 0xa1, 0x0a, 0x26, 0x89, 0xa2,
+    0x0a, 0x26, 0x91, 0xa3, 0x0a, 0x26, 0x99, 0xa4, 0x0a, 0x26, 0xa1, 0xa5,
+    0x0a, 0x26, 0xa9, 0xa6, 0x0a, 0x26, 0xb1, 0xa7, 0x0a, 0x26, 0xb9, 0xa8,
+    0x0a, 0x26, 0xc0, 0x9f, 0x0a, 0x26, 0xc9, 0xa0, 0x0a, 0x26, 0xd1, 0xa1,
+    0x0a, 0x26, 0xd9, 0xa2, 0x0a, 0x26, 0xe1, 0xa3, 0x0a, 0x26, 0xe9, 0xa4,
+    0x0a, 0x26, 0xf1, 0xa5, 0x0a, 0x26, 0xf9, 0xa6, 0x0a, 0x27, 0x01, 0xa7,
+    0x0a, 0x27, 0x09, 0xa8, 0x0a, 0x27, 0x10, 0x9f, 0x0a, 0x27, 0x19, 0xa0,
+    0x0a, 0x27, 0x21, 0xa1, 0x0a, 0x27, 0x2b, 0x02, 0x13, 0x01, 0xa2, 0x0a,
+    0x27, 0x41, 0xa3, 0x0a, 0x27, 0x49, 0xa4, 0x0a, 0x27, 0x51, 0xa5, 0x0a,
+    0x27, 0x59, 0xa6, 0x0a, 0x27, 0x63, 0x02, 0x13, 0x09, 0xa7, 0x0a, 0x27,
+    0x71, 0xa8, 0x0a, 0x27, 0x7a, 0x02, 0x13, 0x0d, 0x9f, 0x0a, 0x27, 0x89,
+    0xa0, 0x0a, 0x27, 0x91, 0xa1, 0x0a, 0x27, 0x99, 0xa2, 0x0a, 0x27, 0xa1,
+    0xa3, 0x0a, 0x27, 0xa9, 0xa4, 0x0a, 0x27, 0xb3, 0x02, 0x13, 0x11, 0xa5,
+    0x0a, 0x27, 0xc3, 0x02, 0x13, 0x15, 0xa6, 0x0a, 0x27, 0xd1, 0xa7, 0x0a,
+    0x27, 0xd9, 0xa8, 0x0a, 0x27, 0xe0, 0x9f, 0x0a, 0x27, 0xe9, 0xa0, 0x0a,
+    0x27, 0xf1, 0xa1, 0x0a, 0x27, 0xf9, 0xa2, 0x0a, 0x28, 0x01, 0xa3, 0x0a,
+    0x28, 0x09, 0xa4, 0x0a, 0x28, 0x11, 0xa5, 0x0a, 0x28, 0x19, 0xa6, 0x0a,
+    0x28, 0x23, 0x02, 0x13, 0x19, 0xa7, 0x0a, 0x28, 0x31, 0xa8, 0x0a, 0x28,
+    0x38, 0x9f, 0x0a, 0x28, 0x41, 0xa0, 0x0a, 0x28, 0x49, 0xa1, 0x0a, 0x28,
+    0x51, 0xa2, 0x0a, 0x28, 0x59, 0xa3, 0x0a, 0x28, 0x61, 0xa4, 0x0a, 0x28,
+    0x69, 0xa5, 0x0a, 0x28, 0x71, 0xa6, 0x0a, 0x28, 0x79, 0xa7, 0x0a, 0x28,
+    0x81, 0xa8, 0x0a, 0x28, 0x88, 0x9f, 0x0a, 0x28, 0x91, 0xa0, 0x0a, 0x28,
+    0x99, 0xa1, 0x0a, 0x28, 0xa1, 0xa2, 0x0a, 0x28, 0xa9, 0xa3, 0x0a, 0x28,
+    0xb1, 0xa4, 0x0a, 0x28, 0xb9, 0xa5, 0x0a, 0x28, 0xc1, 0xa6, 0x0a, 0x28,
+    0xc9, 0xa7, 0x0a, 0x28, 0xd1, 0xa8, 0x0a, 0x28, 0xd8, 0x9f, 0x0a, 0x28,
+    0xe1, 0xa0, 0x0a, 0x28, 0xe9, 0xa1, 0x0a, 0x28, 0xf1, 0xa2, 0x0a, 0x28,
+    0xf9, 0xa3, 0x0a, 0x29, 0x01, 0xa4, 0x0a, 0x29, 0x09, 0xa5, 0x0a, 0x29,
+    0x11, 0xa6, 0x0a, 0x29, 0x19, 0xa7, 0x0a, 0x29, 0x21, 0xa8, 0x0a, 0x29,
+    0x28, 0x9f, 0x0a, 0x29, 0x31, 0xa0, 0x0a, 0x29, 0x39, 0xa1, 0x0a, 0x29,
+    0x41, 0xa2, 0x0a, 0x29, 0x49, 0xa3, 0x0a, 0x29, 0x51, 0xa4, 0x0a, 0x29,
+    0x59, 0xa5, 0x0a, 0x29, 0x61, 0xa6, 0x0a, 0x29, 0x6b, 0x02, 0x13, 0x1d,
+    0xa7, 0x0a, 0x29, 0x79, 0xa8, 0x0a, 0x29, 0x80, 0x9f, 0x0a, 0x29, 0x89,
+    0xa0, 0x0a, 0x29, 0x91, 0xa1, 0x0a, 0x29, 0x99, 0xa2, 0x0a, 0x29, 0xa1,
+    0xa3, 0x0a, 0x29, 0xa9, 0xa4, 0x0a, 0x29, 0xb1, 0xa5, 0x0a, 0x29, 0xb9,
+    0xa6, 0x0a, 0x29, 0xc1, 0xa7, 0x0a, 0x29, 0xc9, 0xa8, 0x0a, 0x29, 0xd0,
+    0x9f, 0x0a, 0x29, 0xd9, 0xa0, 0x0a, 0x29, 0xe1, 0xa1, 0x0a, 0x29, 0xe9,
+    0xa2, 0x0a, 0x29, 0xf1, 0xa3, 0x0a, 0x29, 0xf9, 0xa4, 0x0a, 0x2a, 0x01,
+    0xa5, 0x0a, 0x2a, 0x09, 0xa6, 0x0a, 0x2a, 0x11, 0xa7, 0x0a, 0x2a, 0x19,
+    0xa8, 0x0a, 0x2a, 0x22, 0x02, 0x13, 0x21, 0x9f, 0x0a, 0x2a, 0x31, 0xa0,
+    0x0a, 0x2a, 0x39, 0xa1, 0x0a, 0x2a, 0x41, 0xa2, 0x0a, 0x2a, 0x49, 0xa3,
+    0x0a, 0x2a, 0x53, 0x02, 0x13, 0x25, 0xa4, 0x0a, 0x2a, 0x61, 0xa5, 0x0a,
+    0x2a, 0x69, 0xa6, 0x0a, 0x2a, 0x71, 0xa7, 0x0a, 0x2a, 0x79, 0xa8, 0x0a,
+    0x2a, 0x82, 0x02, 0x13, 0x29, 0x9f, 0x0a, 0x2a, 0x91, 0xa0, 0x0a, 0x2a,
+    0x99, 0xa1, 0x0a, 0x2a, 0xa1, 0xa2, 0x0a, 0x2a, 0xa9, 0xa3, 0x0a, 0x2a,
+    0xb1, 0xa4, 0x0a, 0x2a, 0xb9, 0xa5, 0x0a, 0x2a, 0xc1, 0xa6, 0x0a, 0x2a,
+    0xc9, 0xa7, 0x0a, 0x2a, 0xd1, 0xa8, 0x0a, 0x2a, 0xda, 0x02, 0x13, 0x2d,
+    0x9f, 0x0a, 0x2a, 0xe9, 0xa0, 0x0a, 0x2a, 0xf1, 0xa1, 0x0a, 0x2a, 0xf9,
+    0xa2, 0x0a, 0x2b, 0x01, 0xa3, 0x0a, 0x2b, 0x09, 0xa4, 0x0a, 0x2b, 0x11,
+    0xa5, 0x0a, 0x2b, 0x19, 0xa6, 0x0a, 0x2b, 0x21, 0xa7, 0x0a, 0x2b, 0x29,
+    0xa8, 0x0a, 0x2b, 0x30, 0x9f, 0x0a, 0x2b, 0x39, 0xa0, 0x0a, 0x2b, 0x41,
+    0xa1, 0x0a, 0x2b, 0x49, 0xa2, 0x0a, 0x2b, 0x51, 0xa3, 0x0a, 0x2b, 0x59,
+    0xa4, 0x0a, 0x2b, 0x61, 0xa5, 0x0a, 0x2b, 0x69, 0xa6, 0x0a, 0x2b, 0x71,
+    0xa7, 0x0a, 0x2b, 0x79, 0xa8, 0x0a, 0x2b, 0x82, 0x02, 0x13, 0x31, 0x9f,
+    0x0a, 0x2b, 0x91, 0xa0, 0x0a, 0x2b, 0x99, 0x21, 0xc2, 0x13, 0x35, 0xa2,
+    0x0a, 0x2b, 0xb9, 0xa3, 0x0a, 0x2b, 0xc1, 0xa4, 0x0a, 0x2b, 0xc9, 0xa5,
+    0x0a, 0x2b, 0xd3, 0x02, 0x13, 0x41, 0xa6, 0x0a, 0x2b, 0xf1, 0xa7, 0x0a,
+    0x2b, 0xf9, 0xa8, 0x0a, 0x2c, 0x00, 0x9f, 0x0a, 0x2c, 0x09, 0xa0, 0x0a,
+    0x2c, 0x11, 0xa1, 0x0a, 0x2c, 0x19, 0xa2, 0x0a, 0x2c, 0x21, 0xa3, 0x0a,
+    0x2c, 0x29, 0xa4, 0x0a, 0x2c, 0x31, 0xa5, 0x0a, 0x2c, 0x39, 0xa6, 0x0a,
+    0x2c, 0x41, 0xa7, 0x0a, 0x2c, 0x49, 0xa8, 0x0a, 0x2c, 0x50, 0x9f, 0x0a,
+    0x2c, 0x59, 0xa0, 0x0a, 0x2c, 0x61, 0xa1, 0x0a, 0x2c, 0x69, 0xa2, 0x0a,
+    0x2c, 0x71, 0xa3, 0x0a, 0x2c, 0x79, 0xa4, 0x0a, 0x2c, 0x81, 0xa5, 0x0a,
+    0x2c, 0x89, 0xa6, 0x0a, 0x2c, 0x91, 0xa7, 0x0a, 0x2c, 0x99, 0xa8, 0x0a,
+    0x2c, 0xa2, 0x02, 0x13, 0x4d, 0x9f, 0x0a, 0x2c, 0xb1, 0xa0, 0x0a, 0x2c,
+    0xb9, 0xa1, 0x0a, 0x2c, 0xc1, 0xa2, 0x0a, 0x2c, 0xc9, 0xa3, 0x0a, 0x2c,
+    0xd3, 0x02, 0x13, 0x51, 0xa4, 0x0a, 0x2c, 0xe1, 0xa5, 0x0a, 0x2c, 0xe9,
+    0xa6, 0x0a, 0x2c, 0xf1, 0xa7, 0x0a, 0x2c, 0xfb, 0x02, 0x13, 0x55, 0xa8,
+    0x0a, 0x2d, 0x08, 0x9f, 0x0a, 0x2d, 0x11, 0xa0, 0x0a, 0x2d, 0x1b, 0x02,
+    0x13, 0x59, 0xa1, 0x0a, 0x2d, 0x29, 0xa2, 0x0a, 0x2d, 0x31, 0xa3, 0x0a,
+    0x2d, 0x39, 0xa4, 0x0a, 0x2d, 0x41, 0xa5, 0x0a, 0x2d, 0x49, 0xa6, 0x0a,
+    0x2d, 0x51, 0xa7, 0x0a, 0x2d, 0x59, 0xa8, 0x0a, 0x2d, 0x60, 0x9f, 0x0a,
+    0x2d, 0x69, 0xa0, 0x0a, 0x2d, 0x73, 0x02, 0x13, 0x5d, 0xa1, 0x0a, 0x2d,
+    0x81, 0x22, 0xc2, 0x13, 0x61, 0xa3, 0x0a, 0x2d, 0x99, 0xa4, 0x0a, 0x2d,
+    0xa1, 0xa5, 0x0a, 0x2d, 0xab, 0x02, 0x13, 0x6b, 0xa6, 0x0a, 0x2d, 0xb9,
+    0xa7, 0x0a, 0x2d, 0xc1, 0xa8, 0x0a, 0x2d, 0xc8, 0x9f, 0x0a, 0x2d, 0xd1,
+    0xa0, 0x0a, 0x2d, 0xd9, 0xa1, 0x0a, 0x2d, 0xe1, 0xc7, 0xc2, 0x5a, 0x0a,
+    0x2d, 0xe9, 0xa3, 0x0a, 0x2d, 0xf1, 0xa4, 0x0a, 0x2d, 0xf9, 0xa5, 0x0a,
+    0x2e, 0x01, 0xa6, 0x0a, 0x2e, 0x09, 0xa7, 0x0a, 0x2e, 0x11, 0xa8, 0x0a,
+    0x2e, 0x18, 0x9f, 0x0a, 0x2e, 0x21, 0xa0, 0x0a, 0x2e, 0x29, 0xa1, 0x0a,
+    0x2e, 0x31, 0xa2, 0x0a, 0x2e, 0x39, 0xa3, 0x0a, 0x2e, 0x41, 0xa4, 0x0a,
+    0x2e, 0x49, 0xa5, 0x0a, 0x2e, 0x51, 0xa6, 0x0a, 0x2e, 0x59, 0xa7, 0x0a,
+    0x2e, 0x61, 0xa8, 0x0a, 0x2e, 0x68, 0x1f, 0xc2, 0x13, 0x6f, 0xa0, 0x0a,
+    0x2e, 0x81, 0xa1, 0x0a, 0x2e, 0x89, 0xa2, 0x0a, 0x2e, 0x91, 0xa3, 0x0a,
+    0x2e, 0x99, 0xa4, 0x0a, 0x2e, 0xa1, 0xa5, 0x0a, 0x2e, 0xa9, 0xa6, 0x0a,
+    0x2e, 0xb1, 0xa7, 0x0a, 0x2e, 0xb9, 0xa8, 0x0a, 0x2e, 0xc0, 0x9f, 0x0a,
+    0x2e, 0xc9, 0xa0, 0x0a, 0x2e, 0xd1, 0xa1, 0x0a, 0x2e, 0xd9, 0xa2, 0x0a,
+    0x2e, 0xe1, 0xa3, 0x0a, 0x2e, 0xe9, 0xa4, 0x0a, 0x2e, 0xf1, 0xa5, 0x0a,
+    0x2e, 0xf9, 0xa6, 0x0a, 0x2f, 0x01, 0xa7, 0x0a, 0x2f, 0x09, 0xa8, 0x0a,
+    0x2f, 0x10, 0x9f, 0x0a, 0x2f, 0x19, 0xa0, 0x0a, 0x2f, 0x21, 0xa1, 0x0a,
+    0x2f, 0x29, 0xa2, 0x0a, 0x2f, 0x31, 0xa3, 0x0a, 0x2f, 0x39, 0xa4, 0x0a,
+    0x2f, 0x41, 0xa5, 0x0a, 0x2f, 0x49, 0xa6, 0x0a, 0x2f, 0x51, 0xa7, 0x0a,
+    0x2f, 0x59, 0xa8, 0x0a, 0x2f, 0x60, 0x9f, 0x0a, 0x2f, 0x69, 0xa0, 0x0a,
+    0x2f, 0x71, 0xa1, 0x0a, 0x2f, 0x79, 0xa2, 0x0a, 0x2f, 0x81, 0xa3, 0x0a,
+    0x2f, 0x89, 0xa4, 0x0a, 0x2f, 0x91, 0xa5, 0x0a, 0x2f, 0x99, 0xa6, 0x0a,
+    0x2f, 0xa1, 0xa7, 0x0a, 0x2f, 0xa9, 0xa8, 0x0a, 0x2f, 0xb0, 0x9f, 0x0a,
+    0x2f, 0xbb, 0x02, 0x13, 0x7b, 0xa0, 0x0a, 0x2f, 0xc9, 0xa1, 0x0a, 0x2f,
+    0xd1, 0xa2, 0x0a, 0x2f, 0xd9, 0xa3, 0x0a, 0x2f, 0xe1, 0xa4, 0x0a, 0x2f,
+    0xe9, 0xa5, 0x0a, 0x2f, 0xf1, 0xa6, 0x0a, 0x2f, 0xfb, 0x02, 0x13, 0x7f,
+    0xa7, 0x0a, 0x30, 0x09, 0xa8, 0x0a, 0x30, 0x10, 0x9f, 0x0a, 0x30, 0x19,
+    0xa0, 0x0a, 0x30, 0x21, 0xa1, 0x0a, 0x30, 0x29, 0xa2, 0x0a, 0x30, 0x31,
+    0xa3, 0x0a, 0x30, 0x39, 0xa4, 0x0a, 0x30, 0x41, 0xa5, 0x0a, 0x30, 0x49,
+    0xa6, 0x0a, 0x30, 0x51, 0xa7, 0x0a, 0x30, 0x59, 0xa8, 0x0a, 0x30, 0x60,
+    0x9f, 0x0a, 0x30, 0x69, 0xa0, 0x0a, 0x30, 0x71, 0xa1, 0x0a, 0x30, 0x79,
+    0xa2, 0x0a, 0x30, 0x81, 0xa3, 0x0a, 0x30, 0x89, 0xa4, 0x0a, 0x30, 0x91,
+    0xa5, 0x0a, 0x30, 0x99, 0xa6, 0x0a, 0x30, 0xa1, 0xa7, 0x0a, 0x30, 0xa9,
+    0xa8, 0x0a, 0x30, 0xb0, 0x9f, 0x0a, 0x30, 0xb9, 0xa0, 0x0a, 0x30, 0xc1,
+    0xa1, 0x0a, 0x30, 0xc9, 0xa2, 0x0a, 0x30, 0xd1, 0xa3, 0x0a, 0x30, 0xd9,
+    0xa4, 0x0a, 0x30, 0xe1, 0xa5, 0x0a, 0x30, 0xe9, 0xa6, 0x0a, 0x30, 0xf1,
+    0xa7, 0x0a, 0x30, 0xf9, 0xa8, 0x0a, 0x31, 0x00, 0x9f, 0x0a, 0x31, 0x09,
+    0xa0, 0x0a, 0x31, 0x11, 0xa1, 0x0a, 0x31, 0x19, 0xa2, 0x0a, 0x31, 0x21,
+    0xa3, 0x0a, 0x31, 0x29, 0xa4, 0x0a, 0x31, 0x31, 0xa5, 0x0a, 0x31, 0x39,
+    0xa6, 0x0a, 0x31, 0x40, 0xa0, 0x0a, 0x31, 0x49, 0xa1, 0x0a, 0x31, 0x51,
+    0xa2, 0x0a, 0x31, 0x59, 0xa3, 0x0a, 0x31, 0x61, 0xa4, 0x0a, 0x31, 0x69,
+    0xa5, 0x0a, 0x31, 0x71, 0xa6, 0x0a, 0x31, 0x79, 0xa7, 0x0a, 0x31, 0x81,
+    0xa8, 0x0a, 0x31, 0x88, 0x9f, 0x0a, 0x31, 0x91, 0xa0, 0x0a, 0x31, 0x99,
+    0xa1, 0x0a, 0x31, 0xa1, 0xa2, 0x0a, 0x31, 0xa9, 0xa3, 0x0a, 0x31, 0xb1,
+    0xa4, 0x0a, 0x31, 0xb9, 0xa5, 0x0a, 0x31, 0xc1, 0xa6, 0x0a, 0x31, 0xc9,
+    0xa7, 0x0a, 0x31, 0xd1, 0xa8, 0x0a, 0x31, 0xd8, 0x9f, 0x0a, 0x31, 0xe1,
+    0xa0, 0x0a, 0x31, 0xe9, 0xa1, 0x0a, 0x31, 0xf1, 0xa2, 0x0a, 0x31, 0xf9,
+    0xa3, 0x0a, 0x32, 0x01, 0xa4, 0x0a, 0x32, 0x09, 0xa5, 0x0a, 0x32, 0x11,
+    0xa6, 0x0a, 0x32, 0x19, 0xa7, 0x0a, 0x32, 0x21, 0xa8, 0x0a, 0x32, 0x28,
+    0xd1, 0x00, 0x77, 0x01, 0x5b, 0x79, 0xd4, 0x3d, 0x06, 0x01, 0x5c, 0x61,
+    0xd5, 0x33, 0x55, 0x01, 0x5c, 0x69, 0xd3, 0x41, 0x27, 0x01, 0x5c, 0x71,
+    0xd2, 0x49, 0x8d, 0x01, 0x5c, 0x78, 0xc8, 0x30, 0xea, 0x01, 0x1b, 0x81,
+    0xc9, 0x23, 0x59, 0x01, 0x1b, 0x79, 0x05, 0xc2, 0x13, 0x83, 0x06, 0xc2,
+    0x13, 0x8f, 0x42, 0x00, 0x6f, 0xc2, 0x13, 0xa2, 0xd0, 0x02, 0xf9, 0x01,
+    0x1a, 0x41, 0x42, 0x00, 0x2f, 0xc2, 0x13, 0xae, 0xcc, 0x06, 0x09, 0x01,
+    0x1a, 0x21, 0xc9, 0x00, 0xa0, 0x01, 0x1a, 0x11, 0xc5, 0x00, 0xa4, 0x01,
+    0x1a, 0x09, 0xc3, 0xb9, 0xb5, 0x01, 0x19, 0xd9, 0xc5, 0x00, 0xe4, 0x01,
+    0x19, 0xc0, 0xc9, 0x20, 0xc3, 0x01, 0x1b, 0x09, 0xc3, 0xb9, 0xb5, 0x01,
+    0x1a, 0xa9, 0xc7, 0x78, 0xa6, 0x01, 0x1a, 0x88, 0xcb, 0x97, 0x83, 0x01,
+    0x1b, 0x89, 0xca, 0x98, 0x81, 0x01, 0x1b, 0x31, 0x45, 0x94, 0xda, 0x42,
+    0x13, 0xba, 0xc5, 0x20, 0x41, 0x01, 0x1b, 0x59, 0xc9, 0x20, 0xc3, 0x01,
+    0x1b, 0x11, 0xc5, 0x05, 0x84, 0x01, 0x1a, 0x90, 0xc8, 0x50, 0x50, 0x01,
+    0x1a, 0xc9, 0xc5, 0x05, 0x84, 0x01, 0x1a, 0x58, 0xc2, 0x00, 0x72, 0x01,
+    0x1a, 0xf9, 0xc3, 0x05, 0x86, 0x01, 0x19, 0xe8, 0xc2, 0x00, 0x5d, 0x01,
+    0x12, 0x2b, 0x02, 0x13, 0xc6, 0xcb, 0x24, 0x62, 0x01, 0x53, 0x80, 0xc2,
+    0x0d, 0x1e, 0x08, 0x59, 0x99, 0x87, 0x08, 0x59, 0x88, 0xc2, 0x00, 0x98,
+    0x08, 0x59, 0x21, 0xc2, 0x0d, 0x1e, 0x08, 0x59, 0x19, 0x87, 0x08, 0x59,
+    0x10, 0x87, 0x08, 0x58, 0x38, 0x90, 0x08, 0x58, 0x29, 0x91, 0x08, 0x58,
+    0x18, 0xc7, 0x0c, 0xe7, 0x08, 0x08, 0xc9, 0xc8, 0x53, 0xd0, 0x08, 0x09,
+    0x10, 0xc3, 0x03, 0xe1, 0x08, 0x08, 0x4b, 0x02, 0x13, 0xcc, 0xc4, 0x0c,
+    0xf1, 0x08, 0x08, 0x92, 0x02, 0x13, 0xd0, 0xc9, 0x53, 0xcf, 0x08, 0x09,
+    0x58, 0xc4, 0x17, 0xf9, 0x08, 0x08, 0x8b, 0x02, 0x13, 0xd6, 0x91, 0x08,
+    0x08, 0x42, 0x02, 0x13, 0xdc, 0xc2, 0x00, 0x98, 0x08, 0x08, 0x5b, 0x02,
+    0x13, 0xe0, 0xc3, 0x43, 0x20, 0x08, 0x08, 0xa2, 0x02, 0x13, 0xe4, 0xc2,
+    0x00, 0x35, 0x08, 0x08, 0x53, 0x02, 0x13, 0xea, 0xc3, 0x0c, 0xf2, 0x08,
+    0x08, 0x9a, 0x02, 0x13, 0xee, 0x01, 0xc2, 0x13, 0xf4, 0xc2, 0x0c, 0xf3,
+    0x08, 0x08, 0xaa, 0x02, 0x14, 0x00, 0x01, 0xc2, 0x14, 0x06, 0xc2, 0x0c,
+    0xf3, 0x08, 0x08, 0xb2, 0x02, 0x14, 0x12, 0xc7, 0x0c, 0xe7, 0x08, 0x09,
+    0x01, 0xc8, 0x53, 0xd0, 0x08, 0x09, 0x48, 0xc9, 0x53, 0xcf, 0x08, 0x09,
+    0x90, 0xc7, 0x0c, 0xe7, 0x08, 0x09, 0x09, 0xc8, 0x53, 0xd0, 0x08, 0x09,
+    0x50, 0xc9, 0x53, 0xcf, 0x08, 0x09, 0x98, 0xcc, 0x13, 0xb7, 0x08, 0x09,
+    0xc1, 0xcd, 0x7d, 0xb4, 0x08, 0x09, 0xd8, 0xca, 0x00, 0x4a, 0x01, 0x28,
+    0x03, 0x02, 0x14, 0x18, 0x06, 0xc2, 0x14, 0x1e, 0xc2, 0x00, 0x6f, 0x01,
+    0x2b, 0xab, 0x02, 0x14, 0x28, 0xc4, 0x00, 0x2f, 0x01, 0x2b, 0xa3, 0x02,
+    0x14, 0x2e, 0xc5, 0x00, 0x64, 0x01, 0x2b, 0xb1, 0x44, 0x13, 0xe3, 0xc2,
+    0x14, 0x34, 0xc8, 0x03, 0xc1, 0x01, 0x28, 0x13, 0x02, 0x14, 0x40, 0x4f,
+    0x66, 0xec, 0xc2, 0x14, 0x46, 0x4c, 0x50, 0xcf, 0x42, 0x14, 0x52, 0x50,
+    0x5b, 0x32, 0xc2, 0x14, 0x5e, 0xdd, 0x10, 0xdf, 0x01, 0x2a, 0x29, 0xdd,
+    0x11, 0xc7, 0x01, 0x2a, 0x19, 0x50, 0x10, 0xe4, 0x42, 0x14, 0x70, 0x45,
+    0x00, 0x6a, 0x42, 0x14, 0x82, 0xd0, 0x58, 0x22, 0x01, 0x2b, 0xf0, 0xc2,
+    0x04, 0x68, 0x01, 0x2b, 0xdb, 0x02, 0x14, 0x92, 0x4a, 0x9e, 0x8a, 0x42,
+    0x14, 0x98, 0x45, 0x00, 0x6a, 0x42, 0x14, 0xa4, 0xc8, 0x03, 0xc1, 0x01,
+    0x28, 0x59, 0xca, 0x00, 0x4a, 0x01, 0x28, 0x48, 0xc8, 0x03, 0xc1, 0x01,
+    0x28, 0x39, 0xca, 0x00, 0x4a, 0x01, 0x28, 0x28, 0xc8, 0x03, 0xc1, 0x01,
+    0x2a, 0x8b, 0x02, 0x14, 0xb6, 0x47, 0x54, 0x76, 0xc2, 0x14, 0xbc, 0x49,
+    0x40, 0xb5, 0xc2, 0x14, 0xce, 0xca, 0x00, 0x4a, 0x01, 0x2a, 0x80, 0x4b,
+    0x99, 0x67, 0xc2, 0x14, 0xe0, 0x4b, 0x8f, 0xc7, 0xc2, 0x14, 0xf2, 0x4a,
+    0x5b, 0x32, 0xc2, 0x15, 0x04, 0x4a, 0x10, 0xe4, 0x42, 0x15, 0x1c, 0xd1,
+    0x50, 0x7a, 0x01, 0x2b, 0x59, 0xcb, 0x91, 0xe2, 0x01, 0x2b, 0x11, 0xcc,
+    0x85, 0x98, 0x01, 0x2a, 0xf8, 0xd1, 0x50, 0xf1, 0x01, 0x2b, 0x51, 0xcb,
+    0x8e, 0xeb, 0x01, 0x2b, 0x09, 0xcc, 0x83, 0xdc, 0x01, 0x2a, 0xf0, 0xd0,
+    0x34, 0x80, 0x01, 0x2a, 0x11, 0xca, 0xa5, 0x38, 0x01, 0x29, 0x41, 0xcb,
+    0x5b, 0x3c, 0x01, 0x29, 0x00, 0xd0, 0x38, 0x31, 0x01, 0x29, 0xf9, 0xca,
+    0xa5, 0x2e, 0x01, 0x29, 0x29, 0xcb, 0x97, 0xd0, 0x01, 0x28, 0xe8, 0xd1,
+    0x50, 0x7a, 0x01, 0x2b, 0x41, 0xcb, 0x91, 0xe2, 0x01, 0x2a, 0xe1, 0xcc,
+    0x85, 0x98, 0x01, 0x2a, 0xc8, 0xd1, 0x50, 0xf1, 0x01, 0x2b, 0x39, 0xcb,
+    0x8e, 0xeb, 0x01, 0x2a, 0xd9, 0xcc, 0x83, 0xdc, 0x01, 0x2a, 0xc0, 0xd5,
+    0x38, 0x2c, 0x01, 0x2a, 0x41, 0xd0, 0x38, 0x31, 0x01, 0x29, 0xb9, 0x45,
+    0x00, 0x2f, 0xc2, 0x15, 0x34, 0x46, 0x01, 0x78, 0x42, 0x15, 0x40, 0xd5,
+    0x34, 0x7b, 0x01, 0x2a, 0x01, 0xd0, 0x34, 0x80, 0x01, 0x29, 0xc1, 0x45,
+    0x00, 0x2f, 0xc2, 0x15, 0x4c, 0x46, 0x01, 0x78, 0x42, 0x15, 0x58, 0xce,
+    0x6d, 0x84, 0x01, 0x2a, 0x49, 0xc8, 0x11, 0xc7, 0x01, 0x29, 0xc9, 0xca,
+    0x10, 0xdf, 0x01, 0x29, 0x88, 0xce, 0x6d, 0x5a, 0x01, 0x29, 0xf1, 0xc8,
+    0x10, 0xf4, 0x01, 0x29, 0xb1, 0xca, 0x11, 0xda, 0x01, 0x29, 0x70, 0xc5,
+    0x13, 0x4d, 0x01, 0x18, 0xf9, 0xc3, 0x09, 0x6c, 0x01, 0x18, 0x60, 0xc5,
+    0x13, 0x4d, 0x01, 0x18, 0xf1, 0xc3, 0x09, 0x6c, 0x01, 0x18, 0x68, 0x89,
+    0x01, 0x8d, 0x68, 0xc2, 0x1b, 0xf2, 0x01, 0x8d, 0x70, 0xc2, 0x1b, 0xf2,
+    0x01, 0x8d, 0x78, 0x89, 0x01, 0x89, 0x21, 0x90, 0x01, 0x8d, 0x48, 0x90,
+    0x01, 0x8d, 0x39, 0x89, 0x01, 0x8d, 0x90, 0x89, 0x01, 0x89, 0x29, 0x90,
+    0x01, 0x8d, 0x28, 0x90, 0x01, 0x8d, 0x98, 0xa4, 0x0f, 0xd8, 0xbb, 0x02,
+    0x15, 0x64, 0xa5, 0x0f, 0xd9, 0x38, 0xa2, 0x0f, 0xd8, 0x33, 0x02, 0x15,
+    0x68, 0xa4, 0x0f, 0xd8, 0x93, 0x02, 0x15, 0x7a, 0xa3, 0x0f, 0xd8, 0x53,
+    0x02, 0x15, 0x7e, 0xa5, 0x0f, 0xd9, 0x08, 0xa5, 0x0f, 0xd9, 0x70, 0xa3,
+    0x0f, 0xd8, 0x63, 0x02, 0x15, 0x89, 0xa5, 0x0f, 0xd9, 0x19, 0xc2, 0x00,
+    0x24, 0x0f, 0xd9, 0x90, 0xa5, 0x0f, 0xd9, 0x88, 0xa5, 0x0f, 0xd9, 0x49,
+    0xa4, 0x0f, 0xd8, 0xd2, 0x02, 0x15, 0x94, 0xa5, 0x0f, 0xd9, 0x78, 0xa3,
+    0x0f, 0xd8, 0x6b, 0x02, 0x15, 0x98, 0xa5, 0x0f, 0xd9, 0x21, 0xa4, 0x0f,
+    0xd8, 0xa2, 0x02, 0x15, 0xa3, 0xa4, 0x0f, 0xd8, 0xc2, 0x02, 0x15, 0xa7,
+    0xa5, 0x0f, 0xd9, 0xa8, 0x45, 0xcc, 0x27, 0xc2, 0x15, 0xab, 0x46, 0x3b,
+    0x8b, 0xc2, 0x15, 0xe2, 0xd0, 0x5b, 0xe2, 0x01, 0x39, 0x61, 0xce, 0x72,
+    0x00, 0x01, 0x37, 0x41, 0xc5, 0x00, 0x7d, 0x01, 0x2e, 0x7b, 0x02, 0x15,
+    0xfa, 0xc8, 0xb9, 0xd8, 0x01, 0x33, 0x18, 0x4e, 0x6d, 0xf4, 0xc2, 0x15,
+    0xfe, 0xc7, 0x32, 0x52, 0x01, 0x38, 0x11, 0xce, 0x72, 0xb6, 0x01, 0x38,
+    0x01, 0xc6, 0xcc, 0x50, 0x01, 0x36, 0x39, 0xc9, 0xad, 0x7e, 0x01, 0x33,
+    0x01, 0x0f, 0xc2, 0x16, 0x0a, 0xca, 0x57, 0x36, 0x01, 0x30, 0xb9, 0xc3,
+    0x0d, 0xf5, 0x01, 0x30, 0x29, 0xcc, 0x82, 0xec, 0x01, 0x30, 0x01, 0xc5,
+    0x09, 0x2c, 0x01, 0x2d, 0x03, 0x02, 0x16, 0x16, 0xd3, 0x43, 0x02, 0x0f,
+    0xab, 0x88, 0x44, 0xdf, 0x40, 0xc2, 0x16, 0x1a, 0xc4, 0x6f, 0xd9, 0x01,
+    0x36, 0xf9, 0xd7, 0x29, 0x2b, 0x01, 0x36, 0xb1, 0xc8, 0x35, 0x12, 0x01,
+    0x30, 0x71, 0xd2, 0x49, 0x33, 0x0f, 0xab, 0xf8, 0x43, 0x04, 0x67, 0xc2,
+    0x16, 0x2c, 0xc6, 0x3f, 0x58, 0x01, 0x2e, 0x33, 0x02, 0x16, 0x3e, 0x14,
+    0x42, 0x16, 0x42, 0x44, 0x00, 0x65, 0xc2, 0x16, 0x4e, 0xc8, 0x43, 0x2f,
+    0x01, 0x2d, 0x61, 0xc6, 0xcd, 0x76, 0x0f, 0x9f, 0xb0, 0x43, 0x00, 0x30,
+    0xc2, 0x16, 0x60, 0x11, 0xc2, 0x16, 0x70, 0x45, 0x16, 0x71, 0x42, 0x16,
+    0x7c, 0x0e, 0xc2, 0x16, 0x88, 0x11, 0x42, 0x16, 0x94, 0xca, 0xa4, 0xf2,
+    0x01, 0x35, 0xc1, 0x46, 0x04, 0x3e, 0x42, 0x16, 0xa0, 0xd9, 0x1e, 0xcf,
+    0x01, 0x33, 0xd9, 0x12, 0x42, 0x16, 0xbe, 0x07, 0xc2, 0x16, 0xd6, 0xd5,
+    0x33, 0xe8, 0x0f, 0xad, 0x51, 0x11, 0x42, 0x16, 0xe5, 0xcc, 0x83, 0x7c,
+    0x01, 0x2d, 0x81, 0xc6, 0xc7, 0x55, 0x0f, 0xac, 0x41, 0x42, 0x00, 0x79,
+    0x42, 0x16, 0xf1, 0x46, 0x05, 0x69, 0xc2, 0x16, 0xfd, 0x48, 0x4c, 0x06,
+    0x42, 0x17, 0x09, 0xd0, 0x1d, 0xde, 0x01, 0x3d, 0xb1, 0xd0, 0x02, 0xf9,
+    0x01, 0x3d, 0xa9, 0xd0, 0x3c, 0x1a, 0x01, 0x3d, 0xa0, 0x85, 0x01, 0x09,
+    0x69, 0x9c, 0x01, 0x09, 0x41, 0x94, 0x01, 0x08, 0xe1, 0x8b, 0x01, 0x08,
+    0x89, 0x8a, 0x01, 0x08, 0x60, 0xd0, 0x17, 0x38, 0x01, 0x3a, 0x48, 0x9a,
+    0x01, 0x38, 0xb9, 0x42, 0x00, 0xd3, 0xc2, 0x17, 0x1b, 0xc8, 0x8d, 0x62,
+    0x0f, 0xaf, 0xa0, 0xc3, 0x43, 0x72, 0x00, 0xda, 0xdb, 0x02, 0x17, 0x28,
+    0xc5, 0xd6, 0x7a, 0x00, 0xdb, 0x00, 0xc8, 0xba, 0x48, 0x00, 0xdb, 0xe8,
+    0x46, 0xcf, 0xe0, 0xc2, 0x17, 0x2e, 0x49, 0xb0, 0x3c, 0x42, 0x17, 0x40,
+    0x48, 0xbc, 0x80, 0xc2, 0x17, 0x4c, 0x46, 0xcf, 0xb6, 0x42, 0x17, 0x58,
+    0xc4, 0x89, 0x19, 0x00, 0xdb, 0x99, 0xc5, 0xd5, 0xc1, 0x00, 0xdb, 0x91,
+    0x44, 0xaf, 0xb5, 0xc2, 0x17, 0x64, 0xc7, 0x78, 0x8c, 0x00, 0xdb, 0x79,
+    0xc5, 0xd6, 0x7f, 0x00, 0xdb, 0x61, 0xc5, 0xdc, 0xfb, 0x00, 0xdb, 0x58,
+    0x03, 0xc2, 0x17, 0x76, 0x07, 0xc2, 0x17, 0x8b, 0xc3, 0x00, 0xb1, 0x00,
+    0xdb, 0x31, 0xc3, 0x38, 0x9c, 0x00, 0xdb, 0x19, 0xc3, 0x01, 0x0a, 0x00,
+    0xdb, 0x08, 0xc5, 0x62, 0xba, 0x00, 0xda, 0xf9, 0xc7, 0xc3, 0x10, 0x00,
+    0xda, 0xe8, 0xc4, 0x17, 0xf7, 0x00, 0xda, 0xb9, 0xc2, 0x24, 0x36, 0x00,
+    0xda, 0xb0, 0xc3, 0x0c, 0xf7, 0x00, 0xda, 0xa9, 0xc3, 0x04, 0xa0, 0x00,
+    0xda, 0xa0, 0xc4, 0x03, 0xe0, 0x00, 0xda, 0x99, 0xc2, 0x01, 0xa2, 0x00,
+    0xda, 0x90, 0xcb, 0x97, 0x62, 0x00, 0xda, 0x61, 0xcb, 0x92, 0x92, 0x00,
+    0xda, 0x59, 0xc5, 0xdb, 0x02, 0x00, 0xd8, 0x81, 0xc4, 0x9f, 0x93, 0x00,
+    0xd8, 0x2a, 0x02, 0x17, 0x97, 0xc7, 0xc3, 0x64, 0x00, 0xda, 0x41, 0xc4,
+    0x9f, 0x93, 0x00, 0xd8, 0x78, 0xc9, 0xa9, 0xa0, 0x00, 0xda, 0x39, 0x83,
+    0x00, 0xd9, 0x12, 0x02, 0x17, 0x9d, 0xc9, 0xa7, 0xe7, 0x00, 0xda, 0x31,
+    0x83, 0x00, 0xd8, 0x9a, 0x02, 0x17, 0xa1, 0x43, 0x20, 0xbf, 0x42, 0x17,
+    0xad, 0xc6, 0xbb, 0x72, 0x00, 0xd8, 0x6a, 0x02, 0x17, 0xb9, 0xc5, 0xc7,
+    0x6b, 0x00, 0xd8, 0x5a, 0x02, 0x17, 0xbf, 0xc8, 0xba, 0x28, 0x00, 0xd9,
+    0x50, 0xc6, 0xce, 0x60, 0x00, 0xd9, 0x40, 0x83, 0x00, 0xd9, 0x33, 0x02,
+    0x17, 0xc5, 0xc2, 0x1a, 0x18, 0x00, 0xd8, 0xe1, 0xc2, 0x00, 0xeb, 0x00,
+    0xd8, 0xb8, 0x42, 0x01, 0x32, 0x42, 0x17, 0xcb, 0xc5, 0xd8, 0x23, 0x00,
+    0xd8, 0xd8, 0xc5, 0xd8, 0x46, 0x00, 0xd8, 0xc8, 0xc5, 0xd8, 0x37, 0x00,
+    0xd8, 0xb0, 0xc7, 0xc5, 0x5c, 0x00, 0xd8, 0x90, 0xc7, 0xc5, 0x5c, 0x00,
+    0xd8, 0x50, 0xc7, 0xc5, 0x5c, 0x00, 0xd8, 0x40, 0xc7, 0xc5, 0x5c, 0x00,
+    0xda, 0x18, 0xc5, 0x25, 0x63, 0x00, 0xd9, 0xf3, 0x02, 0x17, 0xd7, 0xc5,
+    0xc5, 0x5e, 0x00, 0xd9, 0xa8, 0xc7, 0xc5, 0x5c, 0x00, 0xd9, 0xe8, 0xc7,
+    0xc5, 0x5c, 0x00, 0xd9, 0xd8, 0xc5, 0xd8, 0x28, 0x00, 0xd9, 0xc8, 0xc5,
+    0xd8, 0x87, 0x00, 0xd9, 0xb8, 0xc6, 0x1f, 0xe9, 0x00, 0xd8, 0x09, 0xc5,
+    0xd3, 0xaa, 0x00, 0xd8, 0x00, 0xc9, 0xa9, 0x19, 0x0b, 0x57, 0xa1, 0xc5,
+    0x27, 0x2b, 0x0b, 0x57, 0x80, 0xc9, 0xa9, 0x3d, 0x0b, 0x57, 0x99, 0xc5,
+    0x27, 0x2b, 0x0b, 0x57, 0x88, 0x87, 0x0b, 0x57, 0x59, 0xc3, 0x1b, 0xf2,
+    0x0b, 0x56, 0x80, 0xc2, 0x4c, 0x38, 0x0b, 0x57, 0x00, 0x91, 0x0b, 0x57,
+    0x48, 0xc3, 0x31, 0x93, 0x0b, 0x57, 0x30, 0xc3, 0x21, 0x54, 0x0b, 0x57,
+    0x21, 0xc2, 0x01, 0xac, 0x0b, 0x56, 0xa8, 0x91, 0x0b, 0x56, 0xf1, 0xc3,
+    0xdf, 0x70, 0x0b, 0x56, 0xb8, 0xc2, 0x06, 0x4c, 0x0b, 0x56, 0xe9, 0xc2,
+    0x01, 0x9a, 0x0b, 0x56, 0xb0, 0xc3, 0x65, 0xf4, 0x0b, 0x56, 0xc1, 0x83,
+    0x0b, 0x56, 0x88, 0x42, 0x02, 0x1a, 0xc2, 0x17, 0xdb, 0x42, 0x00, 0x62,
+    0xc2, 0x18, 0x1c, 0x42, 0x00, 0x6d, 0xc2, 0x18, 0x5c, 0x42, 0x01, 0x90,
+    0xc2, 0x18, 0x91, 0x42, 0x00, 0xed, 0xc2, 0x18, 0xd1, 0x42, 0x02, 0x68,
+    0x42, 0x19, 0x09, 0xc2, 0xcd, 0x29, 0x05, 0x36, 0x29, 0x87, 0x05, 0x36,
+    0x50, 0x87, 0x05, 0x36, 0x41, 0xc2, 0x20, 0xc5, 0x05, 0x36, 0xb8, 0x96,
+    0x05, 0x35, 0xd9, 0xc2, 0xcd, 0x29, 0x05, 0x36, 0x21, 0x90, 0x05, 0x36,
+    0x90, 0xc3, 0xe4, 0xb1, 0x05, 0x37, 0x71, 0xc4, 0xe1, 0x7c, 0x05, 0x37,
+    0x78, 0x87, 0x05, 0x35, 0x29, 0xc2, 0xcd, 0x29, 0x05, 0x36, 0x81, 0x90,
+    0x05, 0x37, 0x08, 0x8b, 0x05, 0x35, 0x61, 0xc2, 0x00, 0xc8, 0x05, 0x35,
+    0x68, 0x87, 0x05, 0x35, 0x31, 0x83, 0x05, 0x35, 0x80, 0x96, 0x05, 0x37,
+    0x41, 0x90, 0x05, 0x37, 0x50, 0xc3, 0x7a, 0x7e, 0x05, 0x35, 0x91, 0xc3,
+    0x81, 0x38, 0x05, 0x35, 0xf1, 0xc2, 0x00, 0xc8, 0x05, 0x36, 0x30, 0xc2,
+    0x20, 0xc5, 0x05, 0x35, 0xe0, 0xc2, 0x00, 0xc8, 0x05, 0x36, 0x39, 0xc2,
+    0x74, 0x8f, 0x05, 0x37, 0x58, 0xc5, 0xdc, 0x33, 0x05, 0x36, 0x99, 0xc2,
+    0x00, 0xeb, 0x05, 0x36, 0xa1, 0x83, 0x05, 0x36, 0xa8, 0xc3, 0xa7, 0x99,
+    0x05, 0x35, 0x79, 0x90, 0x05, 0x37, 0x10, 0xc2, 0x00, 0x79, 0x05, 0x37,
+    0x01, 0xc2, 0x12, 0x99, 0x05, 0x37, 0x38, 0xc2, 0x25, 0x71, 0x05, 0x35,
+    0xb1, 0xc3, 0xd9, 0x3d, 0x05, 0x35, 0xc1, 0x97, 0x05, 0x36, 0x01, 0x91,
+    0x05, 0x36, 0xb0, 0xc7, 0xc7, 0xd2, 0x05, 0x37, 0x81, 0xc9, 0xa9, 0x73,
+    0x05, 0x37, 0x88, 0xc9, 0xb0, 0x8d, 0x01, 0x5a, 0xd9, 0xcd, 0x7a, 0x9b,
+    0x01, 0x5a, 0xe8, 0x12, 0xc2, 0x19, 0x3f, 0xc5, 0xda, 0x49, 0x00, 0xdf,
+    0xf1, 0xc8, 0xb8, 0x10, 0x00, 0xdf, 0xe0, 0xd2, 0x4b, 0x85, 0x00, 0xdf,
+    0x78, 0x91, 0x00, 0xdf, 0x69, 0x8b, 0x00, 0xdf, 0x58, 0x87, 0x00, 0xdf,
+    0x48, 0xc2, 0x00, 0xa0, 0x00, 0xdf, 0x19, 0x83, 0x00, 0xde, 0xa2, 0x02,
+    0x19, 0x4b, 0xc2, 0x0e, 0x60, 0x00, 0xdf, 0x11, 0xc2, 0x1a, 0x18, 0x00,
+    0xdf, 0x01, 0xc2, 0x00, 0xeb, 0x00, 0xde, 0xe9, 0xca, 0x9a, 0x70, 0x00,
+    0xde, 0xb9, 0x83, 0x00, 0xde, 0x48, 0x4a, 0x4b, 0x8b, 0xc2, 0x19, 0x51,
+    0x83, 0x00, 0xde, 0xc1, 0xca, 0x9c, 0x1e, 0x00, 0xde, 0xb0, 0xc7, 0xc8,
+    0x7a, 0x00, 0xde, 0x68, 0xcb, 0x1f, 0xe9, 0x00, 0x4c, 0x09, 0x03, 0xc2,
+    0x19, 0x8b, 0x42, 0x06, 0xb4, 0xc2, 0x19, 0x97, 0xc5, 0x34, 0xd9, 0x00,
+    0x4d, 0xe0, 0x83, 0x00, 0x4c, 0x31, 0x8b, 0x00, 0x4c, 0x81, 0x97, 0x00,
+    0x4c, 0xa0, 0x8b, 0x00, 0x4c, 0x40, 0x97, 0x00, 0x4c, 0x50, 0x47, 0xaa,
+    0xd3, 0xc2, 0x19, 0xa3, 0xcd, 0x7c, 0x7c, 0x00, 0x4f, 0xe0, 0x83, 0x00,
+    0x4c, 0xa9, 0xc2, 0x00, 0xce, 0x00, 0x4c, 0xb2, 0x02, 0x19, 0xb1, 0x83,
+    0x00, 0x4c, 0xb9, 0xc2, 0x00, 0xce, 0x00, 0x4c, 0xc0, 0xc2, 0x00, 0xeb,
+    0x00, 0x4c, 0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x4c, 0xf1, 0xc2, 0x03, 0x83,
+    0x00, 0x4d, 0x19, 0x83, 0x00, 0x4d, 0x40, 0x83, 0x00, 0x4c, 0xd1, 0xc2,
+    0x00, 0xce, 0x00, 0x4c, 0xd8, 0x83, 0x00, 0x4c, 0xe1, 0xc2, 0x00, 0xce,
+    0x00, 0x4c, 0xe8, 0x16, 0xc2, 0x19, 0xb7, 0x83, 0x00, 0x4d, 0x21, 0xc2,
+    0x00, 0xce, 0x00, 0x4d, 0x28, 0x06, 0xc2, 0x19, 0xc1, 0x83, 0x00, 0x4d,
+    0x31, 0xc2, 0x00, 0xce, 0x00, 0x4d, 0x38, 0x83, 0x00, 0x4d, 0x51, 0xc2,
+    0x00, 0xce, 0x00, 0x4d, 0x58, 0x83, 0x00, 0x4d, 0x61, 0xc2, 0x00, 0xce,
+    0x00, 0x4d, 0x68, 0x83, 0x00, 0x4d, 0x79, 0xc2, 0x1a, 0x18, 0x00, 0x4e,
+    0xf8, 0x83, 0x00, 0x4d, 0x83, 0x02, 0x19, 0xcb, 0xc2, 0x00, 0x3b, 0x00,
+    0x4e, 0xe1, 0xc2, 0x00, 0xce, 0x00, 0x4e, 0xe8, 0xc2, 0x00, 0xce, 0x00,
+    0x4d, 0xb1, 0xc2, 0x0d, 0x01, 0x00, 0x4d, 0xb9, 0x83, 0x00, 0x4d, 0xc0,
+    0x83, 0x00, 0x4d, 0xf1, 0x8b, 0x00, 0x4e, 0x41, 0x97, 0x00, 0x4e, 0x60,
+    0x8b, 0x00, 0x4e, 0x00, 0x97, 0x00, 0x4e, 0x10, 0x94, 0x00, 0x4e, 0x1b,
+    0x02, 0x19, 0xd1, 0x8e, 0x00, 0x4f, 0x12, 0x02, 0x19, 0xd5, 0xc2, 0x01,
+    0xa2, 0x00, 0x4f, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x4f, 0x48, 0xc3, 0x04,
+    0xa0, 0x00, 0x4f, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x4f, 0x58, 0xc2, 0x24,
+    0x36, 0x00, 0x4f, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x4f, 0x68, 0xc3, 0x05,
+    0x16, 0x00, 0x4f, 0xa3, 0x02, 0x19, 0xd9, 0x16, 0xc2, 0x19, 0xdf, 0xc4,
+    0x04, 0x9f, 0x00, 0x4f, 0xb8, 0x1b, 0xc2, 0x19, 0xeb, 0xc2, 0x00, 0x3b,
+    0x00, 0xd0, 0x59, 0x83, 0x00, 0xd0, 0x51, 0x09, 0x42, 0x19, 0xf5, 0xc2,
+    0x04, 0xf2, 0x00, 0xd0, 0x39, 0x83, 0x00, 0xd0, 0x30, 0xa5, 0x01, 0x41,
+    0x03, 0x02, 0x19, 0xff, 0xa0, 0x01, 0x40, 0x0b, 0x02, 0x1a, 0x0a, 0xa1,
+    0x01, 0x40, 0x13, 0x02, 0x1a, 0x38, 0xa2, 0x01, 0x40, 0x23, 0x02, 0x1a,
+    0x5f, 0xa3, 0x01, 0x40, 0x43, 0x02, 0x1a, 0x7f, 0xa4, 0x01, 0x40, 0x83,
+    0x02, 0x1a, 0x98, 0xa7, 0x01, 0x44, 0x01, 0xa6, 0x01, 0x42, 0x02, 0x02,
+    0x1a, 0xaa, 0x01, 0x42, 0x1a, 0xae, 0xc2, 0x0c, 0xf3, 0x08, 0x83, 0x18,
+    0x9b, 0x08, 0x83, 0x10, 0xc4, 0x17, 0xf7, 0x08, 0x82, 0xc3, 0x02, 0x1a,
+    0xba, 0xc2, 0x24, 0x36, 0x08, 0x82, 0xba, 0x02, 0x1a, 0xc0, 0x0b, 0xc2,
+    0x1a, 0xc6, 0x11, 0x42, 0x1a, 0xd2, 0x0a, 0xc2, 0x1a, 0xde, 0x19, 0xc2,
+    0x1a, 0xea, 0xc2, 0x00, 0x79, 0x08, 0x82, 0xd8, 0x49, 0x5c, 0x83, 0x42,
+    0x1a, 0xf4, 0xc2, 0x00, 0x89, 0x08, 0x81, 0xa1, 0x83, 0x08, 0x81, 0x70,
+    0xc2, 0x00, 0xce, 0x08, 0x81, 0x51, 0x83, 0x08, 0x81, 0x48, 0xc2, 0x00,
+    0xce, 0x08, 0x81, 0x41, 0x83, 0x08, 0x81, 0x38, 0x83, 0x08, 0x81, 0x31,
+    0xc2, 0x03, 0x83, 0x08, 0x81, 0x09, 0xc2, 0x1a, 0x18, 0x08, 0x80, 0xe1,
+    0xc2, 0x00, 0xeb, 0x08, 0x80, 0xb8, 0xc2, 0x00, 0xce, 0x08, 0x81, 0x29,
+    0x83, 0x08, 0x81, 0x21, 0x06, 0x42, 0x1b, 0x0c, 0xc2, 0x00, 0xce, 0x08,
+    0x81, 0x19, 0x83, 0x08, 0x81, 0x11, 0x16, 0x42, 0x1b, 0x16, 0xc2, 0x00,
+    0xce, 0x08, 0x80, 0xd9, 0x83, 0x08, 0x80, 0xd0, 0xc2, 0x00, 0xce, 0x08,
+    0x80, 0xc9, 0x83, 0x08, 0x80, 0xc0, 0xc2, 0x00, 0xce, 0x08, 0x80, 0xb1,
+    0x83, 0x08, 0x80, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0x80, 0xa1, 0x83, 0x08,
+    0x80, 0x98, 0x97, 0x08, 0x80, 0x91, 0x8b, 0x08, 0x80, 0x81, 0x83, 0x08,
+    0x80, 0x30, 0x47, 0xaa, 0xd3, 0xc2, 0x1b, 0x20, 0x83, 0x08, 0x81, 0x78,
+    0x97, 0x08, 0x80, 0x50, 0x8b, 0x08, 0x80, 0x40, 0xc2, 0x00, 0xce, 0x08,
+    0x81, 0x81, 0xc2, 0x0d, 0x01, 0x08, 0x81, 0x89, 0x83, 0x08, 0x81, 0x90,
+    0x91, 0x08, 0x82, 0x23, 0x02, 0x1b, 0x2e, 0x03, 0xc2, 0x1b, 0x34, 0x87,
+    0x08, 0x82, 0x11, 0x48, 0xaa, 0xd2, 0xc2, 0x1b, 0x40, 0x97, 0x08, 0x81,
+    0xe3, 0x02, 0x1b, 0x4e, 0x8b, 0x08, 0x81, 0xd3, 0x02, 0x1b, 0x52, 0xce,
+    0x6d, 0xbc, 0x08, 0x81, 0xc8, 0xc4, 0x28, 0x74, 0x08, 0x83, 0x79, 0xc5,
+    0x0a, 0xfd, 0x08, 0x83, 0x71, 0x15, 0xc2, 0x1b, 0x56, 0x08, 0xc2, 0x1b,
+    0x62, 0x16, 0xc2, 0x1b, 0x6e, 0xc3, 0x05, 0x16, 0x08, 0x83, 0x39, 0xc4,
+    0x18, 0xa7, 0x08, 0x83, 0x30, 0xc4, 0x71, 0x75, 0x08, 0x82, 0x69, 0xc3,
+    0x00, 0xe0, 0x08, 0x82, 0x58, 0xc8, 0x38, 0xd0, 0x08, 0x82, 0x51, 0x96,
+    0x08, 0x82, 0x48, 0x42, 0x00, 0x48, 0xc2, 0x1b, 0x7a, 0xc9, 0x75, 0x57,
+    0x0e, 0x83, 0x90, 0xc7, 0xc4, 0x91, 0x0e, 0x85, 0xa9, 0xc6, 0xc2, 0x85,
+    0x0e, 0x85, 0xa0, 0xc4, 0x90, 0x5b, 0x0e, 0x87, 0xa1, 0xc3, 0x21, 0xe3,
+    0x0e, 0x83, 0xf8, 0x44, 0xe4, 0x5c, 0xc2, 0x1b, 0x8c, 0xc8, 0x9d, 0xec,
+    0x0e, 0x80, 0xd8, 0x01, 0x42, 0x1b, 0x9e, 0xc5, 0xd8, 0x69, 0x0e, 0x82,
+    0x10, 0x03, 0xc2, 0x1b, 0xaa, 0x11, 0x42, 0x1b, 0xb4, 0xc3, 0x00, 0xb5,
+    0x0e, 0x83, 0xd1, 0xc9, 0xb3, 0xc9, 0x0e, 0x81, 0xb8, 0xc2, 0x00, 0xb0,
+    0x0e, 0x87, 0x79, 0xc2, 0x00, 0x4e, 0x0e, 0x87, 0x71, 0xc2, 0x00, 0x3e,
+    0x0e, 0x87, 0x69, 0xc2, 0x01, 0xa9, 0x0e, 0x87, 0x61, 0xc2, 0x00, 0xeb,
+    0x0e, 0x87, 0x59, 0xc3, 0x29, 0xb6, 0x0e, 0x87, 0x51, 0xc2, 0x04, 0xf2,
+    0x0e, 0x87, 0x48, 0x90, 0x0e, 0x84, 0xb9, 0xc9, 0x75, 0x57, 0x0e, 0x83,
+    0x98, 0x46, 0xcb, 0xba, 0xc2, 0x1b, 0xc0, 0x46, 0xd0, 0x82, 0xc2, 0x1b,
+    0xcd, 0xc5, 0x4a, 0x1f, 0x0e, 0x81, 0x18, 0xc6, 0xd2, 0x62, 0x0e, 0x81,
+    0x99, 0xca, 0x6c, 0x9a, 0x0e, 0x80, 0x68, 0xc5, 0xdc, 0xf1, 0x0e, 0x85,
+    0x09, 0xc4, 0xe1, 0x18, 0x0e, 0x84, 0xd0, 0xc5, 0xd4, 0x13, 0x0e, 0x85,
+    0x01, 0x8b, 0x0e, 0x84, 0xf8, 0xc2, 0x00, 0x8d, 0x0e, 0x84, 0xf1, 0xc4,
+    0x00, 0xc1, 0x0e, 0x84, 0xe8, 0x8b, 0x0e, 0x84, 0xe1, 0xc5, 0xd4, 0x13,
+    0x0e, 0x84, 0xd8, 0xc7, 0xc6, 0xba, 0x0e, 0x83, 0x11, 0xc2, 0x00, 0xb6,
+    0x0e, 0x82, 0xe0, 0xc9, 0xb2, 0xe8, 0x0e, 0x80, 0xf8, 0x01, 0x42, 0x1b,
+    0xd9, 0x01, 0x42, 0x1b, 0xe3, 0xc4, 0xce, 0xf8, 0x0e, 0x80, 0x40, 0x45,
+    0xd8, 0xbe, 0xc2, 0x1b, 0xed, 0xc4, 0xc7, 0x87, 0x0e, 0x80, 0x98, 0xc8,
+    0xb8, 0x28, 0x0e, 0x87, 0x31, 0xc5, 0xcb, 0xa3, 0x0e, 0x84, 0x92, 0x02,
+    0x1b, 0xff, 0x46, 0xcb, 0x7e, 0xc2, 0x1c, 0x05, 0xc4, 0xc0, 0x1f, 0x0e,
+    0x84, 0xc8, 0x16, 0xc2, 0x1c, 0x17, 0xd5, 0x35, 0xb6, 0x0e, 0x86, 0x91,
+    0xdc, 0x13, 0x6f, 0x0e, 0x86, 0x89, 0xd1, 0x4e, 0xf3, 0x0e, 0x86, 0x80,
+    0xc9, 0x9d, 0xeb, 0x0e, 0x84, 0x00, 0x43, 0x00, 0xc1, 0xc2, 0x1c, 0x23,
+    0xd5, 0x35, 0xb6, 0x0e, 0x86, 0xb1, 0xdc, 0x13, 0x6f, 0x0e, 0x86, 0xa9,
+    0xd1, 0x4e, 0xf3, 0x0e, 0x86, 0xa0, 0xc3, 0x21, 0xe3, 0x0e, 0x83, 0xe9,
+    0xc4, 0x90, 0x5b, 0x0e, 0x83, 0xe0, 0xc4, 0xde, 0x7c, 0x0e, 0x82, 0x99,
+    0xc6, 0xcf, 0x62, 0x0e, 0x80, 0x52, 0x02, 0x1c, 0x2f, 0xc5, 0xd5, 0xf3,
+    0x0e, 0x86, 0x39, 0xc9, 0xab, 0xe0, 0x0e, 0x85, 0xe0, 0x47, 0x19, 0x70,
+    0xc2, 0x1c, 0x35, 0xcb, 0x96, 0xe9, 0x0e, 0x85, 0xf0, 0xca, 0x9f, 0x0c,
+    0x0e, 0x86, 0x21, 0xc8, 0xb6, 0x48, 0x0e, 0x86, 0x18, 0x10, 0xc2, 0x1c,
+    0x41, 0xc2, 0x00, 0x4e, 0x0e, 0x86, 0x01, 0xc2, 0x00, 0x3e, 0x0e, 0x85,
+    0xf9, 0xc2, 0x01, 0xa9, 0x0e, 0x85, 0xe9, 0xc2, 0x04, 0xf2, 0x0e, 0x85,
+    0xd0, 0xcf, 0x6a, 0x07, 0x0e, 0x85, 0xc8, 0x44, 0x3a, 0xa5, 0xc2, 0x1c,
+    0x4d, 0xc4, 0x51, 0x22, 0x0e, 0x85, 0xb8, 0xc3, 0x55, 0xc8, 0x0e, 0x82,
+    0x31, 0xc8, 0x9d, 0xec, 0x0e, 0x80, 0xd0, 0x47, 0xc7, 0x23, 0xc2, 0x1c,
+    0x57, 0x44, 0x86, 0xe9, 0x42, 0x1c, 0x63, 0x48, 0x6b, 0x7f, 0xc2, 0x1c,
+    0x6f, 0x42, 0x00, 0x4c, 0x42, 0x1c, 0x7b, 0xce, 0x6e, 0x9c, 0x0e, 0x85,
+    0x29, 0xcc, 0x86, 0xe8, 0x0e, 0x85, 0x18, 0xc6, 0xcb, 0xa2, 0x0e, 0x84,
+    0xb1, 0xc3, 0x1d, 0xa8, 0x0e, 0x84, 0x39, 0x83, 0x0e, 0x81, 0x80, 0xc7,
+    0xc2, 0x53, 0x0e, 0x83, 0x81, 0x12, 0xc2, 0x1c, 0x87, 0xc7, 0xc0, 0x70,
+    0x0e, 0x83, 0x69, 0x42, 0x00, 0x48, 0x42, 0x1c, 0x93, 0xcd, 0x7e, 0xf9,
+    0x0e, 0x83, 0xc9, 0xc2, 0x00, 0xb6, 0x0e, 0x81, 0x6a, 0x02, 0x1c, 0x9d,
+    0xcf, 0x68, 0x27, 0x0e, 0x84, 0x71, 0x16, 0xc2, 0x1c, 0xa9, 0xcb, 0x8e,
+    0x3b, 0x0e, 0x84, 0x59, 0xcc, 0x84, 0xf0, 0x0e, 0x84, 0x50, 0xc3, 0x55,
+    0xc8, 0x0e, 0x82, 0x41, 0xc5, 0xcc, 0x99, 0x0e, 0x80, 0x21, 0xcb, 0x6c,
+    0x99, 0x0e, 0x80, 0x18, 0xc7, 0xc2, 0x53, 0x0e, 0x83, 0x89, 0xcb, 0x90,
+    0x35, 0x0e, 0x83, 0x79, 0xc7, 0xc0, 0x70, 0x0e, 0x83, 0x61, 0x90, 0x0e,
+    0x81, 0xca, 0x02, 0x1c, 0xb5, 0xc2, 0x00, 0x47, 0x0e, 0x80, 0xb9, 0x8b,
+    0x0e, 0x80, 0x00, 0x47, 0xc6, 0x89, 0xc2, 0x1c, 0xbb, 0xc6, 0xce, 0xf6,
+    0x0e, 0x80, 0x4a, 0x02, 0x1c, 0xc7, 0xc4, 0x7c, 0x10, 0x0e, 0x82, 0x68,
+    0x16, 0xc2, 0x1c, 0xcb, 0xc2, 0x00, 0xb6, 0x0e, 0x82, 0x08, 0xc3, 0x55,
+    0xc8, 0x0e, 0x82, 0xc1, 0xc5, 0xcc, 0x99, 0x0e, 0x80, 0x31, 0xcb, 0x6c,
+    0x99, 0x0e, 0x80, 0x28, 0x94, 0x08, 0xe0, 0x38, 0xd1, 0x50, 0x69, 0x0f,
+    0xdc, 0xf9, 0xc2, 0x00, 0x2f, 0x01, 0x2f, 0xd0, 0x4e, 0x60, 0xd5, 0xc2,
+    0x1c, 0xd5, 0xcc, 0x82, 0xb0, 0x0f, 0xac, 0x50, 0xc9, 0xab, 0xc5, 0x0f,
+    0xac, 0x61, 0xc5, 0xcc, 0xe7, 0x0f, 0xac, 0x48, 0xd1, 0x50, 0x69, 0x0f,
+    0xdc, 0xf1, 0xc2, 0x00, 0x2f, 0x01, 0x2f, 0xf8, 0x4e, 0x02, 0xeb, 0xc2,
+    0x1c, 0xe1, 0xdb, 0x15, 0x2c, 0x01, 0x49, 0xf0, 0x5b, 0x17, 0x12, 0xc2,
+    0x1c, 0xed, 0x46, 0x00, 0x29, 0x42, 0x1c, 0xf9, 0xce, 0x06, 0x7b, 0x01,
+    0x2c, 0x31, 0xcd, 0x46, 0x5f, 0x01, 0x2c, 0x18, 0xc9, 0xb2, 0xfa, 0x01,
+    0x3f, 0xf0, 0xc9, 0xb2, 0xfa, 0x01, 0x3f, 0xe0, 0xc9, 0xb2, 0xfa, 0x01,
+    0x3f, 0xe8, 0xc9, 0xb2, 0xfa, 0x01, 0x3f, 0xd8, 0xcc, 0x84, 0x84, 0x01,
+    0x3f, 0xd1, 0xc5, 0x00, 0x83, 0x01, 0x3f, 0xb8, 0x42, 0x00, 0xd8, 0xc2,
+    0x1d, 0x0b, 0xcb, 0x92, 0xdf, 0x01, 0x52, 0xd9, 0xcf, 0x62, 0xa5, 0x01,
+    0x52, 0xe8, 0xc7, 0x18, 0x19, 0x01, 0x52, 0x89, 0x45, 0x03, 0x7c, 0x42,
+    0x1d, 0x17, 0x42, 0x00, 0x6d, 0xc2, 0x1d, 0x23, 0x09, 0x42, 0x1d, 0x35,
+    0xd3, 0x17, 0x86, 0x01, 0x4c, 0x99, 0x49, 0x01, 0xed, 0x42, 0x1d, 0x44,
+    0x49, 0x04, 0x35, 0xc2, 0x1d, 0x50, 0xcc, 0x04, 0x3d, 0x0f, 0xdc, 0x61,
+    0xc6, 0x00, 0x7c, 0x0f, 0xc8, 0x3b, 0x02, 0x1d, 0x56, 0x42, 0x00, 0xdb,
+    0xc2, 0x1d, 0x5c, 0xcb, 0x8c, 0xaf, 0x0f, 0xdd, 0x91, 0xc6, 0x9b, 0x64,
+    0x0f, 0xdd, 0xc8, 0xd0, 0x5b, 0xf2, 0x0f, 0xc2, 0xc1, 0xd1, 0x55, 0xca,
+    0x01, 0x0f, 0xf9, 0xc5, 0x00, 0x83, 0x01, 0x0c, 0xa3, 0x02, 0x1d, 0x68,
+    0xcc, 0x84, 0x84, 0x01, 0x0e, 0xa3, 0x02, 0x1d, 0x6c, 0x19, 0xc2, 0x1d,
+    0x72, 0xcb, 0x94, 0xc3, 0x01, 0x58, 0x61, 0xd5, 0x02, 0xb4, 0x01, 0x5b,
+    0x20, 0xcc, 0x0a, 0xfd, 0x01, 0x2c, 0x79, 0xcd, 0x15, 0xdc, 0x01, 0x2c,
+    0x70, 0xd1, 0x46, 0x5b, 0x01, 0x2c, 0x49, 0xd0, 0x04, 0x79, 0x01, 0x16,
+    0x58, 0x01, 0x42, 0x1d, 0x7e, 0xd3, 0x01, 0x56, 0x01, 0x00, 0xc1, 0xd0,
+    0x5c, 0x72, 0x01, 0x71, 0x30, 0x01, 0x42, 0x1d, 0x96, 0x44, 0x03, 0xe1,
+    0xc2, 0x1d, 0xa8, 0xcc, 0x88, 0xc8, 0x0f, 0xaf, 0x61, 0xde, 0x0a, 0xcb,
+    0x0f, 0xde, 0x08, 0x44, 0x00, 0xc3, 0xc2, 0x1d, 0xb4, 0xd3, 0x43, 0x9a,
+    0x01, 0x70, 0x48, 0xd0, 0x4d, 0x25, 0x01, 0x2c, 0x59, 0xc7, 0xa9, 0x00,
+    0x01, 0x4b, 0xe0, 0xca, 0xa4, 0xa2, 0x01, 0x1c, 0xe9, 0xc9, 0x54, 0x6d,
+    0x01, 0x1c, 0xe1, 0xca, 0xa3, 0x3a, 0x01, 0x1c, 0xd8, 0xce, 0x01, 0x5b,
+    0x01, 0x00, 0xe1, 0xcc, 0x87, 0x78, 0x01, 0x4e, 0xd1, 0xcb, 0x1a, 0x38,
+    0x01, 0x71, 0x41, 0xcd, 0x08, 0x53, 0x01, 0x80, 0x50, 0xcb, 0x1a, 0x38,
+    0x01, 0x4c, 0x29, 0x05, 0xc2, 0x1d, 0xc0, 0xd2, 0x25, 0xdb, 0x01, 0x80,
+    0xb1, 0xd6, 0x06, 0xea, 0x01, 0x80, 0xc1, 0xce, 0x22, 0x37, 0x01, 0x80,
+    0xd0, 0xd6, 0x06, 0xea, 0x01, 0x4c, 0xb9, 0xd2, 0x25, 0xdb, 0x01, 0x80,
+    0x80, 0x50, 0x5d, 0xc2, 0xc2, 0x1d, 0xcc, 0x4e, 0x72, 0xfc, 0x42, 0x1d,
+    0xd8, 0xda, 0x1b, 0x02, 0x0f, 0xc4, 0xa0, 0x45, 0x00, 0xc4, 0xc2, 0x1d,
+    0xe4, 0x44, 0x16, 0x57, 0x42, 0x1d, 0xf0, 0xcd, 0x7d, 0x73, 0x01, 0x0c,
+    0xf1, 0x48, 0x02, 0xbc, 0x42, 0x1d, 0xfc, 0x45, 0x00, 0x92, 0xc2, 0x1e,
+    0x08, 0x16, 0xc2, 0x1e, 0x3e, 0xd5, 0x10, 0x4f, 0x01, 0x0e, 0x31, 0xc8,
+    0xb2, 0xfb, 0x01, 0x0d, 0x23, 0x02, 0x1e, 0x4a, 0x03, 0x42, 0x1e, 0x50,
+    0xc5, 0x00, 0x83, 0x01, 0x0e, 0x83, 0x02, 0x1e, 0x5c, 0xca, 0x50, 0xd6,
+    0x01, 0x48, 0x60, 0xcb, 0x74, 0x6b, 0x01, 0x0e, 0xe1, 0xca, 0x86, 0xd2,
+    0x0f, 0xc1, 0xc0, 0x46, 0x05, 0x35, 0xc2, 0x1e, 0x66, 0xc2, 0x00, 0x6c,
+    0x0f, 0xd7, 0x90, 0xd0, 0x5c, 0xd2, 0x0f, 0xc2, 0x01, 0xc5, 0x00, 0x83,
+    0x0f, 0xc2, 0x20, 0xc5, 0x00, 0x83, 0x01, 0x58, 0x29, 0xd3, 0x45, 0x9b,
+    0x01, 0x5c, 0x40, 0xca, 0x52, 0x3b, 0x00, 0x7e, 0xc0, 0xca, 0x34, 0x32,
+    0x01, 0x13, 0x91, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x20, 0x4a, 0x33, 0x31,
+    0x42, 0x1e, 0x72, 0xe0, 0x06, 0x89, 0x01, 0x54, 0x58, 0x47, 0xc7, 0x38,
+    0xc2, 0x1e, 0x81, 0x53, 0x40, 0xdb, 0x42, 0x1e, 0x8d, 0xe0, 0x03, 0xe9,
+    0x01, 0x54, 0x88, 0xc2, 0x00, 0xce, 0x00, 0xe2, 0x71, 0x83, 0x00, 0xe2,
+    0x68, 0xc2, 0x00, 0xce, 0x00, 0xe0, 0xc1, 0x83, 0x00, 0xe0, 0xb8, 0xc7,
+    0xc0, 0xd9, 0x00, 0xe1, 0xf0, 0xd2, 0x4c, 0xa5, 0x0f, 0xbd, 0xa9, 0xc6,
+    0x13, 0x38, 0x0f, 0xbd, 0x49, 0xc4, 0x04, 0x45, 0x01, 0x2c, 0x88, 0x44,
+    0x00, 0x65, 0xc2, 0x1e, 0x93, 0xc3, 0x14, 0xc5, 0x0f, 0xb4, 0x40, 0xe0,
+    0x06, 0xe9, 0x01, 0x3b, 0x90, 0x44, 0x0c, 0xf7, 0xc2, 0x1e, 0x99, 0x52,
+    0x10, 0x72, 0x42, 0x1e, 0xa5, 0xd7, 0x2b, 0x25, 0x0f, 0xbe, 0x01, 0xd8,
+    0x23, 0xc5, 0x0f, 0xbe, 0x90, 0xc7, 0x74, 0x52, 0x0f, 0xaf, 0x88, 0x83,
+    0x05, 0x26, 0xe9, 0xc2, 0x00, 0xce, 0x05, 0x26, 0xf0, 0x44, 0x57, 0xe5,
+    0xc2, 0x1e, 0xb1, 0xc5, 0xda, 0xb2, 0x05, 0x27, 0xc8, 0xd6, 0x2e, 0x82,
+    0x01, 0x50, 0xa1, 0x45, 0x00, 0x92, 0x42, 0x1e, 0xcf, 0xc4, 0xae, 0x76,
+    0x00, 0x04, 0x50, 0x42, 0xe5, 0xe4, 0xc2, 0x1e, 0xdb, 0x26, 0xc2, 0x1e,
+    0xfb, 0x25, 0xc2, 0x1f, 0x0f, 0x04, 0xc2, 0x1f, 0x2b, 0xc4, 0xe3, 0x00,
+    0x08, 0x30, 0xd9, 0x20, 0xc2, 0x1f, 0x33, 0x22, 0xc2, 0x1f, 0x45, 0x23,
+    0xc2, 0x1f, 0x65, 0x24, 0x42, 0x1f, 0x6d, 0x42, 0x07, 0xf3, 0xc2, 0x1f,
+    0x95, 0x49, 0xaf, 0x5b, 0xc2, 0x1f, 0xa1, 0x4a, 0x9f, 0x16, 0x42, 0x1f,
+    0xab, 0xc4, 0x17, 0xf7, 0x00, 0xca, 0x69, 0xc2, 0x24, 0x36, 0x00, 0xca,
+    0x60, 0xc3, 0x0c, 0xf7, 0x00, 0xca, 0x59, 0xc3, 0x04, 0xa0, 0x00, 0xca,
+    0x50, 0xc4, 0x03, 0xe0, 0x00, 0xca, 0x49, 0xc2, 0x01, 0xa2, 0x00, 0xca,
+    0x40, 0xc3, 0x17, 0x34, 0x00, 0xca, 0x01, 0xc4, 0xde, 0x88, 0x00, 0xc9,
+    0xd9, 0xc9, 0xaf, 0xb5, 0x00, 0xc9, 0xd1, 0xc9, 0xb1, 0x38, 0x00, 0xc9,
+    0xc8, 0xc2, 0x00, 0x89, 0x00, 0xc9, 0xc1, 0xc2, 0x00, 0x3b, 0x00, 0xc9,
+    0xb9, 0xc2, 0x00, 0xb6, 0x00, 0xc9, 0xb1, 0xc2, 0x04, 0xf2, 0x00, 0xc9,
+    0xa9, 0x10, 0xc2, 0x1f, 0xb5, 0xc2, 0x00, 0x51, 0x00, 0xc9, 0x99, 0xc8,
+    0x14, 0x02, 0x00, 0xc9, 0x91, 0xc2, 0x02, 0x4d, 0x00, 0xc9, 0x80, 0xc2,
+    0x00, 0x71, 0x00, 0xc9, 0x59, 0xc2, 0x00, 0x3b, 0x00, 0xc9, 0x51, 0xc2,
+    0x1a, 0x18, 0x00, 0xc9, 0x48, 0x91, 0x00, 0xc9, 0x43, 0x02, 0x1f, 0xbf,
+    0x87, 0x00, 0xc9, 0x3b, 0x02, 0x1f, 0xc3, 0x83, 0x00, 0xc9, 0x03, 0x02,
+    0x1f, 0xc7, 0x97, 0x00, 0xc9, 0x11, 0x8b, 0x00, 0xc9, 0x08, 0xc2, 0x00,
+    0x3b, 0x00, 0xc8, 0xf1, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0x61, 0x83, 0x00,
+    0xc8, 0x58, 0xc3, 0x2c, 0x85, 0x00, 0xc8, 0xe9, 0xc2, 0x00, 0xce, 0x00,
+    0xc8, 0x21, 0x83, 0x00, 0xc8, 0x18, 0x83, 0x00, 0xc8, 0xd9, 0xc2, 0x0d,
+    0x01, 0x00, 0xc8, 0xd1, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0xc8, 0x90, 0x00,
+    0xc8, 0x50, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0x99, 0x83, 0x00, 0xc8, 0x90,
+    0xc2, 0x00, 0xce, 0x00, 0xc8, 0x89, 0x83, 0x00, 0xc8, 0x80, 0x83, 0x00,
+    0xc8, 0x79, 0xc2, 0x00, 0xeb, 0x00, 0xc8, 0x28, 0xc2, 0x00, 0xce, 0x00,
+    0xc8, 0x71, 0x83, 0x00, 0xc8, 0x68, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0x49,
+    0x83, 0x00, 0xc8, 0x40, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0x39, 0x83, 0x00,
+    0xc8, 0x30, 0xc2, 0x00, 0xce, 0x00, 0xc8, 0x11, 0x83, 0x00, 0xc8, 0x08,
+    0x45, 0xd4, 0x4a, 0xc2, 0x1f, 0xcf, 0x44, 0x89, 0x41, 0x42, 0x1f, 0xdb,
+    0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x29, 0xc6, 0x00, 0x7c, 0x0f, 0xa9, 0xa0,
+    0xc6, 0x00, 0x7c, 0x0f, 0xbf, 0x11, 0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x48,
+    0x43, 0x00, 0xe1, 0xc2, 0x1f, 0xed, 0x46, 0x18, 0x98, 0x42, 0x1f, 0xf9,
+    0x43, 0x01, 0xa2, 0xc2, 0x20, 0x0b, 0xdb, 0x16, 0x55, 0x01, 0x57, 0xe0,
+    0xc6, 0x00, 0x7c, 0x0f, 0xbf, 0x09, 0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x40,
+    0xc6, 0x00, 0x7c, 0x0f, 0xbf, 0x19, 0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x50,
+    0x46, 0x01, 0x93, 0xc2, 0x20, 0x17, 0x48, 0x1b, 0xd9, 0x42, 0x20, 0xcd,
+    0xcd, 0x80, 0x3e, 0x00, 0xeb, 0xf1, 0xcd, 0x78, 0xc7, 0x00, 0xeb, 0xd8,
+    0xc4, 0x6f, 0x86, 0x01, 0x04, 0xa0, 0x96, 0x00, 0xe8, 0xdb, 0x02, 0x20,
+    0xe9, 0x8e, 0x00, 0x14, 0xfb, 0x02, 0x20, 0xef, 0x87, 0x00, 0xe8, 0x3b,
+    0x02, 0x20, 0xf5, 0x9c, 0x00, 0xe9, 0x11, 0x99, 0x00, 0xe9, 0x09, 0x98,
+    0x00, 0xe9, 0x01, 0x97, 0x00, 0xe8, 0xe1, 0x94, 0x00, 0x14, 0x03, 0x02,
+    0x21, 0x01, 0x92, 0x00, 0xe8, 0xc1, 0x91, 0x00, 0xe8, 0x7b, 0x02, 0x21,
+    0x13, 0x8f, 0x00, 0xe8, 0x69, 0x8d, 0x00, 0xe8, 0x59, 0x8c, 0x00, 0xe8,
+    0x51, 0x86, 0x00, 0xe8, 0x29, 0x85, 0x00, 0xe8, 0x21, 0x84, 0x00, 0x14,
+    0xcb, 0x02, 0x21, 0x21, 0x83, 0x00, 0xe8, 0x03, 0x02, 0x21, 0x27, 0x89,
+    0x00, 0x13, 0x13, 0x02, 0x21, 0x2b, 0x8b, 0x00, 0x13, 0x53, 0x02, 0x21,
+    0x31, 0x90, 0x00, 0x13, 0xa1, 0x9b, 0x00, 0x14, 0x79, 0x8a, 0x00, 0x14,
+    0xe1, 0x88, 0x05, 0x39, 0x81, 0x95, 0x05, 0x39, 0x89, 0x93, 0x05, 0x3d,
+    0x78, 0xca, 0x43, 0xb6, 0x0e, 0xf8, 0x78, 0xc4, 0x00, 0x34, 0x0e, 0xf8,
+    0x71, 0xc6, 0x00, 0x55, 0x00, 0x0d, 0xf0, 0xd4, 0x06, 0x35, 0x0e, 0xf8,
+    0x50, 0xd8, 0x22, 0xbd, 0x00, 0x15, 0x11, 0xc8, 0xbc, 0x90, 0x00, 0x0d,
+    0x50, 0xc5, 0x06, 0x30, 0x00, 0x14, 0xc1, 0xca, 0x50, 0x5f, 0x00, 0x15,
+    0x60, 0x9b, 0x00, 0x02, 0xcb, 0x02, 0x21, 0x37, 0x8f, 0x00, 0x02, 0x6b,
+    0x02, 0x21, 0x43, 0x97, 0x00, 0x02, 0xab, 0x02, 0x21, 0x4f, 0x91, 0x00,
+    0x02, 0x7b, 0x02, 0x21, 0x59, 0x8b, 0x00, 0x02, 0x4b, 0x02, 0x21, 0x7d,
+    0x87, 0x00, 0x02, 0x2b, 0x02, 0x21, 0x93, 0x83, 0x00, 0x02, 0x0b, 0x02,
+    0x21, 0xbb, 0x95, 0x00, 0x02, 0x9b, 0x02, 0x21, 0xf1, 0x9c, 0x00, 0x02,
+    0xd3, 0x02, 0x22, 0x13, 0x9a, 0x00, 0x02, 0xc3, 0x02, 0x22, 0x19, 0x99,
+    0x00, 0x02, 0xbb, 0x02, 0x22, 0x1f, 0x98, 0x00, 0x02, 0xb3, 0x02, 0x22,
+    0x2b, 0x96, 0x00, 0x02, 0xa3, 0x02, 0x22, 0x47, 0x94, 0x00, 0x02, 0x93,
+    0x02, 0x22, 0x6c, 0x92, 0x00, 0x02, 0x83, 0x02, 0x22, 0x7c, 0x90, 0x00,
+    0x02, 0x73, 0x02, 0x22, 0x82, 0x8e, 0x00, 0x02, 0x63, 0x02, 0x22, 0x8c,
+    0x8d, 0x00, 0x02, 0x5b, 0x02, 0x22, 0x96, 0x8a, 0x00, 0x02, 0x43, 0x02,
+    0x22, 0x9c, 0x89, 0x00, 0x02, 0x3b, 0x02, 0x22, 0xb4, 0x88, 0x00, 0x02,
+    0x33, 0x02, 0x22, 0xcc, 0x86, 0x00, 0x02, 0x23, 0x02, 0x22, 0xd2, 0x85,
+    0x00, 0x02, 0x1b, 0x02, 0x22, 0xdf, 0x84, 0x00, 0x02, 0x13, 0x02, 0x23,
+    0x00, 0x8c, 0x00, 0x02, 0x53, 0x02, 0x23, 0x12, 0x93, 0x00, 0x02, 0x8a,
+    0x02, 0x23, 0x18, 0xc2, 0x00, 0x0b, 0x00, 0x09, 0x91, 0xc2, 0x0b, 0x28,
+    0x00, 0x0a, 0x90, 0x42, 0x00, 0x5e, 0xc2, 0x23, 0x1e, 0x43, 0xe5, 0x59,
+    0x42, 0x23, 0x2a, 0xc3, 0x47, 0x28, 0x00, 0x74, 0x31, 0xc3, 0x19, 0x59,
+    0x00, 0x74, 0x49, 0xc3, 0xe5, 0x6b, 0x00, 0x74, 0x61, 0x10, 0xc2, 0x23,
+    0x36, 0x42, 0x01, 0x94, 0xc2, 0x23, 0x42, 0x06, 0xc2, 0x23, 0x4c, 0xc3,
+    0x3a, 0xeb, 0x00, 0x75, 0x01, 0xc3, 0x00, 0xe8, 0x00, 0x75, 0x60, 0xc4,
+    0xde, 0x94, 0x00, 0x74, 0xe1, 0xc3, 0x31, 0x33, 0x00, 0x74, 0xf0, 0xc3,
+    0x31, 0x33, 0x00, 0x74, 0x51, 0xc4, 0xde, 0x94, 0x00, 0x75, 0x50, 0xc2,
+    0x00, 0xce, 0x00, 0x75, 0x41, 0xc2, 0x0d, 0x01, 0x00, 0x75, 0x48, 0xc4,
+    0xde, 0x94, 0x00, 0x74, 0xb1, 0xc3, 0x31, 0x33, 0x00, 0x74, 0xb8, 0xc2,
+    0x00, 0x47, 0x00, 0x74, 0xe9, 0xc2, 0x0d, 0x1d, 0x00, 0x74, 0xf8, 0xc3,
+    0x00, 0xb1, 0x00, 0x75, 0x19, 0xc3, 0x60, 0x46, 0x00, 0x75, 0x28, 0xd1,
+    0x50, 0x69, 0x0f, 0xdc, 0xe9, 0xc2, 0x00, 0x2f, 0x01, 0x2f, 0xc8, 0x55,
+    0x07, 0x6e, 0xc2, 0x23, 0x56, 0x48, 0x07, 0x75, 0xc2, 0x23, 0x68, 0x4a,
+    0x12, 0xcd, 0x42, 0x23, 0x74, 0xc6, 0x07, 0x83, 0x0f, 0xda, 0x91, 0xc5,
+    0x00, 0x64, 0x0f, 0xda, 0x98, 0xd1, 0x50, 0x69, 0x0f, 0xdc, 0xe1, 0xc2,
+    0x00, 0x2f, 0x01, 0x2f, 0xc0, 0xc6, 0x07, 0x83, 0x0f, 0xda, 0xb9, 0xc5,
+    0x00, 0x64, 0x0f, 0xda, 0xc0, 0x55, 0x17, 0x18, 0xc2, 0x23, 0x80, 0x48,
+    0x07, 0x75, 0xc2, 0x23, 0x92, 0x4a, 0x12, 0xcd, 0x42, 0x23, 0x9e, 0xd5,
+    0x32, 0x98, 0x0f, 0xdc, 0xd1, 0xd0, 0x0a, 0xf9, 0x0f, 0xdc, 0x00, 0xe0,
+    0x06, 0x69, 0x0f, 0xdb, 0x50, 0xe0, 0x0b, 0x29, 0x0f, 0xdc, 0x90, 0xe0,
+    0x04, 0x29, 0x0f, 0xdc, 0x88, 0xd9, 0x1b, 0x03, 0x0f, 0xc4, 0xa9, 0xcb,
+    0x82, 0xe1, 0x01, 0x0f, 0x5b, 0x02, 0x23, 0xaa, 0xc8, 0xb2, 0xfb, 0x01,
+    0x0f, 0x52, 0x02, 0x23, 0xb0, 0xca, 0x01, 0xdf, 0x0f, 0xc4, 0x89, 0x48,
+    0x02, 0xbc, 0x42, 0x23, 0xb6, 0xd1, 0x54, 0x32, 0x01, 0x4a, 0x49, 0xd8,
+    0x01, 0xf1, 0x01, 0x5f, 0x68, 0x45, 0x00, 0x92, 0xc2, 0x23, 0xcb, 0xdc,
+    0x13, 0xc3, 0x01, 0x0e, 0x29, 0xc8, 0xb2, 0xfb, 0x01, 0x0d, 0x29, 0xc6,
+    0x10, 0x65, 0x01, 0x48, 0x91, 0xda, 0x19, 0x7c, 0x0f, 0xdd, 0xc0, 0xc5,
+    0x00, 0x71, 0x01, 0x0d, 0xf9, 0x01, 0x42, 0x23, 0xfb, 0xc5, 0x00, 0x71,
+    0x01, 0x0d, 0xf1, 0x01, 0x42, 0x24, 0x0d, 0xdb, 0x16, 0xdc, 0x01, 0x19,
+    0x21, 0xd2, 0x43, 0x29, 0x01, 0x5d, 0xc8, 0xca, 0x94, 0xa3, 0x01, 0x52,
+    0x09, 0xc7, 0x78, 0xa6, 0x01, 0x52, 0x11, 0xca, 0xa4, 0x3e, 0x01, 0x52,
+    0x28, 0xcc, 0x07, 0xdd, 0x01, 0x52, 0x31, 0xd6, 0x30, 0x50, 0x01, 0x52,
+    0x40, 0xcf, 0x17, 0x39, 0x0f, 0xbd, 0xf1, 0x42, 0x00, 0xbe, 0xc2, 0x24,
+    0x19, 0x48, 0x08, 0xeb, 0x42, 0x24, 0x1f, 0xc8, 0x03, 0x81, 0x01, 0x3b,
+    0x11, 0xc6, 0x07, 0xf3, 0x01, 0x3a, 0xb8, 0xc6, 0x00, 0x7c, 0x0f, 0xbc,
+    0x39, 0xd6, 0x2f, 0xb6, 0x01, 0x36, 0xd9, 0xc6, 0x09, 0x2b, 0x0f, 0xbc,
+    0x88, 0xdd, 0x11, 0x70, 0x0f, 0xb3, 0xd9, 0xc5, 0x13, 0x39, 0x0f, 0xbd,
+    0x60, 0x4e, 0x4d, 0x6b, 0xc2, 0x24, 0x31, 0x45, 0x1d, 0xe4, 0x42, 0x24,
+    0x3d, 0x45, 0x01, 0x56, 0xc2, 0x24, 0x49, 0x42, 0x06, 0x2e, 0x42, 0x24,
+    0x55, 0x49, 0x01, 0x4c, 0xc2, 0x24, 0x61, 0xc5, 0x00, 0x83, 0x01, 0x3c,
+    0xd0, 0xc3, 0x95, 0xf5, 0x0f, 0xb3, 0x21, 0xc9, 0xab, 0x1a, 0x0f, 0xb2,
+    0xe0, 0xc9, 0x8c, 0xfe, 0x0f, 0xaa, 0x39, 0xca, 0xa1, 0xe6, 0x01, 0x5a,
+    0xa8, 0x48, 0x09, 0xcb, 0xc2, 0x24, 0x6d, 0x01, 0x42, 0x24, 0x73, 0x50,
+    0x01, 0x4b, 0xc2, 0x24, 0x7f, 0x51, 0x05, 0x8b, 0x42, 0x24, 0x8b, 0xd7,
+    0x28, 0x17, 0x01, 0x3d, 0xd9, 0x46, 0x09, 0x71, 0x42, 0x24, 0x97, 0xca,
+    0x23, 0xd3, 0x0f, 0xbe, 0x99, 0xcd, 0x0e, 0x9f, 0x0f, 0xbe, 0xa0, 0x4b,
+    0x15, 0x47, 0xc2, 0x24, 0xa3, 0x01, 0x42, 0x24, 0xb5, 0xe0, 0x09, 0x09,
+    0x01, 0x3d, 0x70, 0xd5, 0x01, 0xd4, 0x0f, 0xc0, 0xc9, 0xdb, 0x16, 0x70,
+    0x0f, 0xc0, 0xe8, 0xe0, 0x08, 0xe9, 0x01, 0x3d, 0x40, 0xce, 0x71, 0x90,
+    0x01, 0x3a, 0x31, 0xc7, 0x9c, 0xb7, 0x01, 0x38, 0xa0, 0x46, 0x00, 0x91,
+    0xc2, 0x24, 0xc1, 0xc9, 0xab, 0xbc, 0x01, 0x5a, 0xc8, 0xe0, 0x0b, 0x69,
+    0x01, 0x3d, 0x00, 0x45, 0x03, 0x7c, 0xc2, 0x24, 0xcd, 0xc9, 0x94, 0xe6,
+    0x0f, 0xa5, 0x91, 0x53, 0x05, 0x89, 0x42, 0x24, 0xd9, 0xcb, 0x02, 0xfe,
+    0x01, 0x3c, 0xcb, 0x02, 0x24, 0xe5, 0x50, 0x01, 0x4b, 0x42, 0x24, 0xeb,
+    0xc3, 0x05, 0x16, 0x0f, 0xc4, 0xe3, 0x02, 0x24, 0xf7, 0xca, 0x9b, 0x7e,
+    0x0f, 0xc4, 0xe8, 0xcf, 0x17, 0x39, 0x0f, 0xbd, 0x91, 0xd2, 0x23, 0xcb,
+    0x0f, 0xbe, 0x50, 0xc6, 0x79, 0x91, 0x0f, 0xa4, 0xe9, 0xc5, 0x00, 0x83,
+    0x0f, 0xa4, 0xc1, 0xcf, 0x61, 0xc4, 0x0f, 0x9c, 0xa0, 0xa0, 0x0d, 0x85,
+    0x41, 0x9f, 0x0d, 0x85, 0x38, 0xa0, 0x0d, 0x81, 0x09, 0x9f, 0x0d, 0x81,
+    0x00, 0xcd, 0x7a, 0x67, 0x07, 0xd8, 0xf9, 0x47, 0x03, 0x7a, 0xc2, 0x24,
+    0xfb, 0xc7, 0xc1, 0xb2, 0x00, 0x2f, 0x88, 0x46, 0x00, 0x91, 0x42, 0x25,
+    0x07, 0x46, 0x00, 0x91, 0x42, 0x25, 0x13, 0x46, 0x00, 0x91, 0x42, 0x25,
+    0x1f, 0x46, 0x00, 0x91, 0x42, 0x25, 0x2b, 0xc2, 0x03, 0x4f, 0x00, 0x2f,
+    0x53, 0x02, 0x25, 0x37, 0xc4, 0xd6, 0xad, 0x00, 0x2f, 0x33, 0x02, 0x25,
+    0x3d, 0xc2, 0x00, 0x3f, 0x00, 0x2e, 0xc2, 0x02, 0x25, 0x43, 0xc3, 0x11,
+    0x9a, 0x00, 0x2f, 0x4b, 0x02, 0x25, 0x49, 0xc5, 0xd9, 0x0e, 0x00, 0x2f,
+    0x0a, 0x02, 0x25, 0x4f, 0xcc, 0x80, 0xe8, 0x07, 0xda, 0x40, 0xcc, 0x80,
+    0xe8, 0x07, 0xda, 0x38, 0xc2, 0x00, 0x78, 0x00, 0x2f, 0x1b, 0x02, 0x25,
+    0x55, 0xc3, 0xb8, 0x25, 0x00, 0x2e, 0xd3, 0x02, 0x25, 0x5b, 0xc5, 0xd6,
+    0xac, 0x00, 0x2f, 0x29, 0xc3, 0x20, 0xb0, 0x00, 0x2e, 0xf9, 0xc3, 0x03,
+    0xb0, 0x00, 0x2e, 0xe8, 0xcc, 0x80, 0xe8, 0x07, 0xda, 0x00, 0xcc, 0x80,
+    0xe8, 0x07, 0xd9, 0xf0, 0xcc, 0x80, 0xe8, 0x07, 0xd9, 0xe0, 0x46, 0x00,
+    0x91, 0x42, 0x25, 0x61, 0xcc, 0x80, 0xe8, 0x07, 0xd9, 0xb0, 0xcb, 0x93,
+    0xfd, 0x07, 0xd9, 0xa1, 0x96, 0x00, 0x2e, 0xb8, 0xcc, 0x80, 0xe8, 0x07,
+    0xd9, 0x98, 0xcc, 0x80, 0xe8, 0x07, 0xd9, 0x90, 0x0e, 0xc2, 0x25, 0x6d,
+    0xc3, 0x16, 0xc8, 0x00, 0x2f, 0x10, 0xc3, 0x25, 0x16, 0x07, 0xd9, 0x41,
+    0xc4, 0x5a, 0xd2, 0x07, 0xd9, 0x39, 0xc9, 0xb2, 0x7c, 0x07, 0xd9, 0x31,
+    0xc5, 0x9a, 0x43, 0x07, 0xd9, 0x29, 0xc3, 0xb8, 0x25, 0x07, 0xd9, 0x21,
+    0xc2, 0x00, 0x61, 0x07, 0xd9, 0x19, 0xc5, 0x46, 0x53, 0x07, 0xd9, 0x11,
+    0xc4, 0x02, 0x17, 0x07, 0xd9, 0x08, 0xc5, 0xcc, 0x69, 0x00, 0x2d, 0xc3,
+    0x02, 0x25, 0x7c, 0xc5, 0xd5, 0xe4, 0x00, 0x2d, 0xd8, 0xc6, 0x42, 0xb0,
+    0x00, 0x2e, 0x11, 0x0a, 0xc2, 0x25, 0x82, 0xc4, 0xc3, 0x71, 0x00, 0x2d,
+    0xb0, 0xc4, 0xdd, 0x7e, 0x00, 0x2d, 0xcb, 0x02, 0x25, 0x8e, 0xc4, 0xdd,
+    0x92, 0x00, 0x2d, 0xa1, 0x45, 0xab, 0x57, 0x42, 0x25, 0x94, 0xc6, 0xce,
+    0x90, 0x00, 0x2f, 0xa1, 0xc3, 0x22, 0xeb, 0x00, 0x2f, 0x98, 0xc3, 0xe5,
+    0xa4, 0x00, 0x2c, 0xc1, 0x44, 0xe2, 0xb4, 0x42, 0x25, 0xa6, 0x46, 0xce,
+    0xea, 0xc2, 0x25, 0xb2, 0xc3, 0x1f, 0xf5, 0x00, 0x2c, 0xd8, 0xc7, 0xc4,
+    0x0c, 0x00, 0x2c, 0xe8, 0xc7, 0xc3, 0xb1, 0x00, 0x2d, 0x30, 0xce, 0x71,
+    0x20, 0x02, 0x6e, 0x01, 0xcc, 0x87, 0xb4, 0x02, 0x6e, 0xe9, 0xc7, 0xc1,
+    0x03, 0x02, 0x6f, 0x88, 0x14, 0xc2, 0x25, 0xbe, 0xcc, 0x85, 0xec, 0x02,
+    0x6e, 0xe0, 0xc3, 0x06, 0xf5, 0x02, 0x6f, 0x79, 0xc7, 0xc9, 0xa7, 0x02,
+    0x6f, 0xb8, 0x12, 0xc2, 0x25, 0xca, 0xc6, 0xd2, 0x38, 0x02, 0x6e, 0xc8,
+    0xc7, 0xc0, 0x15, 0x01, 0x59, 0x19, 0xc7, 0xc1, 0x96, 0x01, 0x5e, 0x18,
+    0xc7, 0x37, 0x14, 0x00, 0x00, 0x4b, 0x02, 0x25, 0xd4, 0xc4, 0x3e, 0x8b,
+    0x01, 0x5b, 0xf0, 0x95, 0x0f, 0x9e, 0xc0, 0xc4, 0x17, 0xf7, 0x08, 0x69,
+    0xb9, 0xc2, 0x24, 0x36, 0x08, 0x69, 0xb0, 0xc3, 0x0c, 0xf7, 0x08, 0x69,
+    0xa9, 0xc3, 0x04, 0xa0, 0x08, 0x69, 0xa0, 0xc4, 0x03, 0xe0, 0x08, 0x69,
+    0x99, 0xc2, 0x01, 0xa2, 0x08, 0x69, 0x90, 0xc3, 0x0d, 0x25, 0x08, 0x69,
+    0x39, 0xc2, 0x03, 0x83, 0x08, 0x69, 0x31, 0xc4, 0x6b, 0xc5, 0x08, 0x69,
+    0x28, 0xc2, 0x1a, 0x18, 0x08, 0x68, 0xd9, 0xc2, 0x00, 0xeb, 0x08, 0x68,
+    0xd1, 0x83, 0x08, 0x68, 0xa8, 0x45, 0xdb, 0x43, 0xc2, 0x25, 0xd8, 0x83,
+    0x08, 0x68, 0x89, 0xc2, 0x00, 0xce, 0x08, 0x68, 0x40, 0xc2, 0x00, 0x3b,
+    0x08, 0x68, 0x69, 0x83, 0x08, 0x68, 0x60, 0xc2, 0x0e, 0x60, 0x08, 0x68,
+    0x59, 0x83, 0x08, 0x68, 0x50, 0xc2, 0x00, 0x51, 0x08, 0x68, 0x21, 0x83,
+    0x08, 0x68, 0x18, 0x83, 0x08, 0x68, 0x79, 0xc2, 0x00, 0xce, 0x08, 0x68,
+    0x80, 0x83, 0x00, 0xb9, 0x41, 0xc2, 0x00, 0xeb, 0x00, 0xb9, 0x28, 0xc5,
+    0xd4, 0x7c, 0x00, 0x88, 0x2b, 0x02, 0x25, 0xe4, 0x15, 0xc2, 0x25, 0xe8,
+    0xc5, 0x98, 0x2e, 0x00, 0x88, 0x93, 0x02, 0x25, 0xf7, 0x12, 0xc2, 0x25,
+    0xfd, 0xc5, 0xbe, 0x8b, 0x00, 0x88, 0x5b, 0x02, 0x26, 0x15, 0xc5, 0xdb,
+    0x5c, 0x00, 0x88, 0x33, 0x02, 0x26, 0x19, 0x16, 0xc2, 0x26, 0x1d, 0x0d,
+    0xc2, 0x26, 0x2c, 0xc5, 0xda, 0xcb, 0x00, 0x88, 0x13, 0x02, 0x26, 0x41,
+    0x05, 0xc2, 0x26, 0x45, 0x42, 0x0d, 0x1e, 0xc2, 0x26, 0x5a, 0xc6, 0x22,
+    0x0f, 0x00, 0x8a, 0xf8, 0x49, 0xad, 0x00, 0xc2, 0x26, 0x66, 0x49, 0xaa,
+    0x42, 0x42, 0x26, 0x9d, 0x0d, 0xc2, 0x26, 0xe4, 0x15, 0xc2, 0x26, 0xf9,
+    0xc5, 0xda, 0xcb, 0x01, 0x89, 0xa3, 0x02, 0x27, 0x08, 0x16, 0xc2, 0x27,
+    0x0c, 0xc5, 0xd4, 0x7c, 0x01, 0x89, 0xcb, 0x02, 0x27, 0x18, 0xc5, 0xdb,
+    0x5c, 0x01, 0x8a, 0x0b, 0x02, 0x27, 0x1c, 0x12, 0xc2, 0x27, 0x20, 0x8b,
+    0x01, 0x8b, 0x1b, 0x02, 0x27, 0x35, 0x05, 0xc2, 0x27, 0x3b, 0xc5, 0x98,
+    0x2e, 0x01, 0x8a, 0x71, 0x83, 0x01, 0x8a, 0x7b, 0x02, 0x27, 0x47, 0x1b,
+    0xc2, 0x27, 0x54, 0x87, 0x01, 0x8a, 0xa3, 0x02, 0x27, 0x74, 0x91, 0x01,
+    0x8a, 0xbb, 0x02, 0x27, 0x7c, 0x19, 0xc2, 0x27, 0x80, 0x97, 0x01, 0x8a,
+    0xe0, 0x19, 0xc2, 0x27, 0x92, 0x0a, 0xc2, 0x27, 0x9c, 0xc2, 0x00, 0x79,
+    0x01, 0x81, 0xc0, 0xc3, 0x04, 0xa0, 0x01, 0x81, 0x21, 0xc3, 0x0c, 0xf7,
+    0x01, 0x81, 0x28, 0xc2, 0x24, 0x36, 0x01, 0x81, 0x31, 0xc4, 0x17, 0xf7,
+    0x01, 0x81, 0x38, 0xc8, 0x0c, 0xe6, 0x08, 0x47, 0xf8, 0xc5, 0x26, 0x6c,
+    0x08, 0x47, 0xf1, 0xc2, 0x00, 0x79, 0x08, 0x47, 0xe8, 0xc2, 0x2f, 0x05,
+    0x08, 0x47, 0xa9, 0xc3, 0x0a, 0xc8, 0x08, 0x47, 0x40, 0xc3, 0x11, 0x9a,
+    0x08, 0x47, 0xa1, 0x03, 0x42, 0x27, 0xa8, 0xc2, 0x14, 0xdf, 0x08, 0x47,
+    0x79, 0xc4, 0x35, 0x13, 0x08, 0x47, 0x00, 0xc2, 0x00, 0x60, 0x08, 0x47,
+    0x38, 0x19, 0xc2, 0x27, 0xb4, 0x15, 0xc2, 0x27, 0xbc, 0x83, 0x07, 0xfb,
+    0x89, 0x8b, 0x07, 0xfb, 0x91, 0x97, 0x07, 0xfb, 0x99, 0x87, 0x07, 0xfb,
+    0xa1, 0x91, 0x07, 0xfb, 0xa9, 0x0d, 0xc2, 0x27, 0xd6, 0x16, 0xc2, 0x27,
+    0xea, 0x90, 0x07, 0xfc, 0xeb, 0x02, 0x27, 0xfe, 0x0a, 0xc2, 0x28, 0x12,
+    0x0f, 0xc2, 0x28, 0x26, 0x1b, 0xc2, 0x28, 0x3a, 0x14, 0x42, 0x28, 0x46,
+    0xc5, 0x91, 0x22, 0x07, 0xfd, 0x0b, 0x02, 0x28, 0x5a, 0xc6, 0xb7, 0xd2,
+    0x07, 0xfd, 0xd8, 0x44, 0x5f, 0x39, 0xc2, 0x28, 0x60, 0xc3, 0x3e, 0xb1,
+    0x07, 0xfd, 0xa8, 0x1e, 0x42, 0x28, 0x7e, 0xc4, 0x80, 0x06, 0x07, 0xfd,
+    0x93, 0x02, 0x28, 0xa0, 0xc6, 0xb4, 0xea, 0x07, 0xfd, 0xe8, 0xc4, 0xbe,
+    0x8c, 0x07, 0xfd, 0xb8, 0xc4, 0xbf, 0x92, 0x07, 0xfd, 0xc1, 0xc6, 0xbf,
+    0x91, 0x07, 0xfd, 0xd0, 0xc6, 0xc0, 0x9b, 0x07, 0xfd, 0xe1, 0xc5, 0xc0,
+    0x64, 0x07, 0xfd, 0x38, 0x87, 0x07, 0xfe, 0x18, 0x83, 0x07, 0xfe, 0x23,
+    0x02, 0x28, 0xa6, 0x87, 0x07, 0xfe, 0x5b, 0x02, 0x28, 0xaa, 0x91, 0x07,
+    0xfe, 0x91, 0x97, 0x07, 0xfe, 0xb9, 0x8b, 0x07, 0xfe, 0xd8, 0x91, 0x07,
+    0xfe, 0x31, 0x97, 0x07, 0xfe, 0xd0, 0x87, 0x07, 0xfe, 0x78, 0x83, 0x07,
+    0xfe, 0x6b, 0x02, 0x28, 0xae, 0x87, 0x07, 0xfe, 0xab, 0x02, 0x28, 0xb2,
+    0x8b, 0x07, 0xfe, 0xb0, 0x1e, 0x42, 0x28, 0xb6, 0xc2, 0x0d, 0x1e, 0x0d,
+    0x80, 0x09, 0xc2, 0x4c, 0x38, 0x0d, 0x88, 0xf8, 0x19, 0xc2, 0x28, 0xc2,
+    0x83, 0x01, 0x82, 0x09, 0x8b, 0x01, 0x82, 0x19, 0x97, 0x01, 0x82, 0x29,
+    0x87, 0x01, 0x82, 0x39, 0x91, 0x01, 0x82, 0x49, 0xc2, 0x00, 0x16, 0x01,
+    0x83, 0x19, 0x1b, 0xc2, 0x28, 0xd2, 0x0d, 0x42, 0x28, 0xde, 0xcd, 0x79,
+    0xf2, 0x0f, 0xdc, 0xb1, 0xc5, 0x01, 0x64, 0x0f, 0xdd, 0x88, 0xe0, 0x05,
+    0x89, 0x0f, 0xdd, 0xa0, 0xc5, 0x65, 0x34, 0x01, 0x11, 0xf1, 0xc9, 0xb2,
+    0x4f, 0x01, 0x72, 0x2a, 0x02, 0x28, 0xe6, 0xc6, 0xcc, 0xce, 0x07, 0xff,
+    0xc9, 0xc9, 0x1b, 0x40, 0x07, 0xff, 0xd1, 0xca, 0x7c, 0x4b, 0x07, 0xff,
+    0xd8, 0x45, 0x00, 0x92, 0xc2, 0x28, 0xec, 0x46, 0x00, 0xd2, 0xc2, 0x28,
+    0xfe, 0x43, 0x14, 0x87, 0x42, 0x29, 0x0a, 0x42, 0x05, 0x1f, 0xc2, 0x29,
+    0x10, 0xc7, 0x78, 0xa6, 0x01, 0x50, 0xd9, 0xcc, 0x07, 0xdd, 0x01, 0x50,
+    0xc9, 0xca, 0xa6, 0x1e, 0x01, 0x50, 0xc1, 0xd9, 0x1e, 0x84, 0x01, 0x50,
+    0xb9, 0xcd, 0x7b, 0xe0, 0x01, 0x50, 0x70, 0xd6, 0x2c, 0x88, 0x01, 0x50,
+    0xa9, 0xd1, 0x53, 0xaa, 0x01, 0x50, 0x78, 0xc3, 0x05, 0x16, 0x08, 0x5b,
+    0xc3, 0x02, 0x29, 0x1c, 0x16, 0xc2, 0x29, 0x20, 0xc4, 0x04, 0x9f, 0x08,
+    0x5b, 0xd8, 0x16, 0xc2, 0x29, 0x30, 0x15, 0xc2, 0x29, 0x3c, 0xc2, 0x00,
+    0x78, 0x08, 0x5b, 0x79, 0xc3, 0x20, 0xb0, 0x08, 0x5b, 0x69, 0xc8, 0xb5,
+    0x08, 0x08, 0x5b, 0x61, 0xc6, 0xd0, 0xf4, 0x08, 0x5b, 0x59, 0xc4, 0xe0,
+    0x58, 0x08, 0x5b, 0x51, 0xc4, 0x4e, 0x09, 0x08, 0x5b, 0x49, 0xc2, 0x00,
+    0x61, 0x08, 0x5b, 0x23, 0x02, 0x29, 0x46, 0xc5, 0x4e, 0x03, 0x08, 0x5b,
+    0x31, 0xcd, 0x76, 0xe6, 0x08, 0x5b, 0x29, 0xc6, 0x46, 0x53, 0x08, 0x5b,
+    0x19, 0xc5, 0x9b, 0xd8, 0x08, 0x5b, 0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x5b,
+    0x09, 0xc5, 0x9f, 0x89, 0x08, 0x5b, 0x00, 0xc3, 0x05, 0x16, 0x08, 0x5a,
+    0xc3, 0x02, 0x29, 0x4c, 0x16, 0xc2, 0x29, 0x50, 0xc4, 0x04, 0x9f, 0x08,
+    0x5a, 0xd8, 0x16, 0xc2, 0x29, 0x60, 0x15, 0xc2, 0x29, 0x6c, 0xc4, 0x5a,
+    0xd2, 0x08, 0x5a, 0x99, 0xc3, 0x03, 0xb0, 0x08, 0x5a, 0x61, 0xc6, 0xd0,
+    0xf4, 0x08, 0x5a, 0x59, 0xc4, 0xe0, 0x58, 0x08, 0x5a, 0x51, 0xc4, 0x4e,
+    0x09, 0x08, 0x5a, 0x49, 0xc2, 0x00, 0x61, 0x08, 0x5a, 0x23, 0x02, 0x29,
+    0x76, 0xc5, 0x4e, 0x03, 0x08, 0x5a, 0x31, 0xc3, 0x76, 0xe6, 0x08, 0x5a,
+    0x29, 0xc6, 0x46, 0x53, 0x08, 0x5a, 0x19, 0xc5, 0x9b, 0xd8, 0x08, 0x5a,
+    0x11, 0xc4, 0xe0, 0x9c, 0x08, 0x5a, 0x09, 0x03, 0xc2, 0x29, 0x7c, 0xc3,
+    0x20, 0xb0, 0x08, 0x5a, 0x69, 0xc2, 0x00, 0x78, 0x08, 0x5a, 0x81, 0xc4,
+    0xb5, 0x0c, 0x08, 0x5a, 0x90, 0xc4, 0x04, 0x9f, 0x00, 0x00, 0xe1, 0x16,
+    0xc2, 0x29, 0x88, 0xc3, 0x05, 0x16, 0x00, 0x00, 0xf8, 0xce, 0x06, 0x75,
+    0x0f, 0x65, 0x79, 0x44, 0x05, 0x16, 0x42, 0x29, 0x94, 0x49, 0x41, 0xe5,
+    0xc2, 0x29, 0xa0, 0xc5, 0xda, 0xb7, 0x0f, 0x65, 0x0b, 0x02, 0x29, 0xbe,
+    0xc4, 0x44, 0x3c, 0x0f, 0x64, 0xf3, 0x02, 0x29, 0xc4, 0xc4, 0x28, 0x74,
+    0x0f, 0x63, 0xcb, 0x02, 0x29, 0xca, 0xc5, 0x0a, 0xfd, 0x0f, 0x63, 0xc3,
+    0x02, 0x29, 0xd7, 0x15, 0xc2, 0x29, 0xe2, 0x08, 0xc2, 0x29, 0xf4, 0x16,
+    0xc2, 0x29, 0xfc, 0xc3, 0x05, 0x16, 0x0f, 0x63, 0x8b, 0x02, 0x2a, 0x0d,
+    0x4a, 0x0d, 0x48, 0x42, 0x2a, 0x11, 0xc3, 0x0c, 0xf7, 0x0e, 0x9b, 0xb1,
+    0xc3, 0x04, 0xa0, 0x0e, 0x9b, 0xa8, 0xc4, 0x03, 0xe0, 0x0e, 0x9b, 0xa1,
+    0xc2, 0x01, 0xa2, 0x0e, 0x9b, 0x98, 0x0c, 0xc2, 0x2a, 0x1b, 0xc8, 0xbf,
+    0x20, 0x01, 0x96, 0x09, 0x42, 0x00, 0xb6, 0xc2, 0x2a, 0x25, 0x03, 0xc2,
+    0x2a, 0x2f, 0xc9, 0xa9, 0xf1, 0x01, 0x96, 0x41, 0xc7, 0xc1, 0x8f, 0x01,
+    0x96, 0x49, 0xc8, 0xb6, 0x30, 0x01, 0x96, 0x51, 0x06, 0xc2, 0x2a, 0x3b,
+    0x45, 0xdd, 0xe1, 0x42, 0x2a, 0x47, 0xc5, 0x00, 0x64, 0x01, 0x7f, 0x81,
+    0xd0, 0x5c, 0x02, 0x01, 0x7f, 0x90, 0xc5, 0x01, 0x24, 0x01, 0x7f, 0x89,
+    0xd0, 0x5d, 0xb2, 0x01, 0x7f, 0x98, 0xc5, 0x00, 0xd2, 0x01, 0x7f, 0xa9,
+    0xc5, 0x01, 0x24, 0x01, 0x7f, 0xb1, 0x0e, 0xc2, 0x2a, 0x6c, 0x46, 0x06,
+    0x50, 0x42, 0x2a, 0x78, 0xc8, 0xb8, 0x08, 0x01, 0x8c, 0xa1, 0xc8, 0xb7,
+    0x98, 0x01, 0x8c, 0xd8, 0xc5, 0x01, 0x64, 0x01, 0x8c, 0xa9, 0xc7, 0x35,
+    0x70, 0x01, 0x8c, 0xe0, 0xc2, 0x00, 0x79, 0x08, 0x42, 0xdb, 0x02, 0x2a,
+    0x84, 0x19, 0xc2, 0x2a, 0x8a, 0xc4, 0x03, 0xe0, 0x08, 0x42, 0xd0, 0x01,
+    0x42, 0x2a, 0x94, 0xc2, 0x2f, 0x05, 0x08, 0x42, 0xa9, 0xc3, 0x0a, 0xc8,
+    0x08, 0x42, 0x40, 0xc3, 0x11, 0x9a, 0x08, 0x42, 0xa1, 0x03, 0x42, 0x2a,
+    0xa0, 0xc3, 0x16, 0xc8, 0x08, 0x42, 0x79, 0xc4, 0x35, 0x13, 0x08, 0x42,
+    0x00, 0xc2, 0x00, 0x60, 0x08, 0x42, 0x38, 0x95, 0x05, 0x5c, 0xeb, 0x02,
+    0x2a, 0xac, 0x42, 0x00, 0xe5, 0xc2, 0x2a, 0xc4, 0x10, 0xc2, 0x2a, 0xdc,
+    0x91, 0x05, 0x5b, 0x99, 0x1b, 0xc2, 0x2a, 0xf7, 0x8b, 0x05, 0x5b, 0x91,
+    0x87, 0x05, 0x5b, 0x89, 0x83, 0x05, 0x5b, 0x81, 0x97, 0x05, 0x5b, 0xa1,
+    0x98, 0x05, 0x5b, 0xa9, 0x0f, 0xc2, 0x2b, 0x0f, 0x09, 0xc2, 0x2b, 0x27,
+    0xc2, 0x02, 0x4d, 0x05, 0x5b, 0xb9, 0x0a, 0xc2, 0x2b, 0x3f, 0x0e, 0xc2,
+    0x2b, 0x5d, 0x06, 0xc2, 0x2b, 0x75, 0x16, 0xc2, 0x2b, 0x93, 0x19, 0x42,
+    0x2b, 0xa7, 0x0f, 0xc2, 0x2b, 0xbf, 0x1b, 0xc2, 0x2b, 0xd7, 0x19, 0xc2,
+    0x2b, 0xef, 0x16, 0xc2, 0x2c, 0x07, 0x83, 0x00, 0x9d, 0x01, 0x87, 0x00,
+    0x9d, 0x09, 0x8b, 0x00, 0x9d, 0x11, 0x91, 0x00, 0x9d, 0x19, 0x97, 0x00,
+    0x9d, 0x21, 0x98, 0x00, 0x9d, 0x29, 0x09, 0xc2, 0x2c, 0x1b, 0xc2, 0x02,
+    0x4d, 0x00, 0x9d, 0x39, 0x0a, 0xc2, 0x2c, 0x33, 0x0e, 0xc2, 0x2c, 0x51,
+    0x10, 0xc2, 0x2c, 0x69, 0x42, 0x00, 0xe5, 0xc2, 0x2c, 0x84, 0x95, 0x00,
+    0x9e, 0x6b, 0x02, 0x2c, 0x9c, 0x06, 0x42, 0x2c, 0xb4, 0x01, 0x42, 0x2c,
+    0xd2, 0xcd, 0x7f, 0xa2, 0x0f, 0xa5, 0xc8, 0xc3, 0x3a, 0xec, 0x08, 0x8a,
+    0x21, 0xc2, 0x12, 0x99, 0x08, 0x89, 0x18, 0xc2, 0x12, 0x99, 0x08, 0x89,
+    0x09, 0xc3, 0xa8, 0xb0, 0x08, 0x89, 0x00, 0xc3, 0x3a, 0xec, 0x08, 0x88,
+    0xf1, 0xc2, 0x12, 0x99, 0x08, 0x88, 0xe8, 0xc3, 0x3a, 0xec, 0x08, 0x88,
+    0xe1, 0xc2, 0x12, 0x99, 0x08, 0x88, 0xd8, 0xc2, 0x12, 0x99, 0x08, 0x88,
+    0xd1, 0xc3, 0x3a, 0x98, 0x08, 0x88, 0xa9, 0xc3, 0xa8, 0xb0, 0x08, 0x88,
+    0x81, 0xc3, 0x56, 0x97, 0x08, 0x88, 0x58, 0xc3, 0x3a, 0xec, 0x08, 0x88,
+    0xc9, 0xc2, 0x12, 0x99, 0x08, 0x88, 0xc1, 0x06, 0x42, 0x2c, 0xde, 0xc3,
+    0x3a, 0xec, 0x08, 0x88, 0xb9, 0xc2, 0x12, 0x99, 0x08, 0x88, 0xb1, 0x16,
+    0x42, 0x2c, 0xea, 0xc3, 0x3a, 0xec, 0x08, 0x88, 0x79, 0xc2, 0x12, 0x99,
+    0x08, 0x88, 0x70, 0xc3, 0x3a, 0xec, 0x08, 0x88, 0x69, 0xc2, 0x12, 0x99,
+    0x08, 0x88, 0x60, 0xc3, 0x3a, 0xec, 0x08, 0x88, 0x51, 0xc2, 0x12, 0x99,
+    0x08, 0x88, 0x48, 0xc3, 0x3a, 0xec, 0x08, 0x88, 0x41, 0xc2, 0x12, 0x99,
+    0x08, 0x88, 0x38, 0x87, 0x08, 0x89, 0x63, 0x02, 0x2c, 0xf6, 0x83, 0x08,
+    0x89, 0x3b, 0x02, 0x2c, 0xfa, 0x91, 0x08, 0x89, 0x73, 0x02, 0x2d, 0x06,
+    0x97, 0x08, 0x89, 0x53, 0x02, 0x2d, 0x0a, 0x8b, 0x08, 0x89, 0x42, 0x02,
+    0x2d, 0x0e, 0xc4, 0x28, 0x74, 0x08, 0x89, 0xf9, 0xc5, 0x0a, 0xfd, 0x08,
+    0x89, 0xf1, 0x15, 0xc2, 0x2d, 0x12, 0x08, 0xc2, 0x2d, 0x1e, 0x16, 0xc2,
+    0x2d, 0x2a, 0xc3, 0x05, 0x16, 0x08, 0x89, 0xb9, 0xc4, 0x18, 0xa7, 0x08,
+    0x89, 0xb0, 0xc7, 0x40, 0xae, 0x08, 0x88, 0x11, 0xc8, 0x14, 0x02, 0x08,
+    0x88, 0x09, 0xcb, 0x1f, 0xe9, 0x08, 0x88, 0x00, 0x8a, 0x05, 0x52, 0x69,
+    0x8f, 0x05, 0x52, 0x61, 0xc2, 0x00, 0xb2, 0x05, 0x52, 0x18, 0x87, 0x05,
+    0x51, 0x90, 0x97, 0x05, 0x51, 0x89, 0x8b, 0x05, 0x51, 0x81, 0x83, 0x05,
+    0x51, 0x48, 0x87, 0x05, 0x51, 0x70, 0x8b, 0x05, 0x51, 0x58, 0x83, 0x05,
+    0x51, 0x39, 0xc2, 0x0d, 0x01, 0x05, 0x51, 0x30, 0x09, 0xc2, 0x2d, 0x36,
+    0x83, 0x05, 0x50, 0xc1, 0xc2, 0x0e, 0x21, 0x05, 0x50, 0xb9, 0x0a, 0x42,
+    0x2d, 0x40, 0xc2, 0x00, 0xce, 0x05, 0x50, 0x49, 0x83, 0x05, 0x50, 0x40,
+    0xc2, 0x00, 0xce, 0x05, 0x50, 0x39, 0x83, 0x05, 0x50, 0x30, 0x8b, 0x05,
+    0x50, 0x20, 0xc2, 0x00, 0xca, 0x05, 0x52, 0x59, 0x8e, 0x05, 0x52, 0x51,
+    0x94, 0x05, 0x52, 0x49, 0x9b, 0x05, 0x52, 0x41, 0x92, 0x05, 0x52, 0x39,
+    0x90, 0x05, 0x52, 0x33, 0x02, 0x2d, 0x50, 0x96, 0x05, 0x52, 0x29, 0xc2,
+    0x11, 0x99, 0x05, 0x52, 0x21, 0x89, 0x05, 0x52, 0x09, 0x8d, 0x05, 0x52,
+    0x00, 0xc2, 0x00, 0xa0, 0x05, 0x51, 0x09, 0x83, 0x05, 0x50, 0xe9, 0xc2,
+    0x00, 0xce, 0x05, 0x50, 0xf0, 0x83, 0x05, 0x51, 0x01, 0xc2, 0x0e, 0x21,
+    0x05, 0x50, 0xf8, 0xc2, 0x00, 0xce, 0x05, 0x50, 0xe1, 0xc2, 0x04, 0xf2,
+    0x05, 0x50, 0xd9, 0x83, 0x05, 0x50, 0xd0, 0xc2, 0x0e, 0x60, 0x05, 0x50,
+    0xc9, 0xc2, 0x00, 0xce, 0x05, 0x50, 0xb1, 0x83, 0x05, 0x50, 0xa8, 0xc2,
+    0x00, 0xce, 0x05, 0x50, 0xa1, 0x83, 0x05, 0x50, 0x98, 0xc2, 0x00, 0xce,
+    0x05, 0x50, 0x79, 0x83, 0x05, 0x50, 0x70, 0xc2, 0x00, 0xce, 0x05, 0x50,
+    0x69, 0x83, 0x05, 0x50, 0x60, 0xcb, 0x8c, 0xe6, 0x05, 0x52, 0xf1, 0xc4,
+    0x19, 0xf1, 0x05, 0x52, 0xe8, 0xc4, 0x17, 0xf7, 0x05, 0x52, 0xb9, 0xc2,
+    0x24, 0x36, 0x05, 0x52, 0xb0, 0xc3, 0x0c, 0xf7, 0x05, 0x52, 0xa9, 0xc3,
+    0x04, 0xa0, 0x05, 0x52, 0xa0, 0xc4, 0x03, 0xe0, 0x05, 0x52, 0x99, 0xc2,
+    0x01, 0xa2, 0x05, 0x52, 0x90, 0xc8, 0x0c, 0xe6, 0x08, 0x7e, 0x58, 0x19,
+    0xc2, 0x2d, 0x54, 0xc2, 0x00, 0x79, 0x08, 0x7e, 0x49, 0xc4, 0x03, 0xe0,
+    0x08, 0x7e, 0x38, 0xc3, 0x11, 0x9a, 0x08, 0x7e, 0x19, 0xca, 0x9f, 0x84,
+    0x08, 0x7d, 0x89, 0xc5, 0xd9, 0x0e, 0x08, 0x7d, 0xf8, 0xc2, 0x00, 0x60,
+    0x08, 0x7d, 0xc8, 0xc4, 0x35, 0x13, 0x08, 0x7d, 0x81, 0xc3, 0x16, 0xc8,
+    0x08, 0x7e, 0x00, 0xc9, 0xaf, 0x49, 0x01, 0x31, 0x49, 0xc8, 0xba, 0xa0,
+    0x01, 0x31, 0x40, 0xc5, 0xca, 0xa7, 0x0f, 0xaa, 0x13, 0x02, 0x2d, 0x5e,
+    0x4a, 0x9d, 0x90, 0x42, 0x2d, 0x64, 0xe0, 0x09, 0x29, 0x0f, 0x8c, 0x50,
+    0xc3, 0x17, 0x0c, 0x70, 0x03, 0xf9, 0xc9, 0x19, 0x59, 0x00, 0x04, 0xa0,
+    0x83, 0x08, 0xd5, 0xf9, 0x91, 0x08, 0xd5, 0xf1, 0x8b, 0x08, 0xd5, 0xe9,
+    0x87, 0x08, 0xd5, 0xe0, 0x9b, 0x00, 0xc5, 0xfb, 0x02, 0x2d, 0x70, 0x83,
+    0x00, 0xa7, 0xaa, 0x02, 0x2d, 0x76, 0x19, 0xc2, 0x2d, 0x7a, 0x83, 0x00,
+    0xa8, 0xab, 0x02, 0x2d, 0x93, 0x91, 0x00, 0xa8, 0x9b, 0x02, 0x2d, 0x9b,
+    0x8b, 0x00, 0xa8, 0x8b, 0x02, 0x2d, 0xa3, 0x87, 0x00, 0xa8, 0x80, 0x9b,
+    0x00, 0xc5, 0xf1, 0x91, 0x00, 0xa7, 0x91, 0x4c, 0x8a, 0x0c, 0x42, 0x2d,
+    0xa7, 0x83, 0x00, 0xa8, 0x03, 0x02, 0x2d, 0xbf, 0x91, 0x00, 0xa7, 0xe3,
+    0x02, 0x2d, 0xc3, 0x8b, 0x00, 0xa7, 0xc3, 0x02, 0x2d, 0xc7, 0x87, 0x00,
+    0xa7, 0xb0, 0x8b, 0x00, 0xa7, 0x80, 0x47, 0xc8, 0xf8, 0xc2, 0x2d, 0xcb,
+    0x9b, 0x00, 0xc5, 0xe1, 0x46, 0xd2, 0xe0, 0xc2, 0x2d, 0xd5, 0x83, 0x00,
+    0xa6, 0x42, 0x02, 0x2e, 0x01, 0x91, 0x00, 0xc6, 0x53, 0x02, 0x2e, 0x05,
+    0x8b, 0x00, 0xc6, 0x33, 0x02, 0x2e, 0x09, 0x87, 0x00, 0xa6, 0x49, 0x83,
+    0x00, 0xa6, 0x5a, 0x02, 0x2e, 0x0d, 0x9b, 0x00, 0xc5, 0xd9, 0x91, 0x00,
+    0xa6, 0x28, 0x83, 0x00, 0xb3, 0xab, 0x02, 0x2e, 0x11, 0x91, 0x00, 0xb3,
+    0x9b, 0x02, 0x2e, 0x15, 0x8b, 0x00, 0xb3, 0x8a, 0x02, 0x2e, 0x19, 0x83,
+    0x00, 0xac, 0x9b, 0x02, 0x2e, 0x1d, 0x91, 0x00, 0xac, 0x8b, 0x02, 0x2e,
+    0x28, 0x8b, 0x00, 0xac, 0x7a, 0x02, 0x2e, 0x2c, 0xc4, 0x4a, 0xda, 0x00,
+    0xab, 0xe1, 0xc4, 0xdf, 0x20, 0x00, 0xab, 0xda, 0x02, 0x2e, 0x30, 0x8b,
+    0x00, 0xab, 0x0b, 0x02, 0x2e, 0x49, 0x87, 0x00, 0xaa, 0xf8, 0x8b, 0x00,
+    0xa6, 0x18, 0x46, 0x68, 0x75, 0xc2, 0x2e, 0x4d, 0x83, 0x00, 0xa4, 0x8a,
+    0x02, 0x2e, 0xa5, 0x8b, 0x00, 0xa4, 0x60, 0x91, 0x00, 0xa4, 0x70, 0x87,
+    0x00, 0xa4, 0x91, 0x8b, 0x00, 0xa4, 0xa3, 0x02, 0x2e, 0xa9, 0x91, 0x00,
+    0xa4, 0xc3, 0x02, 0x2e, 0xad, 0x83, 0x00, 0xa4, 0xe2, 0x02, 0x2e, 0xb1,
+    0x94, 0x00, 0xc7, 0xa1, 0x8e, 0x00, 0xc7, 0x98, 0x99, 0x00, 0xb3, 0xfb,
+    0x02, 0x2e, 0xb5, 0x0d, 0xc2, 0x2e, 0xc5, 0x10, 0xc2, 0x2e, 0xd5, 0x83,
+    0x00, 0xad, 0x99, 0x91, 0x00, 0xad, 0x91, 0x8b, 0x00, 0xad, 0x89, 0x87,
+    0x00, 0xad, 0x81, 0x95, 0x00, 0xa8, 0x40, 0x91, 0x00, 0xac, 0x43, 0x02,
+    0x2e, 0xe5, 0xc2, 0x00, 0x2b, 0x00, 0xc7, 0x41, 0x83, 0x00, 0xac, 0x49,
+    0x8b, 0x00, 0xac, 0x39, 0x87, 0x00, 0xac, 0x30, 0x8a, 0x00, 0xab, 0x7b,
+    0x02, 0x2e, 0xe9, 0x87, 0x00, 0xa3, 0x39, 0x8b, 0x00, 0xa3, 0x41, 0x91,
+    0x00, 0xa3, 0x49, 0x83, 0x00, 0xa3, 0x50, 0x19, 0xc2, 0x2f, 0x05, 0xc8,
+    0xb7, 0xd8, 0x00, 0xad, 0x73, 0x02, 0x2f, 0x10, 0x83, 0x00, 0xab, 0x33,
+    0x02, 0x2f, 0x29, 0x91, 0x00, 0xab, 0x23, 0x02, 0x2f, 0x2d, 0x8b, 0x00,
+    0xab, 0x03, 0x02, 0x2f, 0x31, 0x87, 0x00, 0xaa, 0xf0, 0x9b, 0x00, 0xc5,
+    0xb9, 0x83, 0x00, 0xa2, 0xb2, 0x02, 0x2f, 0x35, 0x83, 0x00, 0xab, 0x99,
+    0x91, 0x00, 0xab, 0x91, 0x8b, 0x00, 0xab, 0x89, 0x87, 0x00, 0xab, 0x80,
+    0x91, 0x00, 0xa2, 0xeb, 0x02, 0x2f, 0x39, 0x8b, 0x00, 0xa2, 0xcb, 0x02,
+    0x2f, 0x3d, 0x87, 0x00, 0xa2, 0xb9, 0x83, 0x00, 0xa3, 0x0a, 0x02, 0x2f,
+    0x41, 0x91, 0x00, 0xa2, 0x88, 0x8b, 0x00, 0xa2, 0x78, 0x42, 0x00, 0x15,
+    0x42, 0x2f, 0x45, 0x9b, 0x00, 0xc5, 0x99, 0x83, 0x00, 0xa0, 0xc8, 0x91,
+    0x00, 0xa0, 0xa2, 0x02, 0x2f, 0x51, 0x8b, 0x00, 0xa0, 0x80, 0xc2, 0x00,
+    0x2b, 0x00, 0xc7, 0x01, 0x87, 0x00, 0xaa, 0x18, 0x83, 0x00, 0xc6, 0x9b,
+    0x02, 0x2f, 0x57, 0x91, 0x00, 0xc6, 0x8b, 0x02, 0x2f, 0x5b, 0x8b, 0x00,
+    0xc6, 0x7b, 0x02, 0x2f, 0x5f, 0xc2, 0x00, 0xc8, 0x00, 0xc6, 0x70, 0x9b,
+    0x00, 0xc6, 0x29, 0x83, 0x00, 0xaa, 0x62, 0x02, 0x2f, 0x63, 0x91, 0x00,
+    0xaa, 0x48, 0x8b, 0x00, 0xaa, 0x38, 0x44, 0x12, 0x1f, 0xc2, 0x2f, 0x67,
+    0x8b, 0x00, 0xaa, 0xb0, 0x83, 0x00, 0xaa, 0xd2, 0x02, 0x2f, 0x99, 0x91,
+    0x00, 0xaa, 0xc0, 0x95, 0x00, 0xc6, 0xd3, 0x02, 0x2f, 0x9d, 0x90, 0x00,
+    0xc6, 0xcb, 0x02, 0x2f, 0xa1, 0x8f, 0x00, 0xc6, 0xc1, 0x85, 0x00, 0xc6,
+    0xb9, 0x8d, 0x00, 0xc6, 0xb1, 0x96, 0x00, 0xc6, 0xa9, 0x92, 0x00, 0xc6,
+    0xa0, 0x9b, 0x00, 0xc6, 0x21, 0x83, 0x00, 0xa9, 0x72, 0x02, 0x2f, 0xa5,
+    0x9b, 0x00, 0xc6, 0x19, 0x91, 0x00, 0xa9, 0x58, 0x83, 0x00, 0xa9, 0xcb,
+    0x02, 0x2f, 0xa9, 0x91, 0x00, 0xa9, 0xab, 0x02, 0x2f, 0xad, 0x8b, 0x00,
+    0xa9, 0x8b, 0x02, 0x2f, 0xb1, 0x87, 0x00, 0xa9, 0x78, 0xc3, 0x4c, 0x70,
+    0x00, 0xa9, 0x61, 0xc3, 0xb9, 0x5f, 0x00, 0xa7, 0x99, 0xc3, 0x1d, 0x88,
+    0x00, 0xa2, 0x91, 0x12, 0xc2, 0x2f, 0xb5, 0x99, 0x00, 0xa0, 0xe9, 0xc2,
+    0x05, 0x37, 0x00, 0xa0, 0x39, 0xc3, 0xd9, 0x60, 0x00, 0xa3, 0x89, 0xc3,
+    0x95, 0x78, 0x00, 0xa4, 0x79, 0xc3, 0x17, 0x72, 0x00, 0xa5, 0x49, 0xc3,
+    0x11, 0x9c, 0x00, 0xa6, 0x31, 0xc3, 0x17, 0x34, 0x00, 0xa6, 0xc8, 0x8b,
+    0x00, 0xa9, 0x48, 0x9b, 0x00, 0xc5, 0xe9, 0x83, 0x00, 0xa6, 0xda, 0x02,
+    0x2f, 0xc1, 0x83, 0x00, 0xad, 0x23, 0x02, 0x2f, 0xc5, 0x91, 0x00, 0xad,
+    0x13, 0x02, 0x2f, 0xc9, 0x8b, 0x00, 0xad, 0x02, 0x02, 0x2f, 0xcd, 0x83,
+    0x00, 0xa7, 0x33, 0x02, 0x2f, 0xd1, 0x91, 0x00, 0xa7, 0x13, 0x02, 0x2f,
+    0xd5, 0x8b, 0x00, 0xa6, 0xf3, 0x02, 0x2f, 0xd9, 0x87, 0x00, 0xa6, 0xe0,
+    0x8b, 0x00, 0xa6, 0xb0, 0x91, 0x00, 0xa6, 0xc0, 0x9b, 0x00, 0xc5, 0xd1,
+    0x83, 0x00, 0xa5, 0x5a, 0x02, 0x2f, 0xdd, 0x45, 0x2c, 0x6d, 0x42, 0x2f,
+    0xe1, 0x91, 0x00, 0xa5, 0x42, 0x02, 0x2f, 0xe9, 0x8b, 0x00, 0xa5, 0x30,
+    0x87, 0x00, 0xa5, 0x61, 0x8b, 0x00, 0xa5, 0x73, 0x02, 0x2f, 0xef, 0x91,
+    0x00, 0xa5, 0x93, 0x02, 0x2f, 0xf3, 0x83, 0x00, 0xa5, 0xb2, 0x02, 0x2f,
+    0xf7, 0x83, 0x00, 0xa3, 0xf3, 0x02, 0x2f, 0xfb, 0x87, 0x00, 0xa3, 0xa1,
+    0x8b, 0x00, 0xa3, 0xb3, 0x02, 0x30, 0x03, 0x91, 0x00, 0xa3, 0xd2, 0x02,
+    0x30, 0x07, 0x9b, 0x00, 0xc5, 0xc1, 0x83, 0x00, 0xa3, 0x9a, 0x02, 0x30,
+    0x0b, 0x8b, 0x00, 0xa3, 0x70, 0x91, 0x00, 0xa3, 0x80, 0x91, 0x00, 0xa2,
+    0x03, 0x02, 0x30, 0x0f, 0x83, 0x00, 0xa2, 0x23, 0x02, 0x30, 0x17, 0x8b,
+    0x00, 0xa1, 0xe3, 0x02, 0x30, 0x1b, 0x87, 0x00, 0xa1, 0xd0, 0x9b, 0x00,
+    0xc5, 0xa9, 0x83, 0x00, 0xa1, 0xca, 0x02, 0x30, 0x1f, 0x9b, 0x00, 0xc5,
+    0xa1, 0x91, 0x00, 0xa1, 0xa0, 0x8b, 0x00, 0xa1, 0x90, 0x9b, 0x00, 0xc5,
+    0x91, 0x8b, 0x00, 0xa0, 0x10, 0xc7, 0xc0, 0x07, 0x00, 0xad, 0x78, 0x95,
+    0x00, 0xa8, 0x31, 0x8f, 0x00, 0xa5, 0xf0, 0x8b, 0x00, 0xb3, 0x79, 0x83,
+    0x00, 0xac, 0x22, 0x02, 0x30, 0x23, 0x91, 0x00, 0xac, 0x10, 0x8b, 0x00,
+    0xac, 0x00, 0x97, 0x08, 0x15, 0x22, 0x02, 0x30, 0x27, 0xa1, 0x08, 0x16,
+    0x70, 0xa2, 0x08, 0x16, 0x61, 0xa3, 0x08, 0x16, 0x69, 0xa1, 0x08, 0x16,
+    0x58, 0xa1, 0x08, 0x15, 0xb0, 0xa1, 0x08, 0x15, 0x78, 0xa1, 0x08, 0x16,
+    0x18, 0xc2, 0x03, 0x30, 0x08, 0x29, 0x81, 0xc2, 0x00, 0x4b, 0x08, 0x2a,
+    0x40, 0xc2, 0x00, 0xf0, 0x08, 0x29, 0x91, 0xc4, 0xe1, 0x10, 0x08, 0x2a,
+    0xc0, 0xc2, 0x01, 0x17, 0x08, 0x29, 0x99, 0xc3, 0x2c, 0x85, 0x08, 0x2a,
+    0x09, 0x1c, 0x42, 0x30, 0x33, 0x84, 0x08, 0x29, 0xa1, 0xc2, 0x14, 0xdf,
+    0x08, 0x29, 0xb0, 0xc3, 0x06, 0xc7, 0x08, 0x29, 0xa9, 0x0a, 0x42, 0x30,
+    0x3f, 0xc2, 0x00, 0xa6, 0x08, 0x29, 0xc1, 0xc3, 0x48, 0xd5, 0x08, 0x2a,
+    0x99, 0xc3, 0xb5, 0xb7, 0x08, 0x2a, 0xe0, 0x0a, 0xc2, 0x30, 0x49, 0x03,
+    0xc2, 0x30, 0x5a, 0x42, 0x1a, 0x18, 0x42, 0x30, 0x64, 0xc3, 0x14, 0x31,
+    0x08, 0x29, 0xd1, 0xc3, 0xe5, 0x20, 0x08, 0x2b, 0x08, 0xc2, 0x05, 0x42,
+    0x08, 0x29, 0xe1, 0xc3, 0x2c, 0x73, 0x08, 0x29, 0xf9, 0xc2, 0x04, 0x68,
+    0x08, 0x2a, 0xf0, 0x0a, 0xc2, 0x30, 0x6c, 0xc3, 0xe5, 0xce, 0x08, 0x2a,
+    0xd0, 0xc2, 0x00, 0x6b, 0x08, 0x29, 0xf1, 0xc3, 0x3f, 0xe3, 0x08, 0x2a,
+    0x28, 0xc3, 0xe6, 0x01, 0x08, 0x2a, 0x19, 0xc3, 0x2e, 0x80, 0x08, 0x2a,
+    0x88, 0xc2, 0x00, 0x72, 0x08, 0x2a, 0x21, 0xc2, 0x72, 0xe0, 0x08, 0x2b,
+    0x18, 0x9b, 0x08, 0x2a, 0x39, 0x94, 0x08, 0x2a, 0x68, 0xc2, 0x00, 0x79,
+    0x08, 0x2a, 0xb9, 0xc3, 0xb5, 0xb7, 0x08, 0x2b, 0x10, 0x08, 0xc2, 0x30,
+    0x79, 0x8b, 0x0f, 0x00, 0x5b, 0x02, 0x30, 0x85, 0x04, 0xc2, 0x30, 0x97,
+    0x1b, 0xc2, 0x30, 0xa3, 0x15, 0xc2, 0x30, 0xb5, 0xc6, 0x76, 0x6b, 0x0f,
+    0x00, 0xe9, 0x16, 0xc2, 0x30, 0xc5, 0xc4, 0x5e, 0xcf, 0x0f, 0x00, 0xc1,
+    0xc3, 0xc6, 0x83, 0x0f, 0x00, 0xb1, 0xc5, 0xd3, 0xaf, 0x0f, 0x00, 0x99,
+    0xc6, 0xca, 0x6a, 0x0f, 0x00, 0x91, 0xc3, 0x0c, 0x65, 0x0f, 0x00, 0x89,
+    0xc5, 0xda, 0x58, 0x0f, 0x00, 0x81, 0xc7, 0x62, 0x35, 0x0f, 0x00, 0x79,
+    0xc7, 0xc1, 0xff, 0x0f, 0x00, 0x71, 0xc4, 0xe0, 0x5c, 0x0f, 0x00, 0x69,
+    0x06, 0xc2, 0x30, 0xd1, 0x1c, 0xc2, 0x30, 0xdd, 0xc7, 0xc2, 0xd8, 0x0f,
+    0x00, 0x19, 0xc4, 0xde, 0x30, 0x0f, 0x00, 0x11, 0xc3, 0xe4, 0x92, 0x0f,
+    0x00, 0x00, 0x44, 0x28, 0xa3, 0xc2, 0x30, 0xe9, 0x03, 0x42, 0x31, 0x07,
+    0xc5, 0x00, 0xd2, 0x01, 0x07, 0x81, 0xc5, 0x01, 0x24, 0x00, 0x1a, 0xc8,
+    0xcc, 0x81, 0x3c, 0x01, 0x07, 0x39, 0x4c, 0x04, 0x58, 0x42, 0x31, 0x19,
+    0xc5, 0x01, 0x24, 0x00, 0xef, 0xe9, 0xc5, 0x00, 0xd2, 0x00, 0x1a, 0x60,
+    0x1e, 0xc2, 0x31, 0x25, 0x01, 0x42, 0x31, 0x31, 0x43, 0x00, 0x66, 0xc2,
+    0x31, 0x40, 0x43, 0x00, 0xb2, 0x42, 0x31, 0x48, 0x45, 0x04, 0x37, 0xc2,
+    0x31, 0x5a, 0xd2, 0x4b, 0xf1, 0x00, 0x19, 0x10, 0x01, 0xc2, 0x31, 0x66,
+    0x46, 0x00, 0x71, 0x42, 0x31, 0x82, 0x43, 0x00, 0xb2, 0xc2, 0x31, 0x8e,
+    0xc6, 0x7f, 0x4e, 0x00, 0x19, 0x90, 0x4d, 0x28, 0xa7, 0xc2, 0x31, 0x9e,
+    0x55, 0x36, 0x73, 0x42, 0x32, 0x21, 0xde, 0x0d, 0xf8, 0x00, 0xd5, 0xc9,
+    0x46, 0x1b, 0xdb, 0x42, 0x32, 0x35, 0xcc, 0x86, 0x10, 0x01, 0x07, 0x49,
+    0xd5, 0x35, 0x23, 0x00, 0xef, 0xc8, 0xc8, 0xbe, 0x90, 0x01, 0x07, 0x41,
+    0xcc, 0x87, 0x24, 0x00, 0xd6, 0x59, 0xc3, 0x01, 0xa5, 0x00, 0xd5, 0xa0,
+    0x01, 0x42, 0x32, 0x47, 0x44, 0x00, 0xda, 0xc2, 0x32, 0x5f, 0x16, 0xc2,
+    0x32, 0x69, 0x42, 0x04, 0x68, 0x42, 0x32, 0x73, 0xcb, 0x93, 0x9a, 0x00,
+    0xef, 0xd9, 0x49, 0xae, 0x68, 0x42, 0x32, 0x7f, 0xc5, 0xd7, 0x92, 0x00,
+    0xd5, 0x89, 0xc6, 0x01, 0x23, 0x00, 0x19, 0x20, 0xd8, 0x24, 0xb5, 0x01,
+    0x07, 0x21, 0xc6, 0xd2, 0xda, 0x01, 0x07, 0x19, 0x15, 0xc2, 0x32, 0x91,
+    0xc6, 0x00, 0x7c, 0x01, 0x06, 0xeb, 0x02, 0x32, 0x9d, 0xc7, 0x3f, 0x57,
+    0x01, 0x06, 0xf8, 0xcc, 0x80, 0x7c, 0x01, 0x06, 0xc9, 0xcb, 0x01, 0x7e,
+    0x01, 0x06, 0xa8, 0xcd, 0x32, 0x37, 0x00, 0x24, 0x49, 0x48, 0x0c, 0xe7,
+    0xc2, 0x32, 0xa3, 0x12, 0xc2, 0x32, 0xaf, 0xce, 0x6e, 0xd4, 0x00, 0x24,
+    0x29, 0x16, 0xc2, 0x32, 0xbf, 0x47, 0x01, 0x92, 0xc2, 0x32, 0xd4, 0xc6,
+    0x4a, 0xa1, 0x05, 0x33, 0xe1, 0xc5, 0xd8, 0x91, 0x05, 0x33, 0x78, 0xc6,
+    0x01, 0x23, 0x00, 0x19, 0x68, 0xc3, 0x01, 0x09, 0x00, 0x18, 0x63, 0x02,
+    0x33, 0x42, 0xc9, 0x1f, 0xeb, 0x00, 0x18, 0x80, 0x44, 0x04, 0x0e, 0xc2,
+    0x33, 0x48, 0xcf, 0x69, 0x71, 0x07, 0xf1, 0x32, 0x02, 0x33, 0x57, 0xd5,
+    0x31, 0xc6, 0x01, 0x06, 0x99, 0x15, 0x42, 0x33, 0x5d, 0xcd, 0x7d, 0xe8,
+    0x00, 0xd6, 0x29, 0xc4, 0x01, 0x25, 0x00, 0x19, 0xd8, 0xe0, 0x01, 0x09,
+    0x00, 0xd5, 0xd0, 0xc3, 0x0f, 0x48, 0x00, 0x18, 0x33, 0x02, 0x33, 0x69,
+    0x45, 0x35, 0x2e, 0x42, 0x33, 0x75, 0xc4, 0x00, 0x2f, 0x00, 0xef, 0xb9,
+    0xc5, 0x00, 0x64, 0x00, 0xef, 0xb0, 0xd1, 0x2f, 0x0b, 0x01, 0x84, 0xc9,
+    0xd6, 0x31, 0x42, 0x01, 0x84, 0xd0, 0x46, 0x94, 0xd9, 0xc2, 0x33, 0x81,
+    0xd1, 0x39, 0xad, 0x00, 0x1a, 0x70, 0x47, 0x1e, 0xea, 0xc2, 0x33, 0x8d,
+    0xc6, 0x63, 0x08, 0x00, 0xd5, 0x90, 0xc6, 0x00, 0xd1, 0x00, 0xee, 0x70,
+    0xc2, 0x00, 0x6b, 0x08, 0x1b, 0xb1, 0xc3, 0x63, 0x4a, 0x08, 0x1b, 0xb9,
+    0xc4, 0xe2, 0x44, 0x08, 0x1b, 0xc1, 0xc5, 0xda, 0x8f, 0x08, 0x1b, 0xc9,
+    0xc3, 0xe5, 0x80, 0x08, 0x1b, 0xd0, 0x1e, 0xc2, 0x33, 0x99, 0x01, 0x42,
+    0x33, 0xab, 0xc5, 0x00, 0xd2, 0x00, 0xd6, 0x41, 0xc5, 0x01, 0x24, 0x00,
+    0x18, 0xf8, 0x4a, 0x59, 0x63, 0xc2, 0x33, 0xc3, 0xd4, 0x3d, 0x1a, 0x00,
+    0x19, 0x08, 0xc5, 0x00, 0xd2, 0x00, 0x19, 0xe9, 0xc5, 0x01, 0x24, 0x00,
+    0x1a, 0x98, 0xc5, 0x00, 0xd2, 0x00, 0x18, 0x69, 0xc5, 0x01, 0x24, 0x00,
+    0x19, 0x48, 0xc4, 0x28, 0x74, 0x0e, 0x9b, 0x89, 0xc5, 0x0a, 0xfd, 0x0e,
+    0x9b, 0x81, 0x15, 0xc2, 0x33, 0xd5, 0x08, 0xc2, 0x33, 0xe1, 0x16, 0xc2,
+    0x33, 0xed, 0xc3, 0x05, 0x16, 0x0e, 0x9b, 0x48, 0xc4, 0x28, 0x74, 0x0e,
+    0x9b, 0x41, 0xc5, 0x0a, 0xfd, 0x0e, 0x9b, 0x39, 0x15, 0xc2, 0x33, 0xf9,
+    0x08, 0xc2, 0x34, 0x05, 0x16, 0xc2, 0x34, 0x11, 0xc3, 0x05, 0x16, 0x0e,
+    0x9b, 0x00, 0xc7, 0x78, 0xa6, 0x01, 0x17, 0xe9, 0x48, 0x03, 0xc1, 0xc2,
+    0x34, 0x1d, 0xd6, 0x2b, 0x80, 0x01, 0x17, 0xd0, 0xcf, 0x4a, 0x41, 0x01,
+    0x15, 0x9b, 0x02, 0x34, 0x23, 0xc6, 0x03, 0xb0, 0x01, 0x10, 0x58, 0x0d,
+    0xc2, 0x34, 0x29, 0x0a, 0xc2, 0x34, 0x39, 0x42, 0x00, 0xeb, 0xc2, 0x34,
+    0x45, 0x15, 0xc2, 0x34, 0x51, 0x06, 0xc2, 0x34, 0x67, 0x03, 0xc2, 0x34,
+    0x79, 0xc4, 0xde, 0x60, 0x01, 0x64, 0x19, 0xc3, 0x7b, 0x83, 0x01, 0x64,
+    0x49, 0xc4, 0xe2, 0x44, 0x01, 0x64, 0x69, 0x16, 0xc2, 0x34, 0x85, 0xc5,
+    0xdd, 0x9b, 0x01, 0x64, 0x99, 0x0e, 0xc2, 0x34, 0x91, 0xc2, 0x01, 0x33,
+    0x01, 0x64, 0xc9, 0xc2, 0x00, 0xb0, 0x01, 0x64, 0xd9, 0x91, 0x01, 0x64,
+    0xfb, 0x02, 0x34, 0x9d, 0x12, 0xc2, 0x34, 0xa9, 0xc2, 0x00, 0x57, 0x01,
+    0x65, 0x19, 0xc2, 0x00, 0xe6, 0x01, 0x65, 0x49, 0x08, 0xc2, 0x34, 0xb3,
+    0x42, 0x02, 0x11, 0xc2, 0x34, 0xbd, 0xcd, 0x7b, 0x78, 0x01, 0x67, 0x98,
+    0x0d, 0xc2, 0x34, 0xc9, 0xc5, 0xdb, 0x57, 0x01, 0x67, 0x29, 0xc5, 0xd3,
+    0xe6, 0x01, 0x67, 0x31, 0x15, 0xc2, 0x34, 0xd5, 0xc6, 0xd2, 0x98, 0x01,
+    0x67, 0x40, 0x0a, 0xc2, 0x34, 0xe1, 0x42, 0x00, 0xeb, 0xc2, 0x34, 0xed,
+    0x15, 0xc2, 0x34, 0xf9, 0x06, 0xc2, 0x35, 0x0f, 0x03, 0xc2, 0x35, 0x21,
+    0xc4, 0xde, 0x60, 0x01, 0x64, 0x11, 0xc3, 0x7b, 0x83, 0x01, 0x64, 0x41,
+    0xc4, 0xe2, 0x44, 0x01, 0x64, 0x61, 0x16, 0xc2, 0x35, 0x2d, 0xc5, 0xdd,
+    0x9b, 0x01, 0x64, 0x91, 0x0d, 0xc2, 0x35, 0x39, 0x0e, 0xc2, 0x35, 0x49,
+    0xc2, 0x01, 0x33, 0x01, 0x64, 0xc1, 0xc2, 0x00, 0xb0, 0x01, 0x64, 0xd1,
+    0x91, 0x01, 0x64, 0xf3, 0x02, 0x35, 0x55, 0x12, 0xc2, 0x35, 0x61, 0xc2,
+    0x00, 0x57, 0x01, 0x65, 0x11, 0xc2, 0x00, 0xe6, 0x01, 0x65, 0x41, 0x08,
+    0xc2, 0x35, 0x6b, 0x42, 0x02, 0x11, 0xc2, 0x35, 0x75, 0xcd, 0x7b, 0x78,
+    0x01, 0x67, 0x90, 0xc8, 0xb9, 0xc8, 0x01, 0x67, 0x79, 0x49, 0xab, 0x7d,
+    0x42, 0x35, 0x81, 0xc3, 0x05, 0x16, 0x08, 0x17, 0x09, 0x16, 0xc2, 0x35,
+    0x8d, 0x08, 0xc2, 0x35, 0x99, 0x15, 0xc2, 0x35, 0xa5, 0xc5, 0x0a, 0xfd,
+    0x08, 0x17, 0x41, 0xc4, 0x28, 0x74, 0x08, 0x17, 0x48, 0x16, 0xc2, 0x35,
+    0xb1, 0x08, 0xc2, 0x35, 0xbf, 0x15, 0xc2, 0x35, 0xc7, 0x45, 0x0a, 0xfd,
+    0xc2, 0x35, 0xd3, 0x44, 0x28, 0x74, 0xc2, 0x35, 0xdd, 0xcb, 0x0c, 0xe3,
+    0x08, 0x17, 0x98, 0xcb, 0x95, 0x9f, 0x0f, 0xa7, 0x59, 0xcc, 0x8b, 0x08,
+    0x0f, 0xa7, 0x50, 0xc7, 0x59, 0xfb, 0x0f, 0x98, 0x11, 0xd0, 0x5a, 0x72,
+    0x01, 0x52, 0x62, 0x02, 0x35, 0xe9, 0xc4, 0x0e, 0x6c, 0x01, 0x56, 0x7b,
+    0x02, 0x35, 0xef, 0xc6, 0x2f, 0xa0, 0x01, 0x56, 0x82, 0x02, 0x35, 0xf5,
+    0xcf, 0x65, 0x1b, 0x01, 0x11, 0x91, 0xd2, 0x4c, 0x81, 0x01, 0x4a, 0x08,
+    0xd3, 0x40, 0x69, 0x01, 0x0d, 0xb9, 0xe0, 0x04, 0xc9, 0x01, 0x5b, 0x70,
+    0xdb, 0x15, 0xb3, 0x0f, 0xae, 0xc1, 0x46, 0x00, 0x71, 0x42, 0x35, 0xfb,
+    0xe0, 0x00, 0x69, 0x0f, 0xa8, 0x18, 0x19, 0xc2, 0x36, 0x04, 0x42, 0x00,
+    0x79, 0xc2, 0x36, 0x0e, 0x44, 0x03, 0xe0, 0x42, 0x36, 0x1a, 0x45, 0x65,
+    0x84, 0xc2, 0x36, 0x26, 0x44, 0x00, 0x65, 0x42, 0x36, 0x32, 0xc7, 0xc0,
+    0x4d, 0x0f, 0xab, 0x21, 0xc7, 0xc3, 0xd4, 0x0f, 0xaa, 0xc0, 0x44, 0x17,
+    0xf7, 0xc2, 0x36, 0x3e, 0x42, 0x24, 0x36, 0x42, 0x36, 0x4a, 0x43, 0x0c,
+    0xf7, 0xc2, 0x36, 0x56, 0x43, 0x04, 0xa0, 0x42, 0x36, 0x62, 0xc7, 0xc0,
+    0x4d, 0x0f, 0xaa, 0xe1, 0xc7, 0xc3, 0xd4, 0x0f, 0xaa, 0x80, 0x44, 0x0d,
+    0x23, 0xc2, 0x36, 0x6e, 0xd8, 0x00, 0x91, 0x0f, 0x8b, 0x71, 0x85, 0x0f,
+    0x8b, 0x69, 0x86, 0x0f, 0x89, 0x68, 0xdb, 0x16, 0xa6, 0x01, 0x3d, 0x91,
+    0xd8, 0x23, 0x05, 0x01, 0x1c, 0x49, 0xcb, 0x97, 0x36, 0x0f, 0x8b, 0x79,
+    0x46, 0xc5, 0x17, 0x42, 0x36, 0x78, 0x45, 0x00, 0xbc, 0xc2, 0x36, 0xbe,
+    0x9c, 0x0f, 0x89, 0x70, 0x0b, 0xc2, 0x36, 0xca, 0xc3, 0x00, 0xa6, 0x01,
+    0x14, 0xe9, 0x11, 0x42, 0x36, 0xd6, 0x45, 0x09, 0x34, 0xc2, 0x36, 0xe0,
+    0xc8, 0x00, 0xc9, 0x01, 0x4e, 0x00, 0x16, 0xc2, 0x36, 0xec, 0xc8, 0x48,
+    0x01, 0x01, 0x23, 0x91, 0x07, 0xc2, 0x37, 0x01, 0x15, 0xc2, 0x37, 0x0d,
+    0x08, 0x42, 0x37, 0x19, 0xc7, 0x00, 0xc2, 0x0f, 0xbe, 0xab, 0x02, 0x37,
+    0x23, 0xc4, 0x00, 0xf0, 0x01, 0x14, 0xb8, 0xd0, 0x58, 0xe2, 0x01, 0x14,
+    0xd9, 0x4c, 0x04, 0x57, 0x42, 0x37, 0x29, 0xcc, 0x83, 0x28, 0x01, 0x14,
+    0xd1, 0xce, 0x69, 0x63, 0x01, 0x4d, 0xc0, 0xc4, 0x19, 0x44, 0x01, 0x14,
+    0xb1, 0x49, 0x1d, 0xa4, 0x42, 0x37, 0x35, 0xc3, 0x23, 0xe0, 0x01, 0x14,
+    0xa9, 0xcc, 0x84, 0x78, 0x01, 0x4d, 0xc9, 0xc7, 0x36, 0x57, 0x01, 0x4d,
+    0xb9, 0xca, 0x9a, 0x7a, 0x01, 0x81, 0xb0, 0x49, 0x9a, 0x35, 0xc2, 0x37,
+    0x3b, 0x5b, 0x15, 0x7d, 0xc2, 0x37, 0x87, 0xd1, 0x4f, 0x48, 0x0f, 0xb6,
+    0x40, 0xc5, 0x19, 0xc5, 0x01, 0x4d, 0xf9, 0xc5, 0xd4, 0x09, 0x01, 0x5d,
+    0xf8, 0x50, 0x48, 0xfe, 0xc2, 0x37, 0x8f, 0x48, 0xbd, 0xa8, 0x42, 0x37,
+    0x9b, 0x03, 0xc2, 0x37, 0xd3, 0x46, 0x06, 0x50, 0xc2, 0x37, 0xd9, 0x0e,
+    0xc2, 0x37, 0xe5, 0xd0, 0x59, 0x82, 0x01, 0x2e, 0x89, 0xcd, 0x76, 0x57,
+    0x01, 0x2e, 0x69, 0x43, 0x01, 0xa1, 0xc2, 0x37, 0xf1, 0x15, 0xc2, 0x37,
+    0xf7, 0xce, 0x10, 0x01, 0x01, 0x4d, 0xa8, 0xe0, 0x06, 0xa9, 0x01, 0x4d,
+    0xd0, 0xa4, 0x09, 0x1b, 0x5b, 0x02, 0x38, 0x03, 0xd1, 0x4f, 0x6a, 0x09,
+    0x2a, 0x11, 0x8f, 0x09, 0x1b, 0x71, 0xc3, 0x2b, 0xcc, 0x09, 0x1b, 0x68,
+    0xa6, 0x09, 0x2a, 0x09, 0xc2, 0xe4, 0xd9, 0x09, 0x1b, 0x09, 0x89, 0x09,
+    0x1b, 0x01, 0x01, 0x42, 0x38, 0x09, 0xc2, 0xe3, 0x0e, 0x09, 0x1b, 0x49,
+    0x89, 0x09, 0x1b, 0x41, 0x84, 0x09, 0x1b, 0x33, 0x02, 0x38, 0x15, 0xa2,
+    0x09, 0x1b, 0x29, 0xc8, 0xb8, 0x58, 0x09, 0x1b, 0x20, 0x97, 0x09, 0x19,
+    0xbb, 0x02, 0x38, 0x1b, 0xa1, 0x09, 0x19, 0x5b, 0x02, 0x38, 0x2a, 0x8b,
+    0x09, 0x19, 0xab, 0x02, 0x38, 0x2e, 0xa3, 0x09, 0x19, 0xa1, 0x01, 0x42,
+    0x38, 0x32, 0x97, 0x09, 0x1c, 0xcb, 0x02, 0x38, 0x3e, 0x47, 0x1b, 0x5b,
+    0xc2, 0x38, 0x44, 0xc3, 0x6d, 0x19, 0x09, 0x18, 0x60, 0x47, 0x00, 0xee,
+    0xc2, 0x38, 0x56, 0xc2, 0x04, 0x41, 0x09, 0x19, 0x1b, 0x02, 0x38, 0x6f,
+    0xc3, 0x1f, 0xef, 0x09, 0x19, 0x10, 0x97, 0x09, 0x1a, 0xe1, 0xa2, 0x09,
+    0x1a, 0xd2, 0x02, 0x38, 0x75, 0xc3, 0xe4, 0xd8, 0x09, 0x1a, 0xc1, 0xa1,
+    0x09, 0x1a, 0xb9, 0x9a, 0x09, 0x1a, 0xb1, 0x47, 0x00, 0xee, 0x42, 0x38,
+    0x7b, 0xc5, 0x3a, 0x81, 0x09, 0x19, 0x38, 0xc2, 0x05, 0xa9, 0x09, 0x18,
+    0xe1, 0x01, 0x42, 0x38, 0x8e, 0x8f, 0x09, 0x18, 0x43, 0x02, 0x38, 0xa9,
+    0x94, 0x09, 0x18, 0x4b, 0x02, 0x38, 0xaf, 0x8d, 0x09, 0x18, 0x39, 0xc2,
+    0x05, 0xaa, 0x09, 0x18, 0x30, 0xc2, 0x38, 0x7c, 0x09, 0x17, 0xd3, 0x02,
+    0x38, 0xb5, 0x94, 0x09, 0x17, 0xd9, 0x89, 0x09, 0x17, 0x9b, 0x02, 0x38,
+    0xbb, 0x84, 0x09, 0x17, 0x83, 0x02, 0x38, 0xc1, 0x01, 0x42, 0x38, 0xc5,
+    0xa1, 0x09, 0x1c, 0xb9, 0x94, 0x09, 0x18, 0x0b, 0x02, 0x38, 0xd7, 0x8e,
+    0x09, 0x18, 0x01, 0xc5, 0x59, 0x3d, 0x09, 0x17, 0xf8, 0xc5, 0x3a, 0x81,
+    0x09, 0x17, 0xe8, 0x01, 0xc2, 0x38, 0xdb, 0xc3, 0xdc, 0x3a, 0x09, 0x17,
+    0x09, 0xc2, 0xa2, 0x86, 0x09, 0x17, 0x01, 0x89, 0x09, 0x16, 0xea, 0x02,
+    0x38, 0xe7, 0x97, 0x09, 0x16, 0xbb, 0x02, 0x38, 0xee, 0x87, 0x09, 0x15,
+    0xd3, 0x02, 0x39, 0x01, 0x83, 0x09, 0x15, 0x6b, 0x02, 0x39, 0x18, 0x0b,
+    0x42, 0x39, 0x32, 0x89, 0x09, 0x14, 0xab, 0x02, 0x39, 0x53, 0x94, 0x09,
+    0x15, 0x61, 0xc4, 0xe2, 0x48, 0x09, 0x15, 0x59, 0x8e, 0x09, 0x15, 0x4a,
+    0x02, 0x39, 0x57, 0x94, 0x09, 0x17, 0x4b, 0x02, 0x39, 0x5d, 0x8f, 0x09,
+    0x17, 0x3b, 0x02, 0x39, 0x61, 0xc3, 0x0b, 0xc9, 0x09, 0x17, 0x31, 0x86,
+    0x09, 0x17, 0x23, 0x02, 0x39, 0x67, 0xc8, 0x8b, 0x6b, 0x09, 0x17, 0x18,
+    0x90, 0x09, 0x1c, 0x7b, 0x02, 0x39, 0x6b, 0xc3, 0x78, 0xe2, 0x09, 0x13,
+    0x01, 0x8f, 0x09, 0x12, 0x7b, 0x02, 0x39, 0x78, 0xa1, 0x09, 0x12, 0x71,
+    0xc8, 0x94, 0xef, 0x09, 0x12, 0x68, 0xc2, 0x2b, 0xc9, 0x09, 0x13, 0x13,
+    0x02, 0x39, 0x7e, 0x90, 0x09, 0x13, 0x1a, 0x02, 0x39, 0x82, 0xa3, 0x09,
+    0x1c, 0x71, 0x8f, 0x09, 0x12, 0x33, 0x02, 0x39, 0x8f, 0xc2, 0x00, 0xeb,
+    0x09, 0x12, 0x03, 0x02, 0x39, 0x99, 0xa1, 0x09, 0x11, 0xf8, 0x01, 0x42,
+    0x39, 0xa1, 0xc2, 0x00, 0xa7, 0x09, 0x11, 0x93, 0x02, 0x39, 0xad, 0xc4,
+    0xde, 0x78, 0x09, 0x11, 0x89, 0xc4, 0xe2, 0x94, 0x09, 0x11, 0x81, 0x89,
+    0x09, 0x11, 0x73, 0x02, 0x39, 0xb8, 0xc8, 0xb8, 0x80, 0x09, 0x11, 0x68,
+    0xc9, 0xb1, 0x26, 0x09, 0x28, 0xf9, 0x90, 0x09, 0x11, 0x58, 0x95, 0x09,
+    0x11, 0x4a, 0x02, 0x39, 0xbe, 0xc2, 0x00, 0xa7, 0x09, 0x11, 0x33, 0x02,
+    0x39, 0xc2, 0x94, 0x09, 0x11, 0x29, 0x8a, 0x09, 0x11, 0x21, 0xa1, 0x09,
+    0x11, 0x19, 0x01, 0x42, 0x39, 0xc6, 0xa1, 0x09, 0x0f, 0xeb, 0x02, 0x39,
+    0xd2, 0x8f, 0x09, 0x10, 0xeb, 0x02, 0x39, 0xd6, 0x8e, 0x09, 0x10, 0xe1,
+    0x8a, 0x09, 0x10, 0xd9, 0xc3, 0x3b, 0x31, 0x09, 0x10, 0xbb, 0x02, 0x39,
+    0xdf, 0xa2, 0x09, 0x10, 0xb1, 0xca, 0x8f, 0x70, 0x09, 0x0f, 0xe0, 0x42,
+    0x0c, 0xa7, 0xc2, 0x39, 0xe3, 0x42, 0x00, 0xeb, 0xc2, 0x3a, 0x05, 0x8f,
+    0x09, 0x0f, 0xa3, 0x02, 0x3a, 0x13, 0x8e, 0x09, 0x0f, 0x93, 0x02, 0x3a,
+    0x1c, 0xc4, 0x5f, 0xb1, 0x09, 0x0f, 0x88, 0xc2, 0x00, 0xa7, 0x09, 0x0f,
+    0xd1, 0xc4, 0xe3, 0x84, 0x09, 0x0f, 0xc9, 0x8e, 0x09, 0x0f, 0xc0, 0x47,
+    0x00, 0xee, 0xc2, 0x3a, 0x22, 0xc9, 0xa8, 0x77, 0x09, 0x1b, 0x79, 0xc4,
+    0x43, 0x8a, 0x09, 0x0c, 0xe3, 0x02, 0x3a, 0x6e, 0x0f, 0xc2, 0x3a, 0x72,
+    0x8e, 0x09, 0x0c, 0xbb, 0x02, 0x3a, 0x7a, 0x8d, 0x09, 0x0c, 0xab, 0x02,
+    0x3a, 0x7e, 0x06, 0xc2, 0x3a, 0x84, 0x84, 0x09, 0x0c, 0x79, 0xa1, 0x09,
+    0x0c, 0x6a, 0x02, 0x3a, 0x97, 0xc4, 0x5f, 0xb2, 0x09, 0x0d, 0xa9, 0x94,
+    0x09, 0x0d, 0x9b, 0x02, 0x3a, 0x9d, 0x90, 0x09, 0x0d, 0x91, 0x8e, 0x09,
+    0x0d, 0x83, 0x02, 0x3a, 0xa3, 0xa6, 0x09, 0x0d, 0x79, 0xa3, 0x09, 0x0d,
+    0x6b, 0x02, 0x3a, 0xa9, 0xa2, 0x09, 0x0d, 0x61, 0x49, 0x08, 0x16, 0x42,
+    0x3a, 0xaf, 0x15, 0xc2, 0x3a, 0xb5, 0x90, 0x09, 0x0d, 0x29, 0x86, 0x09,
+    0x0d, 0x21, 0x47, 0x00, 0xee, 0x42, 0x3a, 0xc8, 0x47, 0x00, 0xee, 0x42,
+    0x3a, 0xd5, 0x01, 0xc2, 0x3b, 0x06, 0x8e, 0x09, 0x09, 0x60, 0xc2, 0x00,
+    0xa7, 0x09, 0x1b, 0xe9, 0xc2, 0xd7, 0x55, 0x09, 0x09, 0xf1, 0xc2, 0x5f,
+    0x02, 0x09, 0x09, 0xc2, 0x02, 0x3b, 0x15, 0x86, 0x09, 0x08, 0xf3, 0x02,
+    0x3b, 0x1b, 0xa1, 0x09, 0x08, 0xc3, 0x02, 0x3b, 0x1f, 0x94, 0x09, 0x09,
+    0x2b, 0x02, 0x3b, 0x23, 0x8f, 0x09, 0x09, 0x1b, 0x02, 0x3b, 0x2b, 0x8e,
+    0x09, 0x09, 0x11, 0xcc, 0x80, 0x88, 0x09, 0x08, 0xb8, 0x15, 0xc2, 0x3b,
+    0x31, 0x89, 0x09, 0x1b, 0xe1, 0x14, 0xc2, 0x3b, 0x3e, 0xc3, 0x7e, 0x6b,
+    0x09, 0x08, 0x39, 0xa3, 0x09, 0x08, 0x23, 0x02, 0x3b, 0x4c, 0x01, 0x42,
+    0x3b, 0x50, 0xc5, 0xdc, 0x65, 0x09, 0x07, 0xf3, 0x02, 0x3b, 0x5c, 0xc2,
+    0xe1, 0xb3, 0x09, 0x1b, 0xd8, 0xc2, 0x00, 0xa0, 0x09, 0x07, 0x73, 0x02,
+    0x3b, 0x62, 0xa1, 0x09, 0x05, 0xbb, 0x02, 0x3b, 0x66, 0xc4, 0x16, 0xf6,
+    0x09, 0x07, 0xe9, 0x94, 0x09, 0x07, 0xdb, 0x02, 0x3b, 0x6a, 0x90, 0x09,
+    0x07, 0xb3, 0x02, 0x3b, 0x6e, 0x8f, 0x09, 0x07, 0xa9, 0x8e, 0x09, 0x07,
+    0x93, 0x02, 0x3b, 0x75, 0x86, 0x09, 0x07, 0x83, 0x02, 0x3b, 0x81, 0xc5,
+    0x3a, 0x81, 0x09, 0x05, 0xb0, 0x01, 0x42, 0x3b, 0x87, 0xce, 0x6f, 0xde,
+    0x09, 0x25, 0x60, 0xc3, 0x9c, 0xa7, 0x09, 0x04, 0xfb, 0x02, 0x3b, 0x93,
+    0xc2, 0x00, 0x79, 0x09, 0x04, 0xf0, 0x47, 0x00, 0xee, 0x42, 0x3b, 0x99,
+    0x01, 0x42, 0x3b, 0xbf, 0xd3, 0x40, 0x1d, 0x09, 0x04, 0x61, 0xc9, 0xaf,
+    0xfd, 0x09, 0x04, 0x58, 0x89, 0x09, 0x04, 0x0b, 0x02, 0x3b, 0xd7, 0x84,
+    0x09, 0x03, 0xf3, 0x02, 0x3b, 0xe3, 0xc2, 0x3b, 0x28, 0x09, 0x04, 0x49,
+    0x90, 0x09, 0x04, 0x23, 0x02, 0x3b, 0xed, 0x8a, 0x09, 0x04, 0x19, 0x01,
+    0x42, 0x3b, 0xf8, 0x8f, 0x09, 0x03, 0xa3, 0x02, 0x3c, 0x0a, 0xc2, 0x00,
+    0xa7, 0x09, 0x03, 0xcb, 0x02, 0x3c, 0x17, 0x90, 0x09, 0x03, 0xbb, 0x02,
+    0x3c, 0x1d, 0x84, 0x09, 0x03, 0x98, 0x89, 0x09, 0x02, 0xb3, 0x02, 0x3c,
+    0x23, 0xcb, 0x38, 0x73, 0x09, 0x24, 0x41, 0x94, 0x09, 0x03, 0x7b, 0x02,
+    0x3c, 0x2b, 0x8f, 0x09, 0x03, 0x70, 0x01, 0xc2, 0x3c, 0x2f, 0x94, 0x09,
+    0x02, 0x9b, 0x02, 0x3c, 0x3b, 0xc3, 0x6d, 0x1d, 0x09, 0x02, 0x8a, 0x02,
+    0x3c, 0x3f, 0xc4, 0x3b, 0x26, 0x09, 0x02, 0x1b, 0x02, 0x3c, 0x45, 0x86,
+    0x09, 0x02, 0x0b, 0x02, 0x3c, 0x4b, 0x94, 0x09, 0x02, 0x3b, 0x02, 0x3c,
+    0x51, 0x8e, 0x09, 0x02, 0x23, 0x02, 0x3c, 0x57, 0xc2, 0xa8, 0xbe, 0x09,
+    0x02, 0x10, 0x47, 0x00, 0xee, 0x42, 0x3c, 0x63, 0xcb, 0x94, 0xef, 0x09,
+    0x24, 0x10, 0x01, 0xc2, 0x3c, 0x73, 0xa1, 0x09, 0x00, 0xb2, 0x02, 0x3c,
+    0x7f, 0x47, 0x00, 0xee, 0x42, 0x3c, 0x85, 0x8a, 0x09, 0x01, 0xc3, 0x02,
+    0x3c, 0x91, 0xc3, 0xe5, 0x02, 0x09, 0x01, 0xb8, 0xc3, 0x32, 0xac, 0x09,
+    0x01, 0xb1, 0xc2, 0x01, 0xe7, 0x09, 0x01, 0xa2, 0x02, 0x3c, 0x9f, 0xc3,
+    0x06, 0xf3, 0x09, 0x01, 0x91, 0x01, 0x42, 0x3c, 0xa5, 0xc3, 0x35, 0x14,
+    0x09, 0x01, 0x51, 0xc2, 0x00, 0x6b, 0x09, 0x01, 0x49, 0x47, 0x00, 0xee,
+    0x42, 0x3c, 0xb7, 0x47, 0x00, 0xee, 0x42, 0x3c, 0xdf, 0xc3, 0x78, 0xe2,
+    0x09, 0x00, 0x41, 0xc4, 0x78, 0x41, 0x09, 0x00, 0x39, 0xca, 0x3d, 0xc0,
+    0x09, 0x00, 0x31, 0xc3, 0x03, 0x8c, 0x09, 0x00, 0x29, 0xc2, 0x00, 0xce,
+    0x09, 0x00, 0x21, 0xc9, 0x59, 0x39, 0x09, 0x00, 0x19, 0xc3, 0x69, 0x5c,
+    0x09, 0x00, 0x11, 0x83, 0x09, 0x00, 0x08, 0x14, 0xc2, 0x3c, 0xeb, 0x01,
+    0x42, 0x3c, 0xf8, 0xc9, 0x09, 0x80, 0x09, 0x1c, 0xa0, 0x92, 0x09, 0x13,
+    0xe9, 0x90, 0x09, 0x13, 0xe1, 0x86, 0x09, 0x13, 0xd8, 0x84, 0x09, 0x14,
+    0x80, 0xc2, 0x00, 0xaf, 0x09, 0x0a, 0x99, 0x01, 0x42, 0x3d, 0x04, 0xa1,
+    0x09, 0x0a, 0x69, 0xd0, 0x5d, 0x92, 0x09, 0x0a, 0x60, 0x8b, 0x09, 0x0a,
+    0x32, 0x02, 0x3d, 0x1c, 0x4b, 0x98, 0x12, 0x42, 0x3d, 0x20, 0x97, 0x09,
+    0x20, 0xa3, 0x02, 0x3d, 0x2c, 0xd3, 0x41, 0x60, 0x09, 0x22, 0x33, 0x02,
+    0x3d, 0x32, 0xc5, 0xdb, 0x7a, 0x09, 0x21, 0x59, 0xc5, 0xdc, 0x7e, 0x09,
+    0x20, 0xe9, 0xc4, 0x02, 0x3b, 0x09, 0x20, 0x71, 0xc3, 0x00, 0xa6, 0x09,
+    0x20, 0x38, 0xc3, 0x22, 0xeb, 0x09, 0x22, 0xb9, 0xc3, 0x08, 0x88, 0x09,
+    0x22, 0xb0, 0x97, 0x09, 0x20, 0x9b, 0x02, 0x3d, 0x40, 0xd1, 0x51, 0xac,
+    0x09, 0x22, 0x23, 0x02, 0x3d, 0x46, 0xc5, 0xdb, 0x7a, 0x09, 0x21, 0x51,
+    0xc5, 0xdc, 0x7e, 0x09, 0x20, 0xe1, 0xc4, 0x02, 0x3b, 0x09, 0x20, 0x69,
+    0xc3, 0x00, 0xa6, 0x09, 0x20, 0x30, 0x08, 0xc2, 0x3d, 0x4a, 0xca, 0x9b,
+    0x7e, 0x09, 0x23, 0x31, 0xc9, 0xaa, 0xb7, 0x09, 0x23, 0x28, 0x97, 0x09,
+    0x20, 0x93, 0x02, 0x3d, 0x56, 0x51, 0x51, 0xbd, 0xc2, 0x3d, 0x5c, 0xc5,
+    0xdb, 0x7a, 0x09, 0x21, 0x49, 0xc5, 0xdc, 0x7e, 0x09, 0x20, 0xd9, 0xc4,
+    0x02, 0x3b, 0x09, 0x20, 0x61, 0xc3, 0x00, 0xa6, 0x09, 0x20, 0x28, 0x97,
+    0x09, 0x20, 0x8b, 0x02, 0x3d, 0x64, 0xc3, 0x00, 0xa6, 0x09, 0x20, 0x23,
+    0x02, 0x3d, 0x6a, 0xd1, 0x51, 0xf0, 0x09, 0x22, 0x01, 0xc5, 0xdb, 0x7a,
+    0x09, 0x21, 0x41, 0xc5, 0xdc, 0x7e, 0x09, 0x20, 0xd1, 0xc4, 0x02, 0x3b,
+    0x09, 0x20, 0x58, 0xc3, 0x08, 0x88, 0x09, 0x21, 0x99, 0xc4, 0x02, 0x3b,
+    0x09, 0x21, 0x90, 0x97, 0x09, 0x20, 0x83, 0x02, 0x3d, 0x70, 0x15, 0xc2,
+    0x3d, 0x76, 0x04, 0xc2, 0x3d, 0x82, 0xc3, 0x00, 0xa6, 0x09, 0x20, 0x1b,
+    0x02, 0x3d, 0x91, 0x44, 0x62, 0x98, 0xc2, 0x3d, 0x97, 0xc4, 0x02, 0x3b,
+    0x09, 0x20, 0x50, 0x97, 0x09, 0x20, 0x7b, 0x02, 0x3d, 0x9f, 0x04, 0xc2,
+    0x3d, 0xa5, 0xc3, 0x00, 0xa6, 0x09, 0x20, 0x13, 0x02, 0x3d, 0xb4, 0xd2,
+    0x4e, 0x9d, 0x09, 0x21, 0xe3, 0x02, 0x3d, 0xba, 0x44, 0xa4, 0x52, 0xc2,
+    0x3d, 0xc2, 0x44, 0x62, 0x98, 0xc2, 0x3d, 0xca, 0xc4, 0x02, 0x3b, 0x09,
+    0x20, 0x48, 0xc8, 0xbb, 0xd0, 0x09, 0x23, 0x21, 0x48, 0x15, 0xdc, 0xc2,
+    0x3d, 0xd2, 0x07, 0xc2, 0x3d, 0xde, 0x46, 0x0a, 0xc9, 0xc2, 0x3d, 0xea,
+    0x04, 0xc2, 0x3d, 0xf6, 0xc5, 0xdb, 0x89, 0x09, 0x21, 0x61, 0x44, 0x62,
+    0x98, 0x42, 0x3e, 0x02, 0xc7, 0x06, 0x7b, 0x09, 0x23, 0x11, 0xc5, 0xd3,
+    0x34, 0x09, 0x23, 0x08, 0x47, 0x8d, 0x49, 0xc2, 0x3e, 0x0a, 0xc5, 0xd6,
+    0x52, 0x09, 0x22, 0xc9, 0x04, 0xc2, 0x3e, 0x16, 0xc3, 0x00, 0xa6, 0x09,
+    0x20, 0x03, 0x02, 0x3e, 0x22, 0x44, 0xa4, 0x52, 0xc2, 0x3e, 0x28, 0x44,
+    0x62, 0x98, 0x42, 0x3e, 0x30, 0x04, 0xc2, 0x3e, 0x38, 0xc3, 0x00, 0xa6,
+    0x09, 0x20, 0x0b, 0x02, 0x3e, 0x47, 0x50, 0x5f, 0xa2, 0xc2, 0x3e, 0x4d,
+    0x44, 0xa4, 0x52, 0xc2, 0x3e, 0x59, 0x44, 0x62, 0x98, 0xc2, 0x3e, 0x67,
+    0xc4, 0x02, 0x3b, 0x09, 0x20, 0x40, 0xc2, 0x00, 0x11, 0x01, 0x3d, 0x81,
+    0x46, 0x1a, 0x0b, 0x42, 0x3e, 0x6f, 0xa3, 0x09, 0x7f, 0x81, 0xa1, 0x09,
+    0x7f, 0x79, 0x9f, 0x09, 0x7f, 0x70, 0xa8, 0x09, 0x7f, 0x69, 0xa7, 0x09,
+    0x7f, 0x61, 0xa6, 0x09, 0x7f, 0x59, 0xa4, 0x09, 0x7f, 0x51, 0xa3, 0x09,
+    0x7f, 0x49, 0xa2, 0x09, 0x7f, 0x41, 0xa1, 0x09, 0x7f, 0x39, 0xa0, 0x09,
+    0x7f, 0x31, 0x9f, 0x09, 0x7f, 0x28, 0xa8, 0x09, 0x7f, 0x21, 0xa7, 0x09,
+    0x7f, 0x19, 0xa6, 0x09, 0x7f, 0x11, 0xa5, 0x09, 0x7f, 0x09, 0xa4, 0x09,
+    0x7f, 0x01, 0xa3, 0x09, 0x7e, 0xf9, 0xa1, 0x09, 0x7e, 0xf1, 0xa0, 0x09,
+    0x7e, 0xe9, 0x9f, 0x09, 0x7e, 0xe0, 0xa8, 0x09, 0x7e, 0xd9, 0xa7, 0x09,
+    0x7e, 0xd1, 0xa6, 0x09, 0x7e, 0xc9, 0xa5, 0x09, 0x7e, 0xc1, 0xa4, 0x09,
+    0x7e, 0xb9, 0xa3, 0x09, 0x7e, 0xb1, 0xa2, 0x09, 0x7e, 0xa9, 0xa1, 0x09,
+    0x7e, 0xa1, 0xa0, 0x09, 0x7e, 0x99, 0x9f, 0x09, 0x7e, 0x90, 0xa8, 0x09,
+    0x7e, 0x89, 0xa7, 0x09, 0x7e, 0x81, 0xa5, 0x09, 0x7e, 0x79, 0xa4, 0x09,
+    0x7e, 0x6b, 0x02, 0x3e, 0x7b, 0xa3, 0x09, 0x7e, 0x61, 0xa2, 0x09, 0x7e,
+    0x59, 0xa1, 0x09, 0x7e, 0x51, 0xa0, 0x09, 0x7e, 0x49, 0x9f, 0x09, 0x7e,
+    0x40, 0xa8, 0x09, 0x7e, 0x39, 0xa7, 0x09, 0x7e, 0x31, 0xa6, 0x09, 0x7e,
+    0x29, 0xa5, 0x09, 0x7e, 0x21, 0xa3, 0x09, 0x7e, 0x19, 0xa2, 0x09, 0x7e,
+    0x11, 0xa1, 0x09, 0x7e, 0x09, 0xa0, 0x09, 0x7e, 0x01, 0x9f, 0x09, 0x7d,
+    0xf8, 0xa8, 0x09, 0x7d, 0xf1, 0xa7, 0x09, 0x7d, 0xe9, 0xa5, 0x09, 0x7d,
+    0xe1, 0xa4, 0x09, 0x7d, 0xd9, 0xa3, 0x09, 0x7d, 0xd1, 0xa2, 0x09, 0x7d,
+    0xc9, 0xa1, 0x09, 0x7d, 0xc1, 0xa0, 0x09, 0x7d, 0xb9, 0x9f, 0x09, 0x7d,
+    0xb0, 0xa8, 0x09, 0x7d, 0xa9, 0xa6, 0x09, 0x7d, 0xa1, 0xa5, 0x09, 0x7d,
+    0x99, 0xa3, 0x09, 0x7d, 0x91, 0xa0, 0x09, 0x7d, 0x89, 0x9f, 0x09, 0x7d,
+    0x80, 0xa8, 0x09, 0x7d, 0x79, 0xa7, 0x09, 0x7d, 0x71, 0xa6, 0x09, 0x7d,
+    0x69, 0xa5, 0x09, 0x7d, 0x61, 0xa4, 0x09, 0x7d, 0x59, 0xa3, 0x09, 0x7d,
+    0x51, 0xa2, 0x09, 0x7d, 0x49, 0x9f, 0x09, 0x7d, 0x40, 0xa8, 0x09, 0x7d,
+    0x39, 0xa7, 0x09, 0x7d, 0x31, 0xa6, 0x09, 0x7d, 0x29, 0xa5, 0x09, 0x7d,
+    0x21, 0xa4, 0x09, 0x7d, 0x19, 0xa3, 0x09, 0x7d, 0x11, 0xa2, 0x09, 0x7d,
+    0x09, 0xa0, 0x09, 0x7d, 0x00, 0xa8, 0x09, 0x7c, 0xf9, 0xa6, 0x09, 0x7c,
+    0xf1, 0xa4, 0x09, 0x7c, 0xe9, 0xa2, 0x09, 0x7c, 0xe1, 0xa1, 0x09, 0x7c,
+    0xd3, 0x02, 0x3e, 0x7f, 0xa0, 0x09, 0x7c, 0xc9, 0x9f, 0x09, 0x7c, 0xc0,
+    0xa8, 0x09, 0x7c, 0xb9, 0xa7, 0x09, 0x7c, 0xb1, 0xa6, 0x09, 0x7c, 0xa9,
+    0xa5, 0x09, 0x7c, 0xa1, 0xa4, 0x09, 0x7c, 0x99, 0xa3, 0x09, 0x7c, 0x91,
+    0xa1, 0x09, 0x7c, 0x89, 0xa0, 0x09, 0x7c, 0x80, 0xcb, 0x93, 0x37, 0x00,
+    0xe4, 0x41, 0x46, 0x00, 0x91, 0xc2, 0x3e, 0x83, 0x8d, 0x00, 0x23, 0xca,
+    0x02, 0x3e, 0x8d, 0x44, 0x00, 0xb7, 0xc2, 0x3e, 0x93, 0xce, 0x74, 0x5a,
+    0x00, 0xe4, 0x29, 0x87, 0x00, 0x22, 0x13, 0x02, 0x3e, 0xa5, 0x15, 0xc2,
+    0x3e, 0xab, 0xc2, 0x00, 0x2b, 0x05, 0x34, 0x69, 0xc3, 0x29, 0xdf, 0x05,
+    0x34, 0x98, 0xc6, 0xd2, 0x56, 0x00, 0xe4, 0x19, 0x87, 0x00, 0x28, 0xe8,
+    0xc7, 0x77, 0xf7, 0x00, 0xe4, 0x11, 0xc2, 0x19, 0x48, 0x00, 0x22, 0xd1,
+    0xca, 0xa6, 0xb4, 0x05, 0x32, 0x78, 0xcd, 0x75, 0x6d, 0x00, 0xe4, 0x09,
+    0xc2, 0x00, 0xce, 0x00, 0x28, 0xa9, 0xc9, 0x56, 0x27, 0x00, 0x23, 0x39,
+    0xc2, 0x19, 0x48, 0x00, 0x22, 0xc8, 0x44, 0x0d, 0xd1, 0xc2, 0x3e, 0xc1,
+    0xc2, 0x00, 0xce, 0x00, 0x28, 0xb9, 0x48, 0x10, 0xac, 0x42, 0x3e, 0xcd,
+    0x8e, 0x00, 0x21, 0xdb, 0x02, 0x3e, 0xe5, 0x90, 0x00, 0x21, 0xeb, 0x02,
+    0x3e, 0xeb, 0xcf, 0x67, 0xdc, 0x00, 0x27, 0x69, 0x8f, 0x00, 0x21, 0xe3,
+    0x02, 0x3e, 0xf1, 0x95, 0x00, 0x22, 0x0b, 0x02, 0x3e, 0xf7, 0x94, 0x00,
+    0x22, 0x03, 0x02, 0x3e, 0xfd, 0x88, 0x00, 0x22, 0x20, 0xc3, 0x29, 0xdf,
+    0x00, 0x29, 0x69, 0x1c, 0xc2, 0x3f, 0x03, 0xc2, 0x00, 0x2b, 0x05, 0x34,
+    0x09, 0x46, 0x03, 0x7b, 0xc2, 0x3f, 0x1a, 0xc2, 0x19, 0x48, 0x00, 0x22,
+    0x93, 0x02, 0x3f, 0x24, 0x87, 0x00, 0x21, 0xa0, 0x0a, 0xc2, 0x3f, 0x2a,
+    0xc4, 0x6f, 0x86, 0x00, 0x26, 0xcb, 0x02, 0x3f, 0x49, 0xc9, 0xb1, 0xfe,
+    0x00, 0x25, 0x7b, 0x02, 0x3f, 0x4f, 0xcc, 0x82, 0x20, 0x00, 0x24, 0x69,
+    0x44, 0x6a, 0xa2, 0x42, 0x3f, 0x55, 0x87, 0x00, 0x21, 0xfb, 0x02, 0x3f,
+    0x65, 0xc7, 0xb5, 0x51, 0x00, 0x26, 0x79, 0xc2, 0x00, 0x8d, 0x00, 0x23,
+    0x88, 0xc7, 0xc1, 0x65, 0x00, 0x28, 0xf9, 0x49, 0xb3, 0xc0, 0xc2, 0x3f,
+    0x6b, 0x46, 0x00, 0x91, 0x42, 0x3f, 0x80, 0x83, 0x00, 0x22, 0x7b, 0x02,
+    0x3f, 0x8c, 0xc3, 0x5e, 0xd0, 0x00, 0x22, 0x5b, 0x02, 0x3f, 0x94, 0x8b,
+    0x00, 0x22, 0xb9, 0x90, 0x05, 0x32, 0xf9, 0x97, 0x00, 0x22, 0x70, 0x11,
+    0xc2, 0x3f, 0x9a, 0xcd, 0x80, 0x4b, 0x00, 0x26, 0x61, 0x83, 0x00, 0x21,
+    0xd3, 0x02, 0x3f, 0xa6, 0xc2, 0x00, 0x8d, 0x00, 0x23, 0x79, 0xc2, 0x19,
+    0x48, 0x00, 0x22, 0xe0, 0x83, 0x00, 0x22, 0x2b, 0x02, 0x3f, 0xac, 0xc2,
+    0x00, 0x2b, 0x05, 0x34, 0xa8, 0xc2, 0x00, 0x61, 0x00, 0x21, 0x9b, 0x02,
+    0x3f, 0xb8, 0xc2, 0x19, 0x48, 0x00, 0x22, 0x98, 0x03, 0xc2, 0x3f, 0xbe,
+    0x0b, 0xc2, 0x3f, 0xcd, 0xd7, 0x2b, 0x53, 0x00, 0x22, 0xb1, 0xca, 0xa2,
+    0xea, 0x05, 0x32, 0x69, 0x87, 0x00, 0x21, 0x89, 0xca, 0xa5, 0x7e, 0x05,
+    0x32, 0xd8, 0xcf, 0x67, 0xdc, 0x00, 0x27, 0x39, 0x96, 0x00, 0x23, 0xf9,
+    0xc4, 0x71, 0xbf, 0x00, 0x23, 0x0a, 0x02, 0x3f, 0xd9, 0x46, 0x00, 0x91,
+    0xc2, 0x3f, 0xdf, 0x87, 0x00, 0x21, 0xab, 0x02, 0x3f, 0xf1, 0xc6, 0xcf,
+    0xec, 0x00, 0x23, 0xab, 0x02, 0x3f, 0xf7, 0x91, 0x00, 0x22, 0x8a, 0x02,
+    0x3f, 0xfd, 0x87, 0x00, 0x21, 0xbb, 0x02, 0x40, 0x01, 0x0a, 0x42, 0x40,
+    0x0d, 0xc2, 0x00, 0x61, 0x00, 0x22, 0x3b, 0x02, 0x40, 0x1a, 0xc3, 0x29,
+    0xdf, 0x05, 0x34, 0x39, 0xc8, 0xb5, 0xd0, 0x05, 0x34, 0xd9, 0xd0, 0x56,
+    0x20, 0x05, 0x32, 0xc8, 0xc8, 0x83, 0xf8, 0x05, 0x32, 0x59, 0xc7, 0x76,
+    0x1c, 0x05, 0x33, 0x48, 0x8e, 0x00, 0x20, 0xdb, 0x02, 0x40, 0x20, 0x90,
+    0x00, 0x20, 0xeb, 0x02, 0x40, 0x26, 0xcf, 0x67, 0xdc, 0x00, 0x27, 0x61,
+    0x8f, 0x00, 0x20, 0xe3, 0x02, 0x40, 0x2c, 0x95, 0x00, 0x21, 0x0b, 0x02,
+    0x40, 0x32, 0x94, 0x00, 0x21, 0x03, 0x02, 0x40, 0x38, 0x88, 0x00, 0x21,
+    0x20, 0xc3, 0x29, 0xdf, 0x00, 0x29, 0x61, 0x1c, 0xc2, 0x40, 0x3e, 0xc2,
+    0x00, 0x2b, 0x05, 0x34, 0x01, 0x46, 0x03, 0x7b, 0xc2, 0x40, 0x55, 0xc2,
+    0x19, 0x48, 0x00, 0x20, 0x13, 0x02, 0x40, 0x5f, 0x87, 0x00, 0x20, 0xa0,
+    0x0a, 0xc2, 0x40, 0x65, 0xc4, 0x6f, 0x86, 0x00, 0x26, 0xc3, 0x02, 0x40,
+    0x84, 0xc9, 0xb1, 0xfe, 0x00, 0x25, 0x73, 0x02, 0x40, 0x8a, 0xcc, 0x82,
+    0x20, 0x00, 0x24, 0x61, 0x44, 0x6a, 0xa2, 0x42, 0x40, 0x90, 0x87, 0x00,
+    0x20, 0xfb, 0x02, 0x40, 0xa0, 0xc2, 0x00, 0x8d, 0x00, 0x23, 0x80, 0xc7,
+    0xc1, 0x65, 0x00, 0x28, 0xf1, 0x49, 0xb3, 0xc0, 0xc2, 0x40, 0xa6, 0x46,
+    0x00, 0x91, 0x42, 0x40, 0xbb, 0x83, 0x00, 0x21, 0x7b, 0x02, 0x40, 0xc7,
+    0xc3, 0x5e, 0xd0, 0x00, 0x21, 0x5b, 0x02, 0x40, 0xcf, 0x8b, 0x00, 0x20,
+    0x39, 0x97, 0x00, 0x21, 0x71, 0x90, 0x05, 0x32, 0xf0, 0xc2, 0x00, 0xce,
+    0x00, 0x28, 0xb1, 0x48, 0x10, 0xac, 0xc2, 0x40, 0xd5, 0xca, 0x9e, 0x94,
+    0x00, 0x23, 0xd0, 0xc2, 0x00, 0xce, 0x00, 0x28, 0xa1, 0xc9, 0x56, 0x27,
+    0x00, 0x23, 0x31, 0xc2, 0x19, 0x48, 0x00, 0x20, 0x48, 0x11, 0xc2, 0x40,
+    0xed, 0xcd, 0x80, 0x4b, 0x00, 0x26, 0x59, 0x83, 0x00, 0x20, 0xd3, 0x02,
+    0x40, 0xf9, 0xc2, 0x00, 0x8d, 0x00, 0x23, 0x71, 0xc2, 0x19, 0x48, 0x00,
+    0x20, 0x60, 0x83, 0x00, 0x21, 0x2b, 0x02, 0x40, 0xff, 0xc2, 0x00, 0x2b,
+    0x05, 0x34, 0xa0, 0xc2, 0x00, 0x61, 0x00, 0x20, 0x9b, 0x02, 0x41, 0x0b,
+    0xc2, 0x19, 0x48, 0x00, 0x20, 0x18, 0xc2, 0x00, 0x61, 0x00, 0x21, 0x3b,
+    0x02, 0x41, 0x11, 0xc3, 0x29, 0xdf, 0x05, 0x34, 0x31, 0xc8, 0xb5, 0xd0,
+    0x05, 0x34, 0xd1, 0xd0, 0x56, 0x20, 0x05, 0x32, 0xc0, 0x46, 0x00, 0x91,
+    0xc2, 0x41, 0x17, 0x8d, 0x00, 0x23, 0xc2, 0x02, 0x41, 0x21, 0x03, 0xc2,
+    0x41, 0x27, 0x0b, 0xc2, 0x41, 0x36, 0xd7, 0x2b, 0x53, 0x00, 0x20, 0x31,
+    0x87, 0x00, 0x20, 0x89, 0xca, 0xa2, 0xea, 0x05, 0x32, 0x61, 0xca, 0xa5,
+    0x7e, 0x05, 0x32, 0xd0, 0xcf, 0x67, 0xdc, 0x00, 0x27, 0x31, 0x96, 0x00,
+    0x23, 0xf1, 0xc4, 0x71, 0xbf, 0x00, 0x23, 0x02, 0x02, 0x41, 0x42, 0x46,
+    0x00, 0x91, 0xc2, 0x41, 0x48, 0x87, 0x00, 0x20, 0xab, 0x02, 0x41, 0x5a,
+    0xc6, 0xcf, 0xec, 0x00, 0x23, 0xa3, 0x02, 0x41, 0x60, 0x91, 0x00, 0x20,
+    0x0a, 0x02, 0x41, 0x66, 0x87, 0x00, 0x20, 0xbb, 0x02, 0x41, 0x6a, 0x0a,
+    0x42, 0x41, 0x76, 0x87, 0x00, 0x21, 0x13, 0x02, 0x41, 0x83, 0xc2, 0x00,
+    0x2b, 0x05, 0x34, 0x61, 0x15, 0xc2, 0x41, 0x89, 0xc3, 0x29, 0xdf, 0x05,
+    0x34, 0x90, 0xc2, 0x19, 0x48, 0x00, 0x20, 0x51, 0xca, 0xa6, 0xb4, 0x05,
+    0x32, 0x70, 0xc8, 0x83, 0xf8, 0x05, 0x32, 0x51, 0xc7, 0x76, 0x1c, 0x05,
+    0x33, 0x40, 0xc3, 0xa3, 0x0f, 0x01, 0x75, 0x81, 0xc2, 0x00, 0xc8, 0x01,
+    0x76, 0x29, 0xc5, 0x74, 0x4d, 0x01, 0x76, 0x41, 0xc4, 0x06, 0xf4, 0x01,
+    0x76, 0x49, 0xc3, 0x05, 0x67, 0x01, 0x77, 0x38, 0xc3, 0x1e, 0x6b, 0x01,
+    0x76, 0x81, 0xc3, 0x01, 0xd9, 0x01, 0x76, 0xa0, 0xc3, 0x01, 0x0a, 0x01,
+    0x76, 0x99, 0xc3, 0x4d, 0x7a, 0x01, 0x76, 0xd0, 0xcd, 0x7e, 0x43, 0x01,
+    0x76, 0xc9, 0xc4, 0xe1, 0xdc, 0x01, 0x77, 0x71, 0xc5, 0xd9, 0xfe, 0x01,
+    0x77, 0x98, 0xc2, 0x00, 0x37, 0x01, 0x76, 0xe1, 0xc3, 0x02, 0x3c, 0x01,
+    0x77, 0x29, 0xc3, 0x24, 0xef, 0x01, 0x77, 0x50, 0xc2, 0x01, 0x17, 0x01,
+    0x77, 0x01, 0xc3, 0x17, 0xf8, 0x01, 0x77, 0x60, 0xc3, 0x05, 0x16, 0x01,
+    0x74, 0x11, 0x16, 0x42, 0x41, 0x9f, 0xc3, 0x05, 0x16, 0x01, 0x74, 0xa1,
+    0xc3, 0x01, 0xa1, 0x01, 0x74, 0xa8, 0x0a, 0xc2, 0x41, 0xab, 0x19, 0xc2,
+    0x41, 0xb7, 0xc6, 0xc6, 0xc8, 0x01, 0x77, 0x48, 0xc2, 0x01, 0xa2, 0x01,
+    0x74, 0x79, 0xc4, 0x03, 0xe0, 0x01, 0x74, 0x80, 0xc3, 0x05, 0x16, 0x01,
+    0x74, 0xb1, 0xc3, 0x01, 0xa1, 0x01, 0x74, 0xb8, 0xc3, 0x05, 0x16, 0x01,
+    0x76, 0xa9, 0xc3, 0x01, 0xa1, 0x01, 0x76, 0xb0, 0xc3, 0x05, 0x16, 0x01,
+    0x75, 0x09, 0xc3, 0x01, 0xa1, 0x01, 0x75, 0x10, 0xc3, 0x05, 0x16, 0x01,
+    0x76, 0x69, 0xc3, 0x01, 0xa1, 0x01, 0x76, 0x70, 0xc4, 0xe1, 0xdc, 0x01,
+    0x77, 0x69, 0xc5, 0xd9, 0xfe, 0x01, 0x77, 0x90, 0xc2, 0x01, 0xa2, 0x01,
+    0x76, 0xf1, 0xc4, 0x03, 0xe0, 0x01, 0x76, 0xf8, 0xc2, 0x01, 0xa2, 0x01,
+    0x75, 0xf9, 0xc4, 0x03, 0xe0, 0x01, 0x76, 0x00, 0x92, 0x01, 0x8e, 0x59,
+    0x9c, 0x01, 0x8e, 0x72, 0x02, 0x41, 0xc3, 0x89, 0x01, 0x8e, 0x40, 0xd1,
+    0x46, 0x5b, 0x0f, 0xdc, 0x59, 0xd0, 0x04, 0x79, 0x01, 0x16, 0x60, 0x01,
+    0x42, 0x41, 0xc7, 0xd3, 0x01, 0x56, 0x01, 0x00, 0xc9, 0xd0, 0x5c, 0x72,
+    0x01, 0x71, 0x38, 0xc4, 0x25, 0x11, 0x0f, 0xab, 0x43, 0x02, 0x41, 0xdf,
+    0xca, 0x74, 0x4f, 0x0f, 0xaf, 0x48, 0x42, 0x00, 0x6d, 0xc2, 0x41, 0xe5,
+    0x09, 0x42, 0x41, 0xf1, 0x49, 0x01, 0xed, 0xc2, 0x42, 0x00, 0xd6, 0x13,
+    0xe5, 0x01, 0x4c, 0xa0, 0xcc, 0x0a, 0xfd, 0x01, 0x2c, 0xa9, 0xcd, 0x15,
+    0xdc, 0x0f, 0xdc, 0x38, 0x42, 0x00, 0xdb, 0xc2, 0x42, 0x0c, 0xcc, 0x04,
+    0x3d, 0x0f, 0xdc, 0x69, 0xcb, 0x8c, 0xaf, 0x0f, 0xdd, 0x99, 0xc6, 0x9b,
+    0x64, 0x0f, 0xdd, 0xd0, 0x01, 0x42, 0x42, 0x18, 0xca, 0xa4, 0xa2, 0x01,
+    0x1d, 0x01, 0xc9, 0x54, 0x6d, 0x01, 0x1c, 0xf9, 0xca, 0xa3, 0x3a, 0x01,
+    0x1c, 0xf0, 0xc7, 0xa9, 0x00, 0x01, 0x4b, 0xe9, 0xd0, 0x4d, 0x25, 0x0f,
+    0xdc, 0x48, 0x44, 0x00, 0xc3, 0xc2, 0x42, 0x2a, 0xd3, 0x43, 0x9a, 0x01,
+    0x70, 0x50, 0xcc, 0x88, 0xc8, 0x0f, 0xaf, 0x69, 0x44, 0x03, 0xe1, 0xc2,
+    0x42, 0x39, 0xde, 0x0a, 0xcb, 0x0f, 0xde, 0x18, 0xce, 0x01, 0x5b, 0x01,
+    0x00, 0xe9, 0xcc, 0x87, 0x78, 0x01, 0x4e, 0xd9, 0x03, 0xc2, 0x42, 0x45,
+    0xcb, 0x1a, 0x38, 0x01, 0x71, 0x48, 0xcb, 0x1a, 0x38, 0x01, 0x4c, 0x31,
+    0x05, 0xc2, 0x42, 0x51, 0xd2, 0x25, 0xdb, 0x01, 0x80, 0xb9, 0xd6, 0x06,
+    0xea, 0x01, 0x80, 0xc9, 0xce, 0x22, 0x37, 0x01, 0x80, 0xd8, 0x01, 0x42,
+    0x42, 0x5d, 0x45, 0x00, 0xc4, 0xc2, 0x42, 0x69, 0x44, 0x16, 0x57, 0x42,
+    0x42, 0x75, 0xcd, 0x7d, 0x73, 0x01, 0x0d, 0x01, 0x48, 0x02, 0xbc, 0x42,
+    0x42, 0x81, 0xcb, 0x74, 0x6b, 0x01, 0x0e, 0xe9, 0xca, 0x86, 0xd2, 0x0f,
+    0xc1, 0xd0, 0xd0, 0x5c, 0xd2, 0x0f, 0xc2, 0x11, 0xc5, 0x00, 0x83, 0x0f,
+    0xc2, 0x30, 0x46, 0x05, 0x35, 0xc2, 0x42, 0x8d, 0xc2, 0x00, 0x6c, 0x0f,
+    0xd7, 0x88, 0x45, 0x00, 0x92, 0xc2, 0x42, 0x99, 0x16, 0xc2, 0x42, 0xd5,
+    0xd4, 0x38, 0x7e, 0x01, 0x0e, 0x21, 0xc8, 0xb2, 0xfb, 0x01, 0x0d, 0x33,
+    0x02, 0x42, 0xe1, 0x03, 0x42, 0x42, 0xe7, 0xc5, 0x00, 0x83, 0x01, 0x0e,
+    0x93, 0x02, 0x42, 0xf3, 0xca, 0x50, 0xd6, 0x01, 0x48, 0x68, 0xd3, 0x45,
+    0x9b, 0x01, 0x5c, 0x51, 0xc5, 0x00, 0x83, 0x01, 0x5c, 0xa8, 0xca, 0x52,
+    0x3b, 0x00, 0x7e, 0xb8, 0xc7, 0x0c, 0xe7, 0x01, 0x0b, 0x6b, 0x02, 0x42,
+    0xfd, 0xc8, 0x53, 0xd0, 0x01, 0x0b, 0x7a, 0x02, 0x43, 0x03, 0xc3, 0x43,
+    0x20, 0x01, 0x0b, 0x63, 0x02, 0x43, 0x09, 0xc2, 0x00, 0x98, 0x01, 0x0b,
+    0x22, 0x02, 0x43, 0x0d, 0xca, 0xa1, 0xaa, 0x01, 0x0c, 0x28, 0xc9, 0x53,
+    0xcf, 0x01, 0x0c, 0x10, 0xc4, 0x23, 0xc6, 0x01, 0x0b, 0x59, 0x91, 0x01,
+    0x0b, 0x08, 0xc8, 0xbe, 0xf8, 0x08, 0x0c, 0x81, 0xc8, 0x45, 0xf2, 0x08,
+    0x0c, 0x98, 0x44, 0x1a, 0xd6, 0xc2, 0x43, 0x11, 0xcf, 0x0d, 0x12, 0x0f,
+    0xac, 0x80, 0x01, 0x42, 0x43, 0x17, 0xc7, 0x1b, 0x38, 0x00, 0x04, 0x69,
+    0xde, 0x0e, 0x8e, 0x0f, 0xbe, 0x40, 0xcf, 0x09, 0x5a, 0x01, 0x5a, 0x09,
+    0xd0, 0x02, 0xf9, 0x01, 0x5a, 0x38, 0xda, 0x19, 0xb0, 0x01, 0x30, 0xc9,
+    0xdf, 0x0d, 0x02, 0x0f, 0xac, 0x89, 0xca, 0x3a, 0xd7, 0x01, 0x5f, 0xf0,
+    0xc4, 0x20, 0x42, 0x01, 0x11, 0xeb, 0x02, 0x43, 0x29, 0xcb, 0x93, 0x58,
+    0x01, 0x01, 0xb9, 0x46, 0xd1, 0x0c, 0x42, 0x43, 0x2f, 0xd3, 0x44, 0x1f,
+    0x01, 0x0a, 0x19, 0xc8, 0x50, 0x47, 0x01, 0x02, 0x78, 0xcb, 0x8f, 0x4e,
+    0x01, 0x02, 0x59, 0xc4, 0x16, 0x42, 0x01, 0x01, 0xa8, 0xc5, 0x16, 0x41,
+    0x01, 0x01, 0xb3, 0x02, 0x43, 0x3b, 0xcf, 0x64, 0x0d, 0x01, 0x57, 0x68,
+    0xce, 0x54, 0x24, 0x01, 0x4d, 0x28, 0xca, 0xa1, 0xf0, 0x01, 0x33, 0xc9,
+    0xca, 0xa2, 0xcc, 0x01, 0x33, 0xc1, 0xca, 0xa4, 0xfc, 0x01, 0x33, 0xb9,
+    0xca, 0xa5, 0x42, 0x01, 0x33, 0xb1, 0xca, 0xa5, 0x88, 0x01, 0x33, 0xa9,
+    0xca, 0xa4, 0x0c, 0x01, 0x33, 0xa1, 0xca, 0xa3, 0xe4, 0x01, 0x33, 0x98,
+    0x83, 0x05, 0x4a, 0x71, 0x97, 0x05, 0x4a, 0x68, 0x97, 0x05, 0x4a, 0x61,
+    0x8b, 0x05, 0x4a, 0x50, 0xc2, 0x21, 0x7d, 0x05, 0x4a, 0x29, 0x83, 0x05,
+    0x49, 0xd8, 0xc2, 0x00, 0xeb, 0x05, 0x4a, 0x19, 0x83, 0x05, 0x49, 0x90,
+    0xc8, 0x0c, 0xe6, 0x08, 0x73, 0xc1, 0xc2, 0x0c, 0xf3, 0x08, 0x73, 0x78,
+    0xc8, 0x0c, 0xe6, 0x08, 0x73, 0xb9, 0xc2, 0x0c, 0xf3, 0x08, 0x73, 0x70,
+    0xca, 0x26, 0x60, 0x08, 0x73, 0xb1, 0xc3, 0x43, 0x20, 0x08, 0x73, 0x68,
+    0xca, 0xa3, 0xa8, 0x08, 0x73, 0xa9, 0xc3, 0x0c, 0xf2, 0x08, 0x73, 0x60,
+    0xcb, 0x12, 0xac, 0x08, 0x73, 0xa1, 0xc4, 0x0c, 0xf1, 0x08, 0x73, 0x58,
+    0xc9, 0x17, 0xec, 0x08, 0x73, 0x99, 0xc4, 0x17, 0xf9, 0x08, 0x73, 0x50,
+    0x4d, 0x7e, 0x36, 0xc2, 0x43, 0x41, 0xcd, 0x7d, 0xf5, 0x00, 0xb5, 0x00,
+    0x91, 0x00, 0xb7, 0x99, 0xce, 0x6b, 0xc4, 0x00, 0xb6, 0xf9, 0xc5, 0xd3,
+    0xa5, 0x00, 0xb6, 0xa9, 0x90, 0x00, 0xb5, 0x81, 0x87, 0x00, 0xb5, 0x79,
+    0xc3, 0x00, 0x75, 0x00, 0xb5, 0x48, 0x8a, 0x00, 0xb7, 0x93, 0x02, 0x43,
+    0x57, 0xc3, 0x0c, 0x85, 0x00, 0xb7, 0x29, 0xd6, 0x2d, 0xa6, 0x00, 0xb6,
+    0x59, 0xc7, 0xc4, 0x28, 0x00, 0xb6, 0x50, 0x43, 0x38, 0x9b, 0x42, 0x43,
+    0x5d, 0xcb, 0x98, 0xd8, 0x00, 0xb7, 0x41, 0xc2, 0x00, 0x4b, 0x00, 0xb7,
+    0x09, 0xc2, 0x00, 0xb2, 0x00, 0xb6, 0xeb, 0x02, 0x43, 0x67, 0xc7, 0xc8,
+    0xdc, 0x00, 0xb6, 0x39, 0xcc, 0x84, 0x0c, 0x00, 0xb6, 0x08, 0x4b, 0x2d,
+    0xac, 0xc2, 0x43, 0x6d, 0xd1, 0x4f, 0x9d, 0x00, 0xb6, 0xd0, 0x07, 0xc2,
+    0x43, 0x8b, 0xc3, 0x64, 0xf4, 0x00, 0xb7, 0x19, 0xc6, 0xcb, 0x30, 0x00,
+    0xb7, 0x10, 0xc2, 0x00, 0x72, 0x00, 0xb7, 0x01, 0xc9, 0xad, 0xe1, 0x00,
+    0xb6, 0xb1, 0xc2, 0x00, 0xb2, 0x00, 0xb5, 0xb1, 0xc2, 0x00, 0x60, 0x00,
+    0xb5, 0x38, 0xcb, 0x98, 0x75, 0x00, 0xb6, 0xf1, 0x46, 0xd0, 0x46, 0x42,
+    0x43, 0x95, 0xce, 0x72, 0xe0, 0x00, 0xb6, 0x79, 0xd3, 0x42, 0x44, 0x00,
+    0xb5, 0x30, 0xca, 0xa5, 0xa6, 0x00, 0xb6, 0x49, 0xc3, 0x21, 0xad, 0x00,
+    0xb5, 0x59, 0xc3, 0x16, 0x0a, 0x00, 0xb5, 0x51, 0xc6, 0xcc, 0x92, 0x00,
+    0xb5, 0x40, 0x07, 0xc2, 0x43, 0xa1, 0xc2, 0x00, 0x72, 0x00, 0xb5, 0xc0,
+    0xc5, 0xd6, 0x25, 0x00, 0xb5, 0xd9, 0xc6, 0xca, 0x9a, 0x00, 0xb5, 0xd0,
+    0xcb, 0x99, 0xca, 0x00, 0xb5, 0xc8, 0x94, 0x00, 0xb5, 0x18, 0xca, 0xa6,
+    0x50, 0x0f, 0xd2, 0x43, 0x02, 0x43, 0xab, 0xc4, 0xde, 0xd0, 0x01, 0x32,
+    0xb3, 0x02, 0x43, 0xb1, 0xc4, 0xe3, 0x24, 0x01, 0x32, 0xcb, 0x02, 0x43,
+    0xb7, 0x0d, 0xc2, 0x43, 0xbd, 0xc6, 0xd1, 0xd8, 0x01, 0x32, 0xbb, 0x02,
+    0x43, 0xcf, 0xc5, 0xb0, 0x06, 0x01, 0x32, 0xab, 0x02, 0x43, 0xd5, 0x47,
+    0x46, 0x0d, 0x42, 0x43, 0xdb, 0x01, 0x42, 0x43, 0xf7, 0x46, 0x00, 0x91,
+    0x42, 0x44, 0x03, 0x03, 0xc2, 0x44, 0x0f, 0xc5, 0xc0, 0x17, 0x01, 0x59,
+    0x08, 0xc7, 0xc6, 0xdd, 0x01, 0x4e, 0xb1, 0xd0, 0x57, 0xa2, 0x01, 0x59,
+    0x68, 0x01, 0x42, 0x44, 0x1e, 0x01, 0x42, 0x44, 0x30, 0xca, 0x85, 0xfa,
+    0x01, 0x31, 0xd1, 0x44, 0x00, 0xb7, 0x42, 0x44, 0x3f, 0xc9, 0x8c, 0xfe,
+    0x0f, 0xaa, 0x31, 0xca, 0xa1, 0xd2, 0x01, 0x58, 0xe0, 0x01, 0xc2, 0x44,
+    0x49, 0x4a, 0x01, 0x4b, 0x42, 0x44, 0x55, 0xe0, 0x0a, 0x29, 0x0f, 0xbd,
+    0x00, 0x01, 0x42, 0x44, 0x67, 0xc4, 0x59, 0xa6, 0x01, 0x36, 0x09, 0xc3,
+    0x12, 0xf2, 0x01, 0x36, 0x00, 0x4a, 0x09, 0x9f, 0xc2, 0x44, 0x7f, 0x4a,
+    0x01, 0x4b, 0x42, 0x44, 0x91, 0x46, 0x00, 0xc3, 0xc2, 0x44, 0x9d, 0xc7,
+    0xc8, 0x8f, 0x01, 0x1f, 0x10, 0x11, 0xc2, 0x44, 0xa3, 0xc2, 0x00, 0xea,
+    0x01, 0x34, 0x82, 0x02, 0x44, 0xaf, 0xc4, 0x0d, 0xf4, 0x01, 0x39, 0x39,
+    0xc4, 0x10, 0x84, 0x01, 0x5e, 0x70, 0x4a, 0x09, 0x9f, 0xc2, 0x44, 0xb5,
+    0x4a, 0x01, 0x4b, 0x42, 0x44, 0xc1, 0xc5, 0x0a, 0xe4, 0x01, 0x30, 0xe9,
+    0xce, 0x24, 0xa7, 0x0f, 0xa2, 0x30, 0xc8, 0x00, 0xc1, 0x01, 0x2d, 0x9b,
+    0x02, 0x44, 0xd1, 0xce, 0x73, 0x34, 0x01, 0x2d, 0xa9, 0xc7, 0xbf, 0xba,
+    0x0f, 0xde, 0x50, 0x15, 0xc2, 0x44, 0xd7, 0xc7, 0x3f, 0x57, 0x01, 0x59,
+    0x31, 0xc7, 0x0a, 0x42, 0x01, 0x59, 0x40, 0xc4, 0x2c, 0x09, 0x0f, 0x9f,
+    0x89, 0xc5, 0xb5, 0x8b, 0x01, 0x59, 0x00, 0xc9, 0x43, 0x2e, 0x01, 0x2d,
+    0x79, 0xc3, 0x02, 0xca, 0x01, 0x57, 0xf1, 0xc7, 0x57, 0xab, 0x01, 0x59,
+    0x78, 0xc4, 0x17, 0xf7, 0x0f, 0x17, 0xb9, 0xc2, 0x24, 0x36, 0x0f, 0x17,
+    0xb0, 0xc3, 0x0c, 0xf7, 0x0f, 0x17, 0xa9, 0xc3, 0x04, 0xa0, 0x0f, 0x17,
+    0xa0, 0xc4, 0x03, 0xe0, 0x0f, 0x17, 0x99, 0xc2, 0x01, 0xa2, 0x0f, 0x17,
+    0x90, 0xc2, 0x00, 0xb0, 0x0f, 0x17, 0x78, 0xc2, 0x00, 0xb0, 0x0f, 0x17,
+    0x68, 0xc2, 0x12, 0x9d, 0x0f, 0x17, 0x59, 0x83, 0x0f, 0x16, 0x30, 0xc2,
+    0x00, 0x79, 0x0f, 0x17, 0x50, 0xc2, 0x1a, 0x18, 0x0f, 0x17, 0x49, 0xc2,
+    0x00, 0xeb, 0x0f, 0x16, 0xe9, 0x83, 0x0f, 0x16, 0x48, 0x83, 0x0f, 0x16,
+    0x03, 0x02, 0x44, 0xe9, 0xc2, 0x00, 0xb2, 0x0f, 0x17, 0x21, 0x97, 0x0f,
+    0x16, 0xb0, 0x90, 0x0f, 0x17, 0x38, 0x90, 0x0f, 0x17, 0x32, 0x02, 0x44,
+    0xf0, 0xc2, 0x00, 0xb2, 0x0f, 0x17, 0x28, 0xc2, 0x00, 0x3b, 0x0f, 0x17,
+    0x09, 0xc2, 0x0d, 0x01, 0x0f, 0x17, 0x01, 0xc2, 0x00, 0xce, 0x0f, 0x16,
+    0x61, 0x83, 0x0f, 0x16, 0x58, 0xc3, 0x88, 0x73, 0x0f, 0x16, 0xf9, 0x83,
+    0x0f, 0x16, 0x40, 0xc2, 0x00, 0xce, 0x0f, 0x16, 0xc9, 0x83, 0x0f, 0x16,
+    0xa0, 0xc2, 0x00, 0xce, 0x0f, 0x16, 0x79, 0x83, 0x0f, 0x16, 0x70, 0x83,
+    0x0f, 0x16, 0x51, 0xc2, 0x00, 0xce, 0x0f, 0x16, 0x38, 0xc6, 0x17, 0xf7,
+    0x08, 0xc7, 0x81, 0xc4, 0xcb, 0x72, 0x08, 0xc7, 0x78, 0xc4, 0x43, 0x1f,
+    0x08, 0xc7, 0x71, 0xc4, 0x4b, 0x50, 0x08, 0xc7, 0x68, 0xc5, 0x0c, 0xf0,
+    0x08, 0xc7, 0x61, 0xc5, 0x26, 0x6c, 0x08, 0xc7, 0x59, 0xc2, 0x00, 0x79,
+    0x08, 0xc7, 0x50, 0xc4, 0x17, 0xf7, 0x08, 0xc7, 0x39, 0xc2, 0x24, 0x36,
+    0x08, 0xc7, 0x30, 0xc3, 0x0c, 0xf7, 0x08, 0xc7, 0x29, 0xc3, 0x04, 0xa0,
+    0x08, 0xc7, 0x20, 0xc4, 0x03, 0xe0, 0x08, 0xc7, 0x19, 0xc2, 0x01, 0xa2,
+    0x08, 0xc7, 0x10, 0xc2, 0x25, 0x71, 0x08, 0xc6, 0xf1, 0xc3, 0xa2, 0x70,
+    0x08, 0xc6, 0xe8, 0xc2, 0x00, 0x72, 0x08, 0xc6, 0xe1, 0x11, 0xc2, 0x44,
+    0xf4, 0xc3, 0xb6, 0x79, 0x08, 0xc6, 0xc8, 0x8f, 0x08, 0xc6, 0xb1, 0x96,
+    0x08, 0xc6, 0xa9, 0xc2, 0x00, 0xb2, 0x08, 0xc6, 0x50, 0xc3, 0x38, 0x9c,
+    0x08, 0xc6, 0x99, 0xc3, 0x56, 0x97, 0x08, 0xc6, 0x00, 0xc2, 0x01, 0x35,
+    0x08, 0xc6, 0x88, 0x10, 0x42, 0x45, 0x00, 0x85, 0x08, 0xc6, 0x79, 0x97,
+    0x08, 0xc6, 0x38, 0x97, 0x08, 0xc6, 0x1b, 0x02, 0x45, 0x08, 0x91, 0x08,
+    0xc6, 0x29, 0x83, 0x08, 0xc6, 0x20, 0xc2, 0x25, 0x71, 0x08, 0xc5, 0xf1,
+    0xc3, 0xa2, 0x70, 0x08, 0xc5, 0xe8, 0xc2, 0x00, 0x72, 0x08, 0xc5, 0xe1,
+    0x11, 0xc2, 0x45, 0x0c, 0xc3, 0xb6, 0x79, 0x08, 0xc5, 0xc8, 0x8f, 0x08,
+    0xc5, 0xb1, 0x96, 0x08, 0xc5, 0xa9, 0xc2, 0x00, 0xb2, 0x08, 0xc5, 0x50,
+    0xc3, 0x38, 0x9c, 0x08, 0xc5, 0x99, 0xc3, 0x56, 0x97, 0x08, 0xc5, 0x00,
+    0xc2, 0x01, 0x35, 0x08, 0xc5, 0x88, 0x10, 0x42, 0x45, 0x18, 0x85, 0x08,
+    0xc5, 0x79, 0x97, 0x08, 0xc5, 0x38, 0x97, 0x08, 0xc5, 0x1b, 0x02, 0x45,
+    0x20, 0x91, 0x08, 0xc5, 0x29, 0x83, 0x08, 0xc5, 0x20, 0xd3, 0x44, 0xca,
+    0x01, 0x39, 0x29, 0x43, 0x03, 0x81, 0x42, 0x45, 0x24, 0xc4, 0x01, 0x65,
+    0x01, 0x02, 0xd9, 0xcb, 0x05, 0x1e, 0x01, 0x02, 0xc0, 0x12, 0xc2, 0x45,
+    0x2a, 0xcc, 0x88, 0x2c, 0x0f, 0xc8, 0xa9, 0x11, 0xc2, 0x45, 0x3c, 0xcf,
+    0x67, 0x82, 0x0f, 0xb1, 0x21, 0x16, 0xc2, 0x45, 0x4e, 0x42, 0x00, 0xaa,
+    0xc2, 0x45, 0x5a, 0xd0, 0x58, 0xa2, 0x0f, 0xb0, 0xdb, 0x02, 0x45, 0x66,
+    0x0f, 0xc2, 0x45, 0x6c, 0xcc, 0x87, 0x84, 0x0f, 0xb2, 0x21, 0xcf, 0x69,
+    0x9e, 0x0f, 0xb2, 0x29, 0xdb, 0x19, 0x13, 0x0f, 0xc9, 0x59, 0xda, 0x19,
+    0xca, 0x0f, 0xcb, 0xa1, 0xce, 0x6e, 0x72, 0x0f, 0xd7, 0x20, 0xd0, 0x1d,
+    0xde, 0x01, 0x49, 0x79, 0xcf, 0x33, 0xbe, 0x01, 0x49, 0x60, 0xc4, 0x28,
+    0x74, 0x07, 0xf8, 0xc9, 0xc4, 0x18, 0xa7, 0x07, 0xf8, 0x81, 0xc3, 0x05,
+    0x16, 0x07, 0xf8, 0x89, 0x16, 0xc2, 0x45, 0x78, 0x08, 0xc2, 0x45, 0x84,
+    0x15, 0xc2, 0x45, 0x90, 0xc5, 0x0a, 0xfd, 0x07, 0xf8, 0xc0, 0xc3, 0x0d,
+    0xc9, 0x07, 0xf8, 0xd1, 0x42, 0x04, 0x0e, 0x42, 0x45, 0x9c, 0xcc, 0x81,
+    0xcc, 0x07, 0xf8, 0xe1, 0x43, 0x00, 0x31, 0x42, 0x45, 0xa6, 0x4f, 0x09,
+    0x39, 0xc2, 0x45, 0xbe, 0x4d, 0x28, 0xa7, 0x42, 0x46, 0x26, 0xce, 0x22,
+    0x37, 0x07, 0xf9, 0xe9, 0xcd, 0x00, 0x34, 0x07, 0xfa, 0xe9, 0xd1, 0x55,
+    0xdb, 0x07, 0xfb, 0x01, 0xcb, 0x1a, 0x38, 0x07, 0xf8, 0x48, 0xc9, 0xaf,
+    0x0a, 0x0f, 0x98, 0xd9, 0xc6, 0x07, 0xf3, 0x0f, 0x98, 0x98, 0x44, 0x1c,
+    0xa4, 0xc2, 0x46, 0x8e, 0xc3, 0x02, 0xea, 0x0b, 0x79, 0x90, 0xa7, 0x0b,
+    0x7c, 0xc9, 0xa6, 0x0b, 0x7c, 0xc1, 0xa5, 0x0b, 0x7c, 0xb9, 0xa4, 0x0b,
+    0x7c, 0xb1, 0xa3, 0x0b, 0x7c, 0xa9, 0xa2, 0x0b, 0x7c, 0xa1, 0xa1, 0x0b,
+    0x7c, 0x98, 0x87, 0x0b, 0x7a, 0x49, 0x83, 0x0b, 0x79, 0xb9, 0xc2, 0x00,
+    0xce, 0x0b, 0x79, 0x71, 0xc2, 0x0d, 0x01, 0x0b, 0x79, 0x50, 0xc2, 0x1a,
+    0x18, 0x0b, 0x78, 0xe1, 0x83, 0x0b, 0x78, 0xd0, 0xca, 0x50, 0x38, 0x0b,
+    0x7a, 0x80, 0xc2, 0x00, 0xce, 0x0b, 0x79, 0x69, 0x83, 0x0b, 0x79, 0x60,
+    0xc2, 0x00, 0xce, 0x0b, 0x79, 0x21, 0x83, 0x0b, 0x79, 0x18, 0xc2, 0x00,
+    0xce, 0x0b, 0x78, 0xa9, 0x83, 0x0b, 0x78, 0xa0, 0xc2, 0x13, 0x1a, 0x0b,
+    0x7a, 0x39, 0x83, 0x0b, 0x79, 0xc1, 0xc2, 0x00, 0xce, 0x0b, 0x79, 0x79,
+    0xc2, 0x01, 0x16, 0x0b, 0x79, 0x58, 0xc2, 0x1a, 0x18, 0x0b, 0x78, 0xe9,
+    0x83, 0x0b, 0x78, 0xd8, 0xc3, 0x98, 0x1d, 0x0b, 0x79, 0xf9, 0x10, 0xc2,
+    0x46, 0xa6, 0xc2, 0x00, 0xb6, 0x0b, 0x78, 0x30, 0x15, 0xc2, 0x46, 0xb0,
+    0xc2, 0x1a, 0x18, 0x0b, 0x7a, 0x01, 0x83, 0x0b, 0x79, 0xe8, 0x83, 0x0b,
+    0x79, 0xe1, 0xc2, 0x00, 0xce, 0x0b, 0x79, 0xb0, 0x15, 0xc2, 0x46, 0xba,
+    0x83, 0x0b, 0x78, 0x69, 0xc2, 0x00, 0x51, 0x0b, 0x78, 0x60, 0xc2, 0x00,
+    0xce, 0x0b, 0x79, 0x49, 0x83, 0x0b, 0x79, 0x40, 0xc2, 0x1a, 0x18, 0x0b,
+    0x78, 0xc9, 0x83, 0x0b, 0x78, 0xc0, 0x90, 0x0b, 0x7b, 0x62, 0x02, 0x46,
+    0xc4, 0xc2, 0x00, 0xb2, 0x0b, 0x7c, 0x30, 0x90, 0x0b, 0x7b, 0x1a, 0x02,
+    0x46, 0xc8, 0x94, 0x0b, 0x7b, 0xa8, 0x89, 0x0b, 0x7a, 0xf8, 0x94, 0x0b,
+    0x7c, 0x11, 0x9b, 0x0b, 0x7b, 0x00, 0x87, 0x0b, 0x7b, 0xa0, 0x89, 0x0b,
+    0x7a, 0xc0, 0x01, 0x42, 0x46, 0xcc, 0xcd, 0x0e, 0x9f, 0x0f, 0xbe, 0x19,
+    0xca, 0x23, 0xd3, 0x0f, 0xbe, 0x08, 0xc6, 0x09, 0x2b, 0x0f, 0xbc, 0x79,
+    0xc6, 0x00, 0x7c, 0x01, 0x35, 0x50, 0xd0, 0x5c, 0x62, 0x0f, 0xbc, 0x29,
+    0xcb, 0x89, 0x95, 0x01, 0x35, 0x58, 0x01, 0xc2, 0x46, 0xd8, 0xe0, 0x08,
+    0x49, 0x01, 0x3b, 0x68, 0x01, 0xc2, 0x46, 0xe4, 0xe0, 0x08, 0x49, 0x01,
+    0x3b, 0x60, 0x49, 0x32, 0x5a, 0xc2, 0x46, 0xf0, 0xd3, 0x3e, 0x47, 0x0f,
+    0xbd, 0x81, 0x4c, 0x0e, 0x93, 0x42, 0x46, 0xfc, 0xd1, 0x52, 0xef, 0x01,
+    0x35, 0x61, 0xc4, 0x04, 0x45, 0x01, 0x2c, 0x91, 0xc6, 0x13, 0x38, 0x0f,
+    0xbd, 0x51, 0x43, 0x4c, 0xa5, 0x42, 0x47, 0x08, 0xcf, 0x17, 0x39, 0x0f,
+    0xbd, 0xe1, 0xd2, 0x23, 0xcb, 0x0f, 0xbe, 0x70, 0x9b, 0x0b, 0x73, 0xfb,
+    0x02, 0x47, 0x14, 0x83, 0x0b, 0x73, 0x6b, 0x02, 0x47, 0x18, 0x91, 0x0b,
+    0x73, 0xeb, 0x02, 0x47, 0x22, 0x94, 0x0b, 0x73, 0xe1, 0x90, 0x0b, 0x73,
+    0xdb, 0x02, 0x47, 0x26, 0x86, 0x0b, 0x73, 0xc9, 0x9a, 0x0b, 0x73, 0xc1,
+    0x8a, 0x0b, 0x73, 0xb3, 0x02, 0x47, 0x2e, 0x93, 0x0b, 0x73, 0xa9, 0x8e,
+    0x0b, 0x73, 0xa1, 0x97, 0x0b, 0x73, 0x91, 0x85, 0x0b, 0x73, 0x89, 0x84,
+    0x0b, 0x73, 0x81, 0x87, 0x0b, 0x73, 0x79, 0x8c, 0x0b, 0x73, 0x71, 0x8d,
+    0x0b, 0x73, 0x63, 0x02, 0x47, 0x32, 0x8b, 0x0b, 0x73, 0x59, 0x88, 0x0b,
+    0x73, 0x51, 0x89, 0x0b, 0x73, 0x49, 0x96, 0x0b, 0x73, 0x41, 0x92, 0x0b,
+    0x73, 0x39, 0x9c, 0x0b, 0x73, 0x29, 0x99, 0x0b, 0x73, 0x19, 0x98, 0x0b,
+    0x73, 0x11, 0x95, 0x0b, 0x73, 0x09, 0x8f, 0x0b, 0x73, 0x00, 0x9b, 0x0b,
+    0x72, 0xfb, 0x02, 0x47, 0x36, 0x83, 0x0b, 0x72, 0x6b, 0x02, 0x47, 0x3a,
+    0x91, 0x0b, 0x72, 0xeb, 0x02, 0x47, 0x44, 0x94, 0x0b, 0x72, 0xe1, 0x90,
+    0x0b, 0x72, 0xdb, 0x02, 0x47, 0x48, 0x86, 0x0b, 0x72, 0xc9, 0x9a, 0x0b,
+    0x72, 0xc1, 0x8a, 0x0b, 0x72, 0xb3, 0x02, 0x47, 0x50, 0x93, 0x0b, 0x72,
+    0xa9, 0x8e, 0x0b, 0x72, 0xa1, 0x97, 0x0b, 0x72, 0x91, 0x85, 0x0b, 0x72,
+    0x89, 0x84, 0x0b, 0x72, 0x81, 0x87, 0x0b, 0x72, 0x79, 0x8c, 0x0b, 0x72,
+    0x71, 0x8d, 0x0b, 0x72, 0x63, 0x02, 0x47, 0x54, 0x8b, 0x0b, 0x72, 0x59,
+    0x88, 0x0b, 0x72, 0x51, 0x89, 0x0b, 0x72, 0x49, 0x96, 0x0b, 0x72, 0x41,
+    0x92, 0x0b, 0x72, 0x39, 0x9c, 0x0b, 0x72, 0x29, 0x99, 0x0b, 0x72, 0x19,
+    0x98, 0x0b, 0x72, 0x11, 0x95, 0x0b, 0x72, 0x09, 0x8f, 0x0b, 0x72, 0x00,
+    0xc4, 0x03, 0xe0, 0x0b, 0x74, 0x1b, 0x02, 0x47, 0x58, 0xc2, 0x01, 0xa2,
+    0x0b, 0x74, 0x12, 0x02, 0x47, 0x5e, 0xcf, 0x6a, 0x7f, 0x0b, 0x74, 0xa0,
+    0xc4, 0x17, 0xf7, 0x0b, 0x74, 0x39, 0xc2, 0x24, 0x36, 0x0b, 0x74, 0x30,
+    0xc3, 0x0c, 0xf7, 0x0b, 0x74, 0x29, 0xc3, 0x04, 0xa0, 0x0b, 0x74, 0x20,
+    0xc7, 0x1e, 0xa8, 0x0b, 0x74, 0x91, 0xc5, 0x65, 0x84, 0x0b, 0x74, 0x58,
+    0xc8, 0x49, 0xb1, 0x0b, 0x74, 0x89, 0xc6, 0x43, 0xcd, 0x0b, 0x74, 0x80,
+    0xc6, 0x12, 0xb9, 0x0b, 0x74, 0x79, 0xc7, 0x52, 0x9a, 0x0b, 0x74, 0x70,
+    0xc7, 0x4f, 0xe1, 0x0b, 0x74, 0x69, 0xc5, 0x23, 0xc5, 0x0b, 0x74, 0x61,
+    0xc2, 0x00, 0x79, 0x0b, 0x74, 0x50, 0xc6, 0x07, 0xd1, 0x01, 0x1e, 0xb1,
+    0xc9, 0x66, 0x98, 0x01, 0x1e, 0xa8, 0x26, 0xc2, 0x47, 0x64, 0x27, 0xc2,
+    0x47, 0xa0, 0x21, 0xc2, 0x47, 0xdc, 0x20, 0xc2, 0x48, 0x18, 0x28, 0xc2,
+    0x48, 0x54, 0x24, 0xc2, 0x48, 0x90, 0x1f, 0xc2, 0x48, 0xcc, 0x23, 0xc2,
+    0x49, 0x02, 0x25, 0xc2, 0x49, 0x3e, 0x22, 0x42, 0x49, 0x7a, 0x28, 0xc2,
+    0x49, 0xb6, 0x22, 0xc2, 0x49, 0xe6, 0x20, 0xc2, 0x4a, 0x22, 0x25, 0xc2,
+    0x4a, 0x5e, 0x26, 0xc2, 0x4a, 0x9a, 0x23, 0xc2, 0x4a, 0xd6, 0x1f, 0xc2,
+    0x4b, 0x12, 0x24, 0xc2, 0x4b, 0x4e, 0x27, 0xc2, 0x4b, 0x8a, 0x21, 0x42,
+    0x4b, 0xc6, 0xc2, 0x01, 0xa2, 0x0f, 0x46, 0x41, 0xc4, 0x03, 0xe0, 0x0f,
+    0x46, 0x48, 0xc3, 0x04, 0xa0, 0x0f, 0x46, 0x51, 0xc3, 0x0c, 0xf7, 0x0f,
+    0x46, 0x58, 0xc2, 0x24, 0x36, 0x0f, 0x46, 0x61, 0xc4, 0x17, 0xf7, 0x0f,
+    0x46, 0x68, 0x07, 0xc2, 0x4c, 0x02, 0xc8, 0x4d, 0xa1, 0x0f, 0x46, 0x98,
+    0x95, 0x0f, 0x46, 0x91, 0xca, 0x9e, 0xbc, 0x0f, 0x46, 0xa8, 0x16, 0xc2,
+    0x4c, 0x0c, 0xcd, 0x7b, 0x9f, 0x08, 0x4f, 0xf1, 0x07, 0xc2, 0x4c, 0x1e,
+    0x15, 0xc2, 0x4c, 0x2a, 0x08, 0xc2, 0x4c, 0x36, 0x44, 0x05, 0x16, 0x42,
+    0x4c, 0x42, 0xc4, 0x28, 0x74, 0x08, 0x4e, 0x43, 0x02, 0x4c, 0x4e, 0xc5,
+    0x0a, 0xfd, 0x08, 0x4e, 0x3b, 0x02, 0x4c, 0x58, 0x15, 0xc2, 0x4c, 0x62,
+    0x08, 0xc2, 0x4c, 0x74, 0x16, 0xc2, 0x4c, 0x7c, 0xc3, 0x05, 0x16, 0x08,
+    0x4e, 0x02, 0x02, 0x4c, 0x8d, 0x48, 0x3c, 0xaa, 0xc2, 0x4c, 0x91, 0x46,
+    0x01, 0x93, 0x42, 0x4c, 0x9d, 0xc2, 0xe4, 0xe8, 0x08, 0x4c, 0xf8, 0xc2,
+    0x0e, 0x60, 0x08, 0x4c, 0xe9, 0x16, 0xc2, 0x4c, 0xfc, 0xc2, 0x0f, 0xba,
+    0x08, 0x4c, 0xb9, 0x0d, 0xc2, 0x4d, 0x0e, 0x15, 0xc2, 0x4d, 0x18, 0xc3,
+    0xe6, 0x0d, 0x08, 0x4c, 0x91, 0xc2, 0x00, 0x89, 0x08, 0x4c, 0x81, 0xc2,
+    0x00, 0x3b, 0x08, 0x4c, 0x73, 0x02, 0x4d, 0x23, 0x10, 0xc2, 0x4d, 0x29,
+    0xc2, 0x00, 0xb6, 0x08, 0x4c, 0x49, 0xc2, 0x04, 0xf2, 0x08, 0x4c, 0x41,
+    0xc2, 0x00, 0xa0, 0x08, 0x4c, 0x33, 0x02, 0x4d, 0x37, 0xc2, 0x00, 0x71,
+    0x08, 0x4c, 0x29, 0xc2, 0x1a, 0x18, 0x08, 0x4c, 0x21, 0x91, 0x08, 0x4c,
+    0x19, 0x8b, 0x08, 0x4c, 0x11, 0x87, 0x08, 0x4c, 0x09, 0x83, 0x08, 0x4c,
+    0x00, 0x47, 0x21, 0x5e, 0xc2, 0x4d, 0x3d, 0xcc, 0x88, 0x44, 0x01, 0x4c,
+    0xd8, 0x03, 0xc2, 0x4d, 0x43, 0x97, 0x05, 0x57, 0x71, 0xc3, 0x23, 0xf3,
+    0x05, 0x5f, 0x28, 0x97, 0x05, 0x57, 0x61, 0xc3, 0x23, 0xf3, 0x05, 0x5f,
+    0x40, 0x8b, 0x05, 0x57, 0x59, 0xc3, 0x23, 0xf3, 0x05, 0x5f, 0x20, 0xc2,
+    0x0d, 0x01, 0x05, 0x57, 0x51, 0xc2, 0x00, 0xce, 0x05, 0x57, 0x49, 0xc2,
+    0x03, 0x84, 0x05, 0x5e, 0x08, 0xc2, 0x03, 0x83, 0x05, 0x57, 0x41, 0xc2,
+    0x1a, 0x18, 0x05, 0x57, 0x19, 0x83, 0x05, 0x5e, 0x2b, 0x02, 0x4d, 0x4b,
+    0xc3, 0xc5, 0x62, 0x05, 0x5e, 0x4a, 0x02, 0x4d, 0x51, 0x06, 0xc2, 0x4d,
+    0x57, 0xc3, 0x15, 0xf4, 0x05, 0x5e, 0xc9, 0xc2, 0x01, 0xd7, 0x05, 0x5e,
+    0xb8, 0x16, 0xc2, 0x4d, 0x61, 0xc2, 0x01, 0xd7, 0x05, 0x5e, 0x3b, 0x02,
+    0x4d, 0x6b, 0xc3, 0x15, 0xf4, 0x05, 0x5e, 0x50, 0x83, 0x05, 0x57, 0x11,
+    0xc2, 0x01, 0xd7, 0x05, 0x5e, 0x30, 0xc2, 0x00, 0x58, 0x05, 0x5e, 0x03,
+    0x02, 0x4d, 0x71, 0xc3, 0x15, 0xf4, 0x05, 0x5e, 0x40, 0xc7, 0xc4, 0x75,
+    0x05, 0x5e, 0xe0, 0xc7, 0xc4, 0x75, 0x05, 0x5e, 0xe8, 0x83, 0x05, 0x5e,
+    0x23, 0x02, 0x4d, 0x77, 0xc3, 0x07, 0x2b, 0x05, 0x5e, 0x80, 0xc7, 0xc4,
+    0x75, 0x05, 0x5f, 0x10, 0xc2, 0x00, 0x58, 0x05, 0x5e, 0x91, 0xc3, 0x15,
+    0xf4, 0x05, 0x5e, 0xc0, 0xc3, 0x07, 0x2b, 0x05, 0x5e, 0xd1, 0x83, 0x05,
+    0x5e, 0xa8, 0xc3, 0x07, 0x2b, 0x05, 0x5e, 0x99, 0xc2, 0x01, 0xd7, 0x05,
+    0x5e, 0xb0, 0xc9, 0xb4, 0x8f, 0x0f, 0xb5, 0xa9, 0xc7, 0x62, 0x17, 0x0f,
+    0xb4, 0xf1, 0xc8, 0xbc, 0x50, 0x0f, 0xb5, 0x00, 0xc2, 0x00, 0xaf, 0x01,
+    0x34, 0x59, 0xc3, 0x00, 0xc4, 0x01, 0x34, 0x50, 0xe0, 0x03, 0x69, 0x08,
+    0xb3, 0x60, 0x46, 0x00, 0x91, 0x42, 0x4d, 0x7d, 0xcf, 0x03, 0x7a, 0x08,
+    0xb3, 0x31, 0xc8, 0x03, 0x81, 0x08, 0xb3, 0x28, 0xcf, 0x03, 0x7a, 0x08,
+    0xb3, 0x21, 0xc8, 0x03, 0x81, 0x08, 0xb3, 0x00, 0xc4, 0x28, 0x74, 0x00,
+    0xc0, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0xc0, 0xc1, 0x15, 0xc2, 0x4d, 0x89,
+    0x08, 0xc2, 0x4d, 0x95, 0x16, 0xc2, 0x4d, 0xa1, 0xc3, 0x05, 0x16, 0x00,
+    0xc0, 0x89, 0xc4, 0x18, 0xa7, 0x00, 0xc0, 0x80, 0x45, 0xc5, 0x0a, 0x42,
+    0x4d, 0xad, 0x48, 0xad, 0x76, 0xc2, 0x4d, 0xcf, 0xc2, 0x00, 0xb2, 0x00,
+    0xc1, 0x48, 0x44, 0x6a, 0x9d, 0xc2, 0x4e, 0x1b, 0xc2, 0x0d, 0x01, 0x00,
+    0xc1, 0xe1, 0x83, 0x00, 0xc1, 0x90, 0x83, 0x00, 0xc1, 0xa3, 0x02, 0x4e,
+    0x8c, 0x8b, 0x00, 0xc2, 0x10, 0x44, 0x13, 0x1b, 0xc2, 0x4e, 0x92, 0xc2,
+    0x00, 0xce, 0x00, 0xc1, 0x89, 0x83, 0x00, 0xc1, 0x80, 0xc2, 0x00, 0x0a,
+    0x00, 0xc2, 0x09, 0xc2, 0x00, 0x3b, 0x00, 0xc1, 0xf9, 0x83, 0x00, 0xc1,
+    0xe8, 0xc2, 0x00, 0xce, 0x00, 0xc2, 0x01, 0x83, 0x00, 0xc1, 0x78, 0xc2,
+    0x00, 0xce, 0x00, 0xc1, 0xd9, 0x83, 0x00, 0xc1, 0xd0, 0x87, 0x00, 0xc1,
+    0x38, 0x87, 0x00, 0xc1, 0x30, 0x87, 0x00, 0xc1, 0x28, 0xc4, 0x04, 0x9f,
+    0x00, 0xc0, 0x79, 0x16, 0xc2, 0x4e, 0xf4, 0xc3, 0x05, 0x16, 0x00, 0xc0,
+    0x58, 0x45, 0x04, 0x9a, 0xc2, 0x4f, 0x00, 0xcb, 0x8c, 0xe6, 0x08, 0xb2,
+    0x11, 0xc4, 0x19, 0xf1, 0x08, 0xb2, 0x08, 0xc4, 0xdf, 0x84, 0x08, 0xb2,
+    0x21, 0x03, 0xc2, 0x4f, 0x24, 0x42, 0x06, 0xb4, 0x42, 0x4f, 0x30, 0x03,
+    0xc2, 0x4f, 0x3c, 0x91, 0x08, 0xb1, 0xd9, 0x87, 0x08, 0xb1, 0xc9, 0x48,
+    0xaa, 0xd2, 0xc2, 0x4f, 0x48, 0x97, 0x08, 0xb1, 0x9b, 0x02, 0x4f, 0x56,
+    0x8b, 0x08, 0xb1, 0x8a, 0x02, 0x4f, 0x5a, 0x0e, 0xc2, 0x4f, 0x5e, 0xc2,
+    0x00, 0xce, 0x08, 0xb1, 0x71, 0x15, 0xc2, 0x4f, 0x68, 0x18, 0xc2, 0x4f,
+    0x78, 0xc2, 0x00, 0x3b, 0x08, 0xb1, 0x41, 0xc2, 0x1a, 0x18, 0x08, 0xb1,
+    0x39, 0xc2, 0x00, 0xb6, 0x08, 0xb1, 0x31, 0x04, 0xc2, 0x4f, 0x82, 0x12,
+    0xc2, 0x4f, 0x8c, 0x10, 0xc2, 0x4f, 0x96, 0x06, 0xc2, 0x4f, 0xac, 0x16,
+    0xc2, 0x4f, 0xba, 0x0c, 0xc2, 0x4f, 0xc8, 0x05, 0xc2, 0x4f, 0xd2, 0x09,
+    0xc2, 0x4f, 0xdc, 0x0d, 0xc2, 0x4f, 0xe6, 0x83, 0x08, 0xb0, 0x03, 0x02,
+    0x4f, 0xf0, 0x91, 0x08, 0xb0, 0x61, 0x87, 0x08, 0xb0, 0x51, 0x97, 0x08,
+    0xb0, 0x23, 0x02, 0x4f, 0xfc, 0x8b, 0x08, 0xb0, 0x12, 0x02, 0x50, 0x00,
+    0x15, 0xc2, 0x50, 0x04, 0x05, 0xc2, 0x50, 0x1a, 0x14, 0xc2, 0x50, 0x44,
+    0x0e, 0xc2, 0x50, 0x5a, 0x09, 0xc2, 0x50, 0x6c, 0x04, 0xc2, 0x50, 0x81,
+    0x06, 0xc2, 0x50, 0x8d, 0x03, 0xc2, 0x50, 0x97, 0x12, 0xc2, 0x50, 0xa9,
+    0x16, 0xc2, 0x50, 0xb5, 0x17, 0xc2, 0x50, 0xc1, 0x18, 0xc2, 0x50, 0xd1,
+    0x0f, 0xc2, 0x50, 0xdd, 0x07, 0xc2, 0x50, 0xe7, 0x0a, 0xc2, 0x50, 0xf3,
+    0x1b, 0xc2, 0x50, 0xff, 0xca, 0xa2, 0x54, 0x00, 0x17, 0xf0, 0x89, 0x0e,
+    0xa1, 0xd3, 0x02, 0x51, 0x0b, 0x88, 0x0e, 0xa1, 0xc9, 0x87, 0x0e, 0xa1,
+    0xc3, 0x02, 0x51, 0x11, 0x86, 0x0e, 0xa1, 0xbb, 0x02, 0x51, 0x1d, 0x85,
+    0x0e, 0xa1, 0xb3, 0x02, 0x51, 0x23, 0x84, 0x0e, 0xa1, 0xab, 0x02, 0x51,
+    0x29, 0x83, 0x0e, 0xa1, 0xa3, 0x02, 0x51, 0x2f, 0x91, 0x0e, 0xa2, 0x13,
+    0x02, 0x51, 0x35, 0x92, 0x0e, 0xa2, 0x1b, 0x02, 0x51, 0x39, 0x97, 0x0e,
+    0xa2, 0x43, 0x02, 0x51, 0x49, 0x96, 0x0e, 0xa2, 0x3b, 0x02, 0x51, 0x4f,
+    0x95, 0x0e, 0xa2, 0x33, 0x02, 0x51, 0x5e, 0x94, 0x0e, 0xa2, 0x2b, 0x02,
+    0x51, 0x64, 0x9a, 0x0e, 0xa2, 0x5b, 0x02, 0x51, 0x6a, 0x90, 0x0e, 0xa2,
+    0x0b, 0x02, 0x51, 0x6e, 0x8f, 0x0e, 0xa2, 0x03, 0x02, 0x51, 0x72, 0x8e,
+    0x0e, 0xa1, 0xfb, 0x02, 0x51, 0x76, 0x8d, 0x0e, 0xa1, 0xf3, 0x02, 0x51,
+    0x7c, 0x8b, 0x0e, 0xa1, 0xe3, 0x02, 0x51, 0x82, 0x9c, 0x0e, 0xa2, 0x6b,
+    0x02, 0x51, 0x88, 0x9b, 0x0e, 0xa2, 0x61, 0x99, 0x0e, 0xa2, 0x51, 0x98,
+    0x0e, 0xa2, 0x49, 0x93, 0x0e, 0xa2, 0x21, 0x8c, 0x0e, 0xa1, 0xe9, 0x8a,
+    0x0e, 0xa1, 0xd8, 0xc8, 0xa0, 0x8a, 0x0e, 0xb8, 0xd9, 0xc9, 0xaa, 0x4b,
+    0x0e, 0xb8, 0xc9, 0xd3, 0x41, 0x01, 0x0e, 0xb8, 0xa8, 0x91, 0x0e, 0xa2,
+    0xe3, 0x02, 0x51, 0x8e, 0x92, 0x0e, 0xa2, 0xeb, 0x02, 0x51, 0x92, 0x85,
+    0x0e, 0xa2, 0x83, 0x02, 0x51, 0xa2, 0x97, 0x0e, 0xa3, 0x13, 0x02, 0x51,
+    0xa8, 0x96, 0x0e, 0xa3, 0x0b, 0x02, 0x51, 0xae, 0x95, 0x0e, 0xa3, 0x03,
+    0x02, 0x51, 0xba, 0x88, 0x0e, 0xa2, 0x9b, 0x02, 0x51, 0xc0, 0x94, 0x0e,
+    0xa2, 0xfb, 0x02, 0x51, 0xc6, 0x9a, 0x0e, 0xa3, 0x2b, 0x02, 0x51, 0xcc,
+    0x90, 0x0e, 0xa2, 0xdb, 0x02, 0x51, 0xd0, 0x8f, 0x0e, 0xa2, 0xd3, 0x02,
+    0x51, 0xd4, 0x8e, 0x0e, 0xa2, 0xcb, 0x02, 0x51, 0xd8, 0x8d, 0x0e, 0xa2,
+    0xc3, 0x02, 0x51, 0xde, 0x8b, 0x0e, 0xa2, 0xb3, 0x02, 0x51, 0xe4, 0x87,
+    0x0e, 0xa2, 0x93, 0x02, 0x51, 0xea, 0x9c, 0x0e, 0xa3, 0x3b, 0x02, 0x51,
+    0xf6, 0x86, 0x0e, 0xa2, 0x8b, 0x02, 0x51, 0xfc, 0x89, 0x0e, 0xa2, 0xa3,
+    0x02, 0x52, 0x08, 0x84, 0x0e, 0xa2, 0x7b, 0x02, 0x52, 0x0e, 0x83, 0x0e,
+    0xa2, 0x73, 0x02, 0x52, 0x14, 0x9b, 0x0e, 0xa3, 0x31, 0x99, 0x0e, 0xa3,
+    0x21, 0x98, 0x0e, 0xa3, 0x19, 0x93, 0x0e, 0xa2, 0xf1, 0x8c, 0x0e, 0xa2,
+    0xb8, 0x45, 0x00, 0xb6, 0xc2, 0x52, 0x1a, 0x46, 0x02, 0x11, 0x42, 0x52,
+    0xbe, 0xc4, 0x28, 0x74, 0x0e, 0xbe, 0xb9, 0xc5, 0x0a, 0xfd, 0x0e, 0xbe,
+    0xb1, 0x15, 0xc2, 0x52, 0xca, 0x08, 0xc2, 0x52, 0xd6, 0x16, 0xc2, 0x52,
+    0xe2, 0xc3, 0x05, 0x16, 0x0e, 0xbe, 0x79, 0xc4, 0x18, 0xa7, 0x0e, 0xbe,
+    0x70, 0x86, 0x0e, 0xa0, 0x1b, 0x02, 0x52, 0xee, 0x91, 0x0e, 0xa0, 0x73,
+    0x02, 0x52, 0xfa, 0x92, 0x0e, 0xa0, 0x7b, 0x02, 0x52, 0xfe, 0x85, 0x0e,
+    0xa0, 0x13, 0x02, 0x53, 0x0e, 0x97, 0x0e, 0xa0, 0xa3, 0x02, 0x53, 0x14,
+    0x96, 0x0e, 0xa0, 0x9b, 0x02, 0x53, 0x1a, 0x95, 0x0e, 0xa0, 0x93, 0x02,
+    0x53, 0x29, 0x94, 0x0e, 0xa0, 0x8b, 0x02, 0x53, 0x2f, 0x9a, 0x0e, 0xa0,
+    0xbb, 0x02, 0x53, 0x35, 0x90, 0x0e, 0xa0, 0x6b, 0x02, 0x53, 0x39, 0x8f,
+    0x0e, 0xa0, 0x63, 0x02, 0x53, 0x3d, 0x8e, 0x0e, 0xa0, 0x5b, 0x02, 0x53,
+    0x41, 0x8d, 0x0e, 0xa0, 0x53, 0x02, 0x53, 0x47, 0x8b, 0x0e, 0xa0, 0x43,
+    0x02, 0x53, 0x4d, 0x87, 0x0e, 0xa0, 0x23, 0x02, 0x53, 0x53, 0x9c, 0x0e,
+    0xa0, 0xcb, 0x02, 0x53, 0x5f, 0x89, 0x0e, 0xa0, 0x33, 0x02, 0x53, 0x65,
+    0x84, 0x0e, 0xa0, 0x0b, 0x02, 0x53, 0x6b, 0x83, 0x0e, 0xa0, 0x03, 0x02,
+    0x53, 0x71, 0x9b, 0x0e, 0xa0, 0xc1, 0x99, 0x0e, 0xa0, 0xb1, 0x98, 0x0e,
+    0xa0, 0xa9, 0x93, 0x0e, 0xa0, 0x81, 0x8c, 0x0e, 0xa0, 0x49, 0x8a, 0x0e,
+    0xa0, 0x39, 0x88, 0x0e, 0xa0, 0x28, 0x12, 0xc2, 0x53, 0x77, 0xca, 0xa1,
+    0x5a, 0x0e, 0xba, 0xa1, 0xcc, 0x88, 0xd4, 0x0e, 0xba, 0x91, 0xcc, 0x8a,
+    0x90, 0x0e, 0xba, 0x89, 0xce, 0x11, 0xb9, 0x0e, 0xba, 0x81, 0x46, 0x00,
+    0xb5, 0xc2, 0x53, 0x89, 0xc5, 0xda, 0x3a, 0x0e, 0xb9, 0xa9, 0x48, 0x09,
+    0x39, 0x42, 0x54, 0x2d, 0xc8, 0xa0, 0x8a, 0x0e, 0xb7, 0x09, 0xc9, 0xaa,
+    0x4b, 0x0e, 0xb6, 0xf9, 0xd3, 0x41, 0x01, 0x0e, 0xb6, 0xd8, 0x46, 0x00,
+    0xb5, 0xc2, 0x54, 0xce, 0x48, 0x09, 0x39, 0x42, 0x55, 0x36, 0xc4, 0x28,
+    0x74, 0x0e, 0xbf, 0xf9, 0xc5, 0x0a, 0xfd, 0x0e, 0xbf, 0xf1, 0x15, 0xc2,
+    0x55, 0x9e, 0x08, 0xc2, 0x55, 0xaa, 0x16, 0xc2, 0x55, 0xb6, 0xc3, 0x05,
+    0x16, 0x0e, 0xbf, 0xb9, 0xc4, 0x18, 0xa7, 0x0e, 0xbf, 0xb0, 0x9c, 0x0e,
+    0xb5, 0x19, 0x9b, 0x0e, 0xb5, 0x11, 0x9a, 0x0e, 0xb5, 0x09, 0x99, 0x0e,
+    0xb5, 0x01, 0x98, 0x0e, 0xb4, 0xf9, 0x97, 0x0e, 0xb4, 0xf1, 0x96, 0x0e,
+    0xb4, 0xe9, 0x95, 0x0e, 0xb4, 0xe1, 0x94, 0x0e, 0xb4, 0xd9, 0x93, 0x0e,
+    0xb4, 0xd1, 0x92, 0x0e, 0xb4, 0xc9, 0x91, 0x0e, 0xb4, 0xc1, 0x90, 0x0e,
+    0xb4, 0xb9, 0x8f, 0x0e, 0xb4, 0xb1, 0x8e, 0x0e, 0xb4, 0xa9, 0x8d, 0x0e,
+    0xb4, 0xa1, 0x8c, 0x0e, 0xb4, 0x99, 0x8b, 0x0e, 0xb4, 0x91, 0x8a, 0x0e,
+    0xb4, 0x89, 0x89, 0x0e, 0xb4, 0x81, 0x88, 0x0e, 0xb4, 0x79, 0x87, 0x0e,
+    0xb4, 0x71, 0x86, 0x0e, 0xb4, 0x69, 0x85, 0x0e, 0xb4, 0x61, 0x84, 0x0e,
+    0xb4, 0x59, 0x83, 0x0e, 0xb4, 0x50, 0x9c, 0x0e, 0xb4, 0x49, 0x9b, 0x0e,
+    0xb4, 0x41, 0x9a, 0x0e, 0xb4, 0x39, 0x99, 0x0e, 0xb4, 0x31, 0x98, 0x0e,
+    0xb4, 0x29, 0x97, 0x0e, 0xb4, 0x21, 0x96, 0x0e, 0xb4, 0x19, 0x95, 0x0e,
+    0xb4, 0x11, 0x94, 0x0e, 0xb4, 0x09, 0x93, 0x0e, 0xb4, 0x01, 0x92, 0x0e,
+    0xb3, 0xf9, 0x91, 0x0e, 0xb3, 0xf1, 0x90, 0x0e, 0xb3, 0xe9, 0x8f, 0x0e,
+    0xb3, 0xe1, 0x8e, 0x0e, 0xb3, 0xd9, 0x8d, 0x0e, 0xb3, 0xd1, 0x8c, 0x0e,
+    0xb3, 0xc9, 0x8b, 0x0e, 0xb3, 0xc1, 0x8a, 0x0e, 0xb3, 0xb9, 0x89, 0x0e,
+    0xb3, 0xb1, 0x88, 0x0e, 0xb3, 0xa9, 0x87, 0x0e, 0xb3, 0xa1, 0x86, 0x0e,
+    0xb3, 0x99, 0x85, 0x0e, 0xb3, 0x91, 0x84, 0x0e, 0xb3, 0x89, 0x83, 0x0e,
+    0xb3, 0x80, 0x45, 0x5f, 0x82, 0xc2, 0x55, 0xc2, 0x46, 0x04, 0x99, 0xc2,
+    0x55, 0xfc, 0x47, 0xc8, 0x49, 0xc2, 0x56, 0x20, 0x46, 0x00, 0xb5, 0xc2,
+    0x56, 0x2c, 0x48, 0x09, 0x39, 0x42, 0x56, 0x94, 0x46, 0x00, 0xb5, 0xc2,
+    0x56, 0xfc, 0x48, 0x09, 0x39, 0x42, 0x57, 0x58, 0xc4, 0x28, 0x74, 0x0e,
+    0xbf, 0x09, 0xc5, 0x0a, 0xfd, 0x0e, 0xbf, 0x01, 0x15, 0xc2, 0x57, 0xa0,
+    0x08, 0xc2, 0x57, 0xac, 0x16, 0xc2, 0x57, 0xb8, 0xc3, 0x05, 0x16, 0x0e,
+    0xbe, 0xc9, 0xc4, 0x18, 0xa7, 0x0e, 0xbe, 0xc0, 0x9c, 0x0e, 0xab, 0x59,
+    0x9b, 0x0e, 0xab, 0x51, 0x9a, 0x0e, 0xab, 0x49, 0x99, 0x0e, 0xab, 0x41,
+    0x98, 0x0e, 0xab, 0x39, 0x97, 0x0e, 0xab, 0x31, 0x96, 0x0e, 0xab, 0x29,
+    0x95, 0x0e, 0xab, 0x21, 0x94, 0x0e, 0xab, 0x19, 0x93, 0x0e, 0xab, 0x11,
+    0x92, 0x0e, 0xab, 0x09, 0x91, 0x0e, 0xab, 0x01, 0x90, 0x0e, 0xaa, 0xf9,
+    0x8f, 0x0e, 0xaa, 0xf1, 0x8e, 0x0e, 0xaa, 0xe9, 0x8d, 0x0e, 0xaa, 0xe1,
+    0x8c, 0x0e, 0xaa, 0xd9, 0x8b, 0x0e, 0xaa, 0xd1, 0x8a, 0x0e, 0xaa, 0xc9,
+    0x89, 0x0e, 0xaa, 0xc1, 0x88, 0x0e, 0xaa, 0xb9, 0x87, 0x0e, 0xaa, 0xb1,
+    0x86, 0x0e, 0xaa, 0xa9, 0x85, 0x0e, 0xaa, 0xa1, 0x84, 0x0e, 0xaa, 0x99,
+    0x83, 0x0e, 0xaa, 0x90, 0x9b, 0x0e, 0xaa, 0x81, 0x9a, 0x0e, 0xaa, 0x79,
+    0x99, 0x0e, 0xaa, 0x71, 0x98, 0x0e, 0xaa, 0x69, 0x97, 0x0e, 0xaa, 0x61,
+    0x96, 0x0e, 0xaa, 0x59, 0x95, 0x0e, 0xaa, 0x51, 0x91, 0x0e, 0xaa, 0x31,
+    0x8f, 0x0e, 0xaa, 0x21, 0x8e, 0x0e, 0xaa, 0x19, 0x8d, 0x0e, 0xaa, 0x11,
+    0x8c, 0x0e, 0xaa, 0x09, 0x8b, 0x0e, 0xaa, 0x01, 0x89, 0x0e, 0xa9, 0xf1,
+    0x88, 0x0e, 0xa9, 0xe9, 0x87, 0x0e, 0xa9, 0xe1, 0x86, 0x0e, 0xa9, 0xd9,
+    0x84, 0x0e, 0xa9, 0xc9, 0x83, 0x0e, 0xa9, 0xc0, 0x46, 0x00, 0xb5, 0xc2,
+    0x57, 0xc4, 0x48, 0x09, 0x39, 0x42, 0x58, 0x2c, 0xd5, 0x32, 0x59, 0x01,
+    0x3f, 0x79, 0x46, 0x00, 0xbb, 0xc2, 0x58, 0x80, 0xd4, 0x39, 0x6e, 0x01,
+    0x3f, 0x59, 0xcd, 0x08, 0x53, 0x01, 0x3f, 0x48, 0xd6, 0x06, 0xea, 0x01,
+    0x3f, 0x61, 0xce, 0x22, 0x37, 0x01, 0x3f, 0x30, 0xc4, 0x17, 0xf7, 0x08,
+    0xea, 0xb9, 0xc2, 0x24, 0x36, 0x08, 0xea, 0xb0, 0xc3, 0x0c, 0xf7, 0x08,
+    0xea, 0xa9, 0xc3, 0x04, 0xa0, 0x08, 0xea, 0xa0, 0xc4, 0x03, 0xe0, 0x08,
+    0xea, 0x99, 0xc2, 0x01, 0xa2, 0x08, 0xea, 0x90, 0x03, 0xc2, 0x58, 0x8c,
+    0x91, 0x08, 0xe9, 0xe9, 0x87, 0x08, 0xe9, 0xd1, 0xc9, 0xaa, 0xd2, 0x08,
+    0xe9, 0xb1, 0x97, 0x08, 0xe9, 0xa3, 0x02, 0x58, 0x98, 0x8b, 0x08, 0xe9,
+    0x92, 0x02, 0x58, 0x9c, 0xc2, 0x00, 0x3b, 0x08, 0xe9, 0x81, 0xc2, 0x00,
+    0xce, 0x08, 0xe8, 0xe1, 0x83, 0x08, 0xe8, 0xd9, 0x16, 0x42, 0x58, 0xa0,
+    0xc3, 0x2c, 0x73, 0x08, 0xe9, 0x79, 0xc2, 0x00, 0xce, 0x08, 0xe8, 0xa1,
+    0x83, 0x08, 0xe8, 0x98, 0xc3, 0x1b, 0xb1, 0x08, 0xe9, 0x71, 0xc2, 0x00,
+    0xce, 0x08, 0xe8, 0x69, 0x83, 0x08, 0xe8, 0x60, 0xc2, 0x00, 0x89, 0x08,
+    0xe9, 0x69, 0x83, 0x08, 0xe9, 0x38, 0x83, 0x08, 0xe9, 0x59, 0xc2, 0x0d,
+    0x01, 0x08, 0xe9, 0x51, 0xc2, 0x00, 0xce, 0x08, 0xe9, 0x48, 0xc2, 0x00,
+    0xce, 0x08, 0xe9, 0x19, 0x83, 0x08, 0xe9, 0x10, 0xc2, 0x00, 0xce, 0x08,
+    0xe9, 0x09, 0x83, 0x08, 0xe9, 0x00, 0x83, 0x08, 0xe8, 0xf9, 0xc2, 0x03,
+    0x83, 0x08, 0xe8, 0xd1, 0xc2, 0x1a, 0x18, 0x08, 0xe8, 0xa9, 0xc2, 0x00,
+    0xeb, 0x08, 0xe8, 0x80, 0xc2, 0x00, 0xce, 0x08, 0xe8, 0xf1, 0x83, 0x08,
+    0xe8, 0xe9, 0x06, 0x42, 0x58, 0xaa, 0xc2, 0x00, 0xce, 0x08, 0xe8, 0x91,
+    0x83, 0x08, 0xe8, 0x88, 0xc2, 0x00, 0xce, 0x08, 0xe8, 0x79, 0x83, 0x08,
+    0xe8, 0x70, 0x97, 0x08, 0xe8, 0x59, 0x8b, 0x08, 0xe8, 0x41, 0x83, 0x08,
+    0xe8, 0x08, 0x97, 0x08, 0xe8, 0x28, 0x8b, 0x08, 0xe8, 0x18, 0xcb, 0x1f,
+    0xe9, 0x08, 0xe5, 0xb1, 0xc8, 0x14, 0x02, 0x08, 0xe5, 0xa8, 0x83, 0x08,
+    0xe5, 0x79, 0xc2, 0x00, 0xce, 0x08, 0xe5, 0x71, 0x15, 0xc2, 0x58, 0xb4,
+    0xc2, 0x00, 0x89, 0x08, 0xe5, 0x59, 0xc2, 0x00, 0x3b, 0x08, 0xe5, 0x51,
+    0xc2, 0x1a, 0x18, 0x08, 0xe5, 0x49, 0x1c, 0xc2, 0x58, 0xbe, 0xc2, 0x00,
+    0x71, 0x08, 0xe5, 0x29, 0x06, 0xc2, 0x58, 0xc8, 0x16, 0xc2, 0x58, 0xd2,
+    0xc2, 0x00, 0xb6, 0x08, 0xe5, 0x09, 0xc2, 0x00, 0xa0, 0x08, 0xe5, 0x01,
+    0x12, 0xc2, 0x58, 0xe0, 0x10, 0xc2, 0x58, 0xea, 0xc2, 0x21, 0x7d, 0x08,
+    0xe4, 0xc1, 0x05, 0xc2, 0x58, 0xfa, 0xc2, 0x00, 0xeb, 0x08, 0xe4, 0xa1,
+    0x0d, 0x42, 0x59, 0x04, 0x83, 0x08, 0xe4, 0x69, 0xc2, 0x00, 0xce, 0x08,
+    0xe4, 0x60, 0x83, 0x08, 0xe4, 0x39, 0xc2, 0x00, 0xce, 0x08, 0xe4, 0x30,
+    0xc2, 0x01, 0x16, 0x08, 0xe4, 0x21, 0x83, 0x08, 0xe3, 0xe0, 0x15, 0xc2,
+    0x59, 0x0e, 0xc2, 0x00, 0xce, 0x08, 0xe3, 0xd9, 0x83, 0x08, 0xe3, 0xd0,
+    0xc2, 0x00, 0xce, 0x08, 0xe3, 0xf9, 0x83, 0x08, 0xe3, 0xf0, 0x83, 0x08,
+    0xe3, 0xe9, 0xc2, 0x1a, 0x18, 0x08, 0xe3, 0xc9, 0xc2, 0x00, 0xeb, 0x08,
+    0xe3, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0xe3, 0xb9, 0x83, 0x08, 0xe3, 0xb0,
+    0xc2, 0x00, 0xce, 0x08, 0xe3, 0x99, 0x83, 0x08, 0xe3, 0x90, 0xd7, 0x2a,
+    0xe0, 0x00, 0x68, 0x01, 0xca, 0x1f, 0xea, 0x00, 0x68, 0x09, 0xce, 0x74,
+    0xe6, 0x00, 0x69, 0xe0, 0xc7, 0x14, 0x03, 0x00, 0x68, 0x11, 0xc7, 0x7e,
+    0x15, 0x00, 0x69, 0xe8, 0x0b, 0xc2, 0x59, 0x18, 0xd2, 0x4a, 0x2f, 0x00,
+    0x69, 0xd8, 0xcd, 0x7c, 0x7c, 0x00, 0x68, 0x21, 0x47, 0xaa, 0xd3, 0xc2,
+    0x59, 0x24, 0x83, 0x00, 0x69, 0xa8, 0x83, 0x00, 0x68, 0x31, 0x8b, 0x00,
+    0x68, 0x81, 0x97, 0x00, 0x68, 0xa1, 0xc9, 0xaa, 0xa5, 0x00, 0x6a, 0xf8,
+    0x8b, 0x00, 0x68, 0x40, 0x97, 0x00, 0x68, 0x50, 0x87, 0x00, 0x68, 0x78,
+    0x91, 0x00, 0x68, 0x98, 0x83, 0x00, 0x68, 0xa9, 0xc2, 0x00, 0xce, 0x00,
+    0x68, 0xb0, 0x83, 0x00, 0x68, 0xb9, 0xc2, 0x00, 0xce, 0x00, 0x68, 0xc0,
+    0xc2, 0x00, 0xeb, 0x00, 0x68, 0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x68, 0xf1,
+    0x10, 0xc2, 0x59, 0x32, 0x83, 0x00, 0x69, 0x40, 0x83, 0x00, 0x68, 0xd1,
+    0x0a, 0x42, 0x59, 0x3c, 0x83, 0x00, 0x68, 0xe1, 0xc2, 0x00, 0xce, 0x00,
+    0x68, 0xe8, 0x16, 0xc2, 0x59, 0x46, 0x83, 0x00, 0x69, 0x21, 0xc2, 0x00,
+    0xce, 0x00, 0x69, 0x28, 0x06, 0xc2, 0x59, 0x56, 0x83, 0x00, 0x69, 0x31,
+    0xc2, 0x00, 0xce, 0x00, 0x69, 0x39, 0xc7, 0xc7, 0x07, 0x00, 0x6a, 0x70,
+    0x83, 0x00, 0x69, 0x51, 0xc2, 0x00, 0xce, 0x00, 0x69, 0x58, 0x83, 0x00,
+    0x69, 0x61, 0xc2, 0x00, 0xce, 0x00, 0x69, 0x68, 0x83, 0x00, 0x69, 0x81,
+    0xc2, 0x00, 0x3b, 0x00, 0x69, 0x88, 0x83, 0x00, 0x69, 0x91, 0x0e, 0x42,
+    0x59, 0x60, 0xc2, 0x00, 0xce, 0x00, 0x69, 0xb1, 0xc2, 0x0d, 0x01, 0x00,
+    0x69, 0xb9, 0x83, 0x00, 0x69, 0xc0, 0x83, 0x00, 0x69, 0xf1, 0x8b, 0x00,
+    0x6a, 0x41, 0x97, 0x00, 0x6a, 0x60, 0x8b, 0x00, 0x6a, 0x00, 0x97, 0x00,
+    0x6a, 0x10, 0x94, 0x00, 0x6a, 0x1b, 0x02, 0x59, 0x6a, 0x8e, 0x00, 0x6b,
+    0x12, 0x02, 0x59, 0x6e, 0x87, 0x00, 0x6a, 0x38, 0x91, 0x00, 0x6a, 0x58,
+    0xd8, 0x24, 0x25, 0x00, 0x6a, 0xc1, 0x08, 0xc2, 0x59, 0x72, 0x16, 0xc2,
+    0x59, 0x7e, 0xc7, 0x06, 0x7b, 0x00, 0x6b, 0x99, 0xc4, 0x04, 0x30, 0x00,
+    0x6b, 0xa1, 0xc9, 0x69, 0x08, 0x00, 0x6b, 0xb1, 0xc6, 0x0a, 0xfd, 0x00,
+    0x6b, 0xb8, 0xca, 0xa6, 0xd2, 0x00, 0x6a, 0xd1, 0xca, 0x9c, 0xaa, 0x00,
+    0x6a, 0xe9, 0xc8, 0x06, 0x7b, 0x00, 0x6b, 0xa9, 0xca, 0xa2, 0x2c, 0x00,
+    0x6b, 0xc0, 0xc4, 0x18, 0xa7, 0x00, 0x6b, 0x31, 0xc3, 0x05, 0x16, 0x00,
+    0x6b, 0x39, 0x16, 0xc2, 0x59, 0x8a, 0x08, 0xc2, 0x59, 0x96, 0x15, 0xc2,
+    0x59, 0xa2, 0xc5, 0x0a, 0xfd, 0x00, 0x6b, 0x71, 0xc4, 0x28, 0x74, 0x00,
+    0x6b, 0x78, 0xc7, 0x0c, 0xe7, 0x00, 0x6b, 0x89, 0xc8, 0x53, 0xd0, 0x00,
+    0x6b, 0x90, 0x96, 0x08, 0x57, 0xa3, 0x02, 0x59, 0xae, 0xd3, 0x42, 0xa3,
+    0x08, 0x57, 0x90, 0xc8, 0x0c, 0xe6, 0x08, 0x57, 0x78, 0xc5, 0x26, 0x6c,
+    0x08, 0x57, 0x71, 0xc2, 0x00, 0x79, 0x08, 0x57, 0x68, 0xc2, 0x2f, 0x05,
+    0x08, 0x57, 0x21, 0xc6, 0xd2, 0x0e, 0x08, 0x56, 0xa9, 0xc3, 0x0a, 0xc8,
+    0x08, 0x56, 0x70, 0xc4, 0x3c, 0xf4, 0x08, 0x57, 0x19, 0xc3, 0x11, 0x9a,
+    0x08, 0x57, 0x11, 0x03, 0x42, 0x59, 0xb4, 0xc4, 0xd1, 0xdb, 0x08, 0x57,
+    0x01, 0xc3, 0x2e, 0xd6, 0x08, 0x56, 0xf0, 0xc3, 0x2e, 0xd6, 0x08, 0x56,
+    0xf9, 0xc3, 0x04, 0xf8, 0x08, 0x56, 0x88, 0xc4, 0x46, 0x4e, 0x08, 0x56,
+    0xd1, 0xc3, 0x16, 0xc8, 0x08, 0x56, 0xc9, 0xc4, 0x35, 0x13, 0x08, 0x56,
+    0x00, 0xc6, 0xd2, 0x0e, 0x08, 0x56, 0xa1, 0xc5, 0x46, 0x54, 0x08, 0x56,
+    0x28, 0xc4, 0xda, 0x95, 0x08, 0x56, 0x91, 0xc3, 0x04, 0xf8, 0x08, 0x56,
+    0x80, 0xc2, 0x00, 0x60, 0x08, 0x56, 0x68, 0xc5, 0xdd, 0xeb, 0x08, 0x56,
+    0x61, 0xc4, 0x46, 0x4e, 0x08, 0x56, 0x58, 0xc5, 0xdd, 0xeb, 0x08, 0x56,
+    0x51, 0xc4, 0x46, 0x4e, 0x08, 0x56, 0x48, 0xc5, 0xdd, 0xa0, 0x08, 0x56,
+    0x21, 0xc4, 0x9b, 0xd9, 0x08, 0x56, 0x18, 0xc4, 0x9b, 0xde, 0x08, 0x56,
+    0x11, 0xc3, 0x0a, 0xc8, 0x08, 0x56, 0x08, 0xc2, 0x00, 0xaf, 0x00, 0x42,
+    0xc1, 0x96, 0x00, 0x42, 0xab, 0x02, 0x59, 0xc0, 0x95, 0x00, 0x42, 0x73,
+    0x02, 0x59, 0xc4, 0x94, 0x00, 0x42, 0x99, 0x93, 0x00, 0x42, 0x91, 0x92,
+    0x00, 0x42, 0x81, 0x90, 0x00, 0x42, 0x69, 0x8f, 0x00, 0x42, 0x61, 0x8e,
+    0x00, 0x42, 0x59, 0x8d, 0x00, 0x42, 0x53, 0x02, 0x59, 0xcc, 0x9c, 0x00,
+    0x42, 0x31, 0x8a, 0x00, 0x42, 0x21, 0x86, 0x00, 0x42, 0x19, 0x89, 0x00,
+    0x42, 0x11, 0x84, 0x00, 0x42, 0x08, 0x90, 0x00, 0x42, 0x79, 0x96, 0x00,
+    0x42, 0x38, 0x14, 0xc2, 0x59, 0xd2, 0xc2, 0x00, 0xce, 0x08, 0x8b, 0x89,
+    0xc2, 0x0d, 0x01, 0x08, 0x8b, 0x81, 0xc2, 0x02, 0x63, 0x08, 0x8b, 0x79,
+    0xc2, 0x00, 0x89, 0x08, 0x8b, 0x71, 0xc2, 0x00, 0xb6, 0x08, 0x8b, 0x61,
+    0x04, 0xc2, 0x59, 0xdc, 0x12, 0xc2, 0x59, 0xe6, 0x10, 0xc2, 0x59, 0xf0,
+    0x06, 0xc2, 0x5a, 0x00, 0x16, 0xc2, 0x5a, 0x0e, 0x0c, 0xc2, 0x5a, 0x1c,
+    0x05, 0xc2, 0x5a, 0x26, 0x09, 0xc2, 0x5a, 0x30, 0x0d, 0xc2, 0x5a, 0x3a,
+    0x91, 0x08, 0x8a, 0xa1, 0x87, 0x08, 0x8a, 0x99, 0x97, 0x08, 0x8a, 0x91,
+    0x8b, 0x08, 0x8a, 0x89, 0x83, 0x08, 0x8a, 0x80, 0x05, 0xc2, 0x5a, 0x44,
+    0xc7, 0xc0, 0x23, 0x0f, 0x80, 0xb8, 0x05, 0xc2, 0x5a, 0x50, 0xc7, 0xc0,
+    0x23, 0x0f, 0x80, 0xa8, 0x05, 0xc2, 0x5a, 0x5c, 0xc7, 0xc0, 0x23, 0x0f,
+    0x80, 0xb0, 0x05, 0xc2, 0x5a, 0x68, 0xc7, 0xc0, 0x23, 0x0f, 0x80, 0xc0,
+    0x05, 0xc2, 0x5a, 0x74, 0xc7, 0xc0, 0x23, 0x0f, 0x80, 0x80, 0x05, 0xc2,
+    0x5a, 0x80, 0xc7, 0xc0, 0x23, 0x0f, 0x80, 0x88, 0x05, 0xc2, 0x5a, 0x8c,
+    0xc7, 0xc0, 0x23, 0x0f, 0x80, 0x90, 0x05, 0xc2, 0x5a, 0x98, 0xc7, 0xc0,
+    0x23, 0x0f, 0x80, 0x98, 0x05, 0xc2, 0x5a, 0xa4, 0xc7, 0xc0, 0x23, 0x0f,
+    0x80, 0xa0, 0x46, 0x12, 0x2e, 0xc2, 0x5a, 0xb0, 0xc4, 0xe0, 0xec, 0x0f,
+    0x9d, 0xe0, 0xcb, 0x93, 0xf2, 0x0f, 0x9c, 0xc0, 0x9a, 0x01, 0x38, 0xa9,
+    0xc4, 0x00, 0x8d, 0x00, 0x06, 0xba, 0x02, 0x5b, 0x16, 0xc5, 0x14, 0x9e,
+    0x01, 0x14, 0x71, 0xce, 0x1d, 0xa3, 0x01, 0x14, 0x68, 0xc2, 0x00, 0xce,
+    0x08, 0x95, 0x41, 0xc2, 0x00, 0x3b, 0x08, 0x95, 0x39, 0x83, 0x08, 0x95,
+    0x10, 0xc2, 0x00, 0xce, 0x08, 0x94, 0xf9, 0x83, 0x08, 0x94, 0xe8, 0xc2,
+    0x00, 0xce, 0x08, 0x94, 0xe1, 0x83, 0x08, 0x94, 0xd8, 0x83, 0x08, 0x94,
+    0xd1, 0xc2, 0x03, 0x83, 0x08, 0x94, 0xa9, 0xc2, 0x1a, 0x18, 0x08, 0x94,
+    0x78, 0xc2, 0x00, 0xce, 0x08, 0x94, 0xc9, 0x83, 0x08, 0x94, 0xc1, 0x06,
+    0x42, 0x5b, 0x1a, 0xc2, 0x00, 0xce, 0x08, 0x94, 0xb9, 0x83, 0x08, 0x94,
+    0xb1, 0x16, 0x42, 0x5b, 0x2a, 0x83, 0x08, 0x94, 0x61, 0xc2, 0x21, 0x7d,
+    0x08, 0x94, 0x68, 0x83, 0x08, 0x94, 0x51, 0xc2, 0x00, 0xce, 0x08, 0x94,
+    0x58, 0xc2, 0x00, 0xce, 0x08, 0x94, 0x41, 0x83, 0x08, 0x94, 0x30, 0xc2,
+    0x00, 0xce, 0x08, 0x94, 0x29, 0x83, 0x08, 0x94, 0x20, 0xc3, 0x49, 0x6b,
+    0x05, 0x4f, 0x29, 0x45, 0x27, 0x2c, 0xc2, 0x5b, 0x34, 0x48, 0xbe, 0x50,
+    0x42, 0x5b, 0x44, 0xc3, 0x01, 0xa1, 0x05, 0x53, 0xc9, 0xc3, 0x05, 0x16,
+    0x05, 0x53, 0xc1, 0xcb, 0x0e, 0xed, 0x05, 0x53, 0xb8, 0x44, 0x3a, 0x39,
+    0x42, 0x5b, 0x50, 0x48, 0x62, 0xe3, 0x42, 0x5b, 0x94, 0x83, 0x00, 0x80,
+    0x59, 0xc2, 0x00, 0xce, 0x00, 0x80, 0x60, 0x83, 0x00, 0x82, 0x83, 0x02,
+    0x5b, 0xb4, 0x4b, 0x99, 0x88, 0x42, 0x5b, 0xba, 0xc2, 0x1a, 0x18, 0x00,
+    0x80, 0x51, 0x83, 0x00, 0x80, 0x78, 0x83, 0x00, 0x80, 0x69, 0xc2, 0x00,
+    0xce, 0x00, 0x80, 0x70, 0x87, 0x00, 0x81, 0x41, 0xc3, 0x66, 0x09, 0x00,
+    0x82, 0xd1, 0xc3, 0xe5, 0x6b, 0x00, 0x82, 0xd9, 0x42, 0x42, 0x59, 0x42,
+    0x5b, 0xc6, 0xc3, 0x00, 0xcd, 0x00, 0x83, 0x29, 0xc3, 0x00, 0x70, 0x00,
+    0x83, 0x30, 0xc3, 0x3f, 0x6f, 0x00, 0x83, 0x71, 0xc3, 0xe3, 0x54, 0x00,
+    0x83, 0x79, 0xc4, 0xe1, 0x78, 0x00, 0x83, 0x80, 0x94, 0x00, 0x82, 0x98,
+    0x8e, 0x00, 0x82, 0xa8, 0x8b, 0x00, 0x84, 0xe8, 0xc6, 0x00, 0xd1, 0x00,
+    0x84, 0x28, 0xc3, 0x00, 0x3c, 0x0f, 0x85, 0x01, 0xca, 0xa2, 0xae, 0x0f,
+    0x86, 0x78, 0xc6, 0xcb, 0xd2, 0x0f, 0x85, 0x09, 0xc6, 0x77, 0x89, 0x0f,
+    0x85, 0x89, 0xc8, 0x3f, 0x57, 0x0f, 0x86, 0x09, 0xc5, 0xd5, 0x0d, 0x0f,
+    0x86, 0x88, 0x46, 0xd0, 0x16, 0xc2, 0x5b, 0xce, 0x48, 0xbd, 0xb0, 0xc2,
+    0x5b, 0xe6, 0x46, 0xb0, 0x09, 0xc2, 0x5b, 0xfe, 0x45, 0xdd, 0xf5, 0x42,
+    0x5c, 0x16, 0x11, 0xc2, 0x5c, 0x40, 0x47, 0xc9, 0xed, 0x42, 0x5c, 0x4c,
+    0x46, 0xcb, 0x96, 0xc2, 0x5c, 0x64, 0x48, 0xbd, 0x40, 0x42, 0x5c, 0x7c,
+    0xc6, 0xcb, 0xd2, 0x0f, 0x85, 0x41, 0xc6, 0x77, 0x89, 0x0f, 0x85, 0xc1,
+    0xc8, 0x3f, 0x57, 0x0f, 0x86, 0x41, 0xc5, 0xd5, 0x0d, 0x0f, 0x86, 0xc0,
+    0xc6, 0xcb, 0xd2, 0x0f, 0x85, 0x49, 0xc6, 0x77, 0x89, 0x0f, 0x85, 0xc9,
+    0xc8, 0x3f, 0x57, 0x0f, 0x86, 0x49, 0xc5, 0xd5, 0x0d, 0x0f, 0x86, 0xc8,
+    0xc6, 0xcb, 0xd2, 0x0f, 0x85, 0x59, 0xc6, 0x77, 0x89, 0x0f, 0x85, 0xd9,
+    0xc8, 0x3f, 0x57, 0x0f, 0x86, 0x59, 0xc5, 0xd5, 0x0d, 0x0f, 0x86, 0xd8,
+    0x49, 0xb0, 0x72, 0xc2, 0x5c, 0x94, 0x47, 0x37, 0x74, 0x42, 0x5c, 0xac,
+    0xc6, 0xcb, 0xd2, 0x0f, 0x85, 0x69, 0xc6, 0x77, 0x89, 0x0f, 0x85, 0xe9,
+    0xc8, 0x3f, 0x57, 0x0f, 0x86, 0x69, 0xc5, 0xd5, 0x0d, 0x0f, 0x86, 0xe8,
+    0xc2, 0x01, 0xa2, 0x01, 0x5e, 0x99, 0xc4, 0x03, 0xe0, 0x01, 0x5e, 0xa0,
+    0xc3, 0x04, 0xa0, 0x01, 0x5e, 0xa9, 0xc3, 0x0c, 0xf7, 0x01, 0x5e, 0xb0,
+    0x43, 0x07, 0x9b, 0xc2, 0x5c, 0xc4, 0x45, 0x00, 0x92, 0xc2, 0x5c, 0xd6,
+    0xd1, 0x0f, 0xa9, 0x01, 0x53, 0x90, 0xc5, 0xd8, 0x2d, 0x0f, 0xad, 0xb0,
+    0xa0, 0x00, 0x04, 0x89, 0xa1, 0x00, 0x04, 0x90, 0xc3, 0x05, 0x16, 0x00,
+    0x04, 0x89, 0xc3, 0x01, 0xa1, 0x00, 0x04, 0x90, 0xca, 0x34, 0x32, 0x01,
+    0x13, 0xf1, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0xe0, 0x4c, 0x23, 0x4d, 0xc2,
+    0x5c, 0xf2, 0xcb, 0x0f, 0xaf, 0x01, 0x55, 0x99, 0x44, 0x1d, 0x75, 0xc2,
+    0x5c, 0xfe, 0xcf, 0x66, 0x0b, 0x01, 0x55, 0xb8, 0xc3, 0x0d, 0xc9, 0x07,
+    0xf0, 0x99, 0xc3, 0x04, 0x0e, 0x07, 0xf0, 0x80, 0xcf, 0x0e, 0xee, 0x07,
+    0xf0, 0xa9, 0xc6, 0xb7, 0xe2, 0x07, 0xf1, 0x89, 0xc6, 0xcb, 0x0c, 0x07,
+    0xf1, 0x90, 0x44, 0x00, 0x30, 0xc2, 0x5d, 0x0a, 0xc7, 0x7f, 0x4d, 0x07,
+    0xf1, 0x98, 0xcb, 0x1a, 0x38, 0x07, 0xf1, 0xb1, 0x05, 0xc2, 0x5d, 0x38,
+    0xd6, 0x06, 0xea, 0x07, 0xf1, 0xd1, 0xd8, 0x25, 0xd5, 0x07, 0xf1, 0xe1,
+    0xd4, 0x39, 0x6e, 0x07, 0xf1, 0xf1, 0xce, 0x22, 0x37, 0x07, 0xf2, 0x41,
+    0x46, 0x00, 0xbb, 0xc2, 0x5d, 0x44, 0xcd, 0x08, 0x53, 0x07, 0xf2, 0x00,
+    0xc5, 0x04, 0x0c, 0x07, 0xf0, 0x89, 0xc9, 0x11, 0xa1, 0x07, 0xf0, 0x90,
+    0xcb, 0x8e, 0x67, 0x0f, 0xae, 0xf9, 0xc3, 0x00, 0x35, 0x0f, 0xa6, 0x18,
+    0xc5, 0x28, 0x97, 0x08, 0xd7, 0xb9, 0xc4, 0x0d, 0xc9, 0x08, 0xd7, 0x9a,
+    0x02, 0x5d, 0x50, 0x45, 0x22, 0x67, 0xc2, 0x5d, 0x56, 0x83, 0x08, 0xd6,
+    0x98, 0x83, 0x08, 0xd6, 0xd8, 0x83, 0x08, 0xd6, 0xd0, 0xc2, 0x00, 0xce,
+    0x08, 0xd6, 0xa1, 0x83, 0x08, 0xd6, 0x68, 0xc2, 0x00, 0xce, 0x08, 0xd6,
+    0x89, 0x83, 0x08, 0xd6, 0x00, 0x83, 0x08, 0xd6, 0x81, 0xc2, 0x00, 0xeb,
+    0x08, 0xd6, 0x38, 0xc2, 0x00, 0xce, 0x08, 0xd6, 0x79, 0x83, 0x08, 0xd6,
+    0x70, 0xc2, 0x00, 0xce, 0x08, 0xd6, 0x51, 0x83, 0x08, 0xd6, 0x08, 0xc5,
+    0x28, 0x97, 0x08, 0xd7, 0x71, 0xc4, 0x0d, 0xc9, 0x08, 0xd7, 0x5a, 0x02,
+    0x5d, 0x79, 0xc6, 0x28, 0x96, 0x08, 0xd7, 0x40, 0x16, 0xc2, 0x5d, 0x7f,
+    0x08, 0xc2, 0x5d, 0x8f, 0xc3, 0x05, 0x16, 0x08, 0x43, 0xc8, 0xd3, 0x43,
+    0xe6, 0x08, 0x43, 0xb9, 0x45, 0x01, 0x94, 0x42, 0x5d, 0x9b, 0xcc, 0x41,
+    0x08, 0x01, 0x10, 0x11, 0x45, 0x00, 0xdf, 0x42, 0x5e, 0x04, 0x9c, 0x01,
+    0x25, 0xa9, 0x9b, 0x01, 0x25, 0xa1, 0x9a, 0x01, 0x25, 0x99, 0x99, 0x01,
+    0x25, 0x91, 0x98, 0x01, 0x25, 0x89, 0x97, 0x01, 0x25, 0x81, 0x96, 0x01,
+    0x25, 0x79, 0x95, 0x01, 0x25, 0x71, 0x94, 0x01, 0x25, 0x69, 0x93, 0x01,
+    0x25, 0x61, 0x92, 0x01, 0x25, 0x59, 0x91, 0x01, 0x25, 0x51, 0x90, 0x01,
+    0x25, 0x49, 0x8f, 0x01, 0x25, 0x41, 0x8e, 0x01, 0x25, 0x39, 0x8d, 0x01,
+    0x25, 0x31, 0x8c, 0x01, 0x25, 0x29, 0x8b, 0x01, 0x25, 0x21, 0x8a, 0x01,
+    0x25, 0x19, 0x89, 0x01, 0x25, 0x11, 0x88, 0x01, 0x25, 0x09, 0x87, 0x01,
+    0x25, 0x01, 0x86, 0x01, 0x24, 0xf9, 0x85, 0x01, 0x24, 0xf1, 0x84, 0x01,
+    0x24, 0xe9, 0x83, 0x01, 0x24, 0xe0, 0x9c, 0x0f, 0x89, 0x49, 0x9b, 0x0f,
+    0x89, 0x41, 0x9a, 0x0f, 0x89, 0x39, 0x99, 0x0f, 0x89, 0x31, 0x98, 0x0f,
+    0x89, 0x29, 0x97, 0x0f, 0x89, 0x21, 0x96, 0x0f, 0x89, 0x19, 0x95, 0x0f,
+    0x89, 0x11, 0x94, 0x0f, 0x89, 0x09, 0x93, 0x0f, 0x89, 0x01, 0x92, 0x0f,
+    0x88, 0xf9, 0x91, 0x0f, 0x88, 0xf1, 0x90, 0x0f, 0x88, 0xe9, 0x8f, 0x0f,
+    0x88, 0xe1, 0x8e, 0x0f, 0x88, 0xd9, 0x8d, 0x0f, 0x88, 0xd1, 0x8c, 0x0f,
+    0x88, 0xc9, 0x8b, 0x0f, 0x88, 0xc1, 0x8a, 0x0f, 0x88, 0xb9, 0x89, 0x0f,
+    0x88, 0xb1, 0x88, 0x0f, 0x88, 0xa9, 0x87, 0x0f, 0x88, 0xa1, 0x86, 0x0f,
+    0x88, 0x99, 0x85, 0x0f, 0x88, 0x91, 0x84, 0x0f, 0x88, 0x89, 0x83, 0x0f,
+    0x88, 0x80, 0x42, 0x00, 0x2b, 0xc2, 0x5e, 0x1c, 0xc7, 0x4f, 0xe1, 0x01,
+    0x24, 0x01, 0xc2, 0x00, 0x79, 0x01, 0x23, 0xe8, 0xc7, 0x1e, 0xa8, 0x01,
+    0x24, 0x29, 0xc5, 0x65, 0x84, 0x01, 0x23, 0xf0, 0xc8, 0x49, 0xb1, 0x01,
+    0x24, 0x21, 0xc6, 0x43, 0xcd, 0x01, 0x24, 0x18, 0xc6, 0x12, 0xb9, 0x01,
+    0x24, 0x11, 0xc7, 0x52, 0x9a, 0x01, 0x24, 0x08, 0xc4, 0x17, 0xf7, 0x01,
+    0x23, 0xd1, 0xc2, 0x24, 0x36, 0x01, 0x23, 0xc8, 0xc3, 0x0c, 0xf7, 0x01,
+    0x23, 0xc1, 0xc3, 0x04, 0xa0, 0x01, 0x23, 0xb8, 0xc4, 0x03, 0xe0, 0x01,
+    0x23, 0xb1, 0xc2, 0x01, 0xa2, 0x01, 0x23, 0xa8, 0xc5, 0x91, 0x22, 0x01,
+    0x90, 0x03, 0x02, 0x5e, 0x28, 0xc6, 0xb7, 0xd2, 0x01, 0x90, 0x52, 0x02,
+    0x5e, 0x2e, 0xc2, 0x00, 0x6a, 0x01, 0x90, 0x78, 0xc5, 0xc0, 0x64, 0x01,
+    0x90, 0x13, 0x02, 0x5e, 0x34, 0xc6, 0xc0, 0x9b, 0x01, 0x90, 0x5a, 0x02,
+    0x5e, 0x3a, 0xc2, 0x00, 0x6a, 0x01, 0x90, 0x88, 0xc2, 0x00, 0x6a, 0x01,
+    0x90, 0x90, 0xc4, 0x80, 0x06, 0x01, 0x90, 0x2b, 0x02, 0x5e, 0x40, 0xc6,
+    0xb4, 0xea, 0x01, 0x90, 0x62, 0x02, 0x5e, 0x46, 0xc2, 0x00, 0x6a, 0x01,
+    0x90, 0xa0, 0xc2, 0x00, 0x6a, 0x01, 0x90, 0xa8, 0xc4, 0xbf, 0x92, 0x01,
+    0x90, 0x43, 0x02, 0x5e, 0x4c, 0xc6, 0xbf, 0x91, 0x01, 0x90, 0x4a, 0x02,
+    0x5e, 0x50, 0xc2, 0x00, 0x6a, 0x01, 0x90, 0xd8, 0xc2, 0x01, 0xa2, 0x01,
+    0x91, 0x09, 0xc4, 0x03, 0xe0, 0x01, 0x91, 0x11, 0xc2, 0x00, 0x79, 0x01,
+    0x91, 0x48, 0xc3, 0x04, 0xa0, 0x01, 0x91, 0x19, 0x0b, 0xc2, 0x5e, 0x56,
+    0xc7, 0xc9, 0x37, 0x01, 0x92, 0x00, 0xc2, 0x24, 0x36, 0x01, 0x91, 0x29,
+    0x07, 0xc2, 0x5e, 0x68, 0x17, 0xc2, 0x5e, 0x74, 0x16, 0xc2, 0x5e, 0x7e,
+    0xc6, 0xcc, 0xaa, 0x01, 0x91, 0x99, 0xc6, 0xd1, 0xcc, 0x01, 0x91, 0xa8,
+    0xc4, 0x00, 0x65, 0x01, 0x91, 0x39, 0xc4, 0x67, 0x42, 0x01, 0x91, 0x79,
+    0xc9, 0xb2, 0x3d, 0x01, 0x91, 0xe8, 0xc3, 0x00, 0xe0, 0x01, 0x91, 0x41,
+    0xc3, 0x03, 0x84, 0x01, 0x91, 0xa0, 0xc3, 0x05, 0x37, 0x01, 0x91, 0x51,
+    0xc4, 0x07, 0x09, 0x01, 0x91, 0x70, 0xc4, 0x01, 0xd9, 0x01, 0x91, 0x61,
+    0xc3, 0x29, 0xc9, 0x01, 0x91, 0x68, 0xcd, 0x75, 0x7a, 0x01, 0x91, 0xb9,
+    0xc3, 0x00, 0xb7, 0x01, 0x91, 0xd0, 0xc7, 0x7c, 0x75, 0x01, 0x91, 0xc9,
+    0x15, 0xc2, 0x5e, 0x8a, 0xc3, 0x29, 0xfd, 0x01, 0x92, 0x18, 0xd1, 0x00,
+    0x4a, 0x01, 0x57, 0x91, 0xce, 0x34, 0xe4, 0x01, 0x57, 0x98, 0xc2, 0xb5,
+    0x6f, 0x0b, 0x5c, 0x79, 0xc2, 0x1a, 0x19, 0x0b, 0x5c, 0x50, 0xc2, 0x0e,
+    0x15, 0x0b, 0x5c, 0x71, 0xc3, 0xaa, 0xc1, 0x0b, 0x5c, 0x41, 0xc2, 0x05,
+    0x37, 0x0b, 0x5c, 0x10, 0x15, 0xc2, 0x5e, 0x94, 0xc3, 0xe5, 0xfe, 0x0b,
+    0x5c, 0x28, 0xc2, 0x1a, 0x19, 0x0b, 0x5c, 0x61, 0xc3, 0xe5, 0xda, 0x0b,
+    0x5b, 0xf0, 0x8f, 0x0b, 0x5c, 0x49, 0xc2, 0xb5, 0x6f, 0x0b, 0x5c, 0x18,
+    0xc3, 0xe5, 0x3b, 0x0b, 0x5c, 0x01, 0xc2, 0x02, 0x1c, 0x0b, 0x5b, 0xf8,
+    0xc2, 0x1f, 0x90, 0x0b, 0x59, 0x79, 0xc3, 0x9b, 0xd4, 0x0b, 0x59, 0x38,
+    0xc2, 0x1f, 0x90, 0x0b, 0x59, 0x61, 0x16, 0xc2, 0x5e, 0xa6, 0xc4, 0xe0,
+    0xcc, 0x0b, 0x59, 0x41, 0xc3, 0xd8, 0xb7, 0x0b, 0x59, 0x11, 0xc3, 0x1f,
+    0x8f, 0x0b, 0x59, 0x00, 0xc3, 0x4f, 0x7b, 0x0b, 0x59, 0x49, 0xc3, 0x1f,
+    0x8f, 0x0b, 0x59, 0x29, 0xc2, 0x1f, 0x90, 0x0b, 0x58, 0xf8, 0xc3, 0xe5,
+    0xd7, 0x0b, 0x5b, 0xa3, 0x02, 0x5e, 0xb2, 0xc7, 0xc6, 0xcf, 0x0b, 0x5a,
+    0x28, 0xca, 0x9e, 0x1c, 0x0b, 0x5b, 0x99, 0xc4, 0x12, 0xfb, 0x0b, 0x59,
+    0xc8, 0xc5, 0xd6, 0xb6, 0x0b, 0x5b, 0x71, 0xc4, 0xde, 0xa0, 0x0b, 0x5a,
+    0x08, 0xc2, 0x05, 0x37, 0x0b, 0x5b, 0x21, 0x44, 0x1b, 0xb9, 0x42, 0x5e,
+    0xb8, 0x0a, 0xc2, 0x5e, 0xd0, 0xc9, 0xaa, 0xc0, 0x0b, 0x59, 0xc0, 0x01,
+    0xc2, 0x5e, 0xdc, 0x95, 0x0b, 0x5a, 0xd8, 0x98, 0x0b, 0x58, 0xd9, 0x84,
+    0x0b, 0x58, 0xd0, 0x98, 0x0b, 0x58, 0x79, 0x84, 0x0b, 0x58, 0x70, 0x98,
+    0x0b, 0x58, 0x59, 0x84, 0x0b, 0x58, 0x50, 0x98, 0x0b, 0x58, 0x29, 0x84,
+    0x0b, 0x58, 0x20, 0x98, 0x0b, 0x58, 0xa9, 0x84, 0x0b, 0x58, 0xa0, 0x98,
+    0x0b, 0x58, 0x69, 0x84, 0x0b, 0x58, 0x60, 0x98, 0x0b, 0x58, 0x89, 0x84,
+    0x0b, 0x58, 0x80, 0x98, 0x0b, 0x58, 0x09, 0x84, 0x0b, 0x58, 0x00, 0xc5,
+    0x10, 0x8c, 0x01, 0x81, 0x00, 0x45, 0x00, 0x92, 0xc2, 0x5e, 0xe8, 0xcd,
+    0x7f, 0x95, 0x0f, 0xb2, 0x39, 0x14, 0xc2, 0x5f, 0x04, 0xc8, 0x75, 0x46,
+    0x0f, 0xb2, 0x69, 0xcf, 0x63, 0x4a, 0x0f, 0xc9, 0xc1, 0x43, 0x07, 0x9b,
+    0xc2, 0x5f, 0x0a, 0xc8, 0xbe, 0xe8, 0x0f, 0xce, 0xb8, 0xc4, 0x03, 0xe0,
+    0x08, 0x48, 0xd9, 0x19, 0xc2, 0x5f, 0x16, 0xc2, 0x00, 0x79, 0x08, 0x48,
+    0xb8, 0xc8, 0x0c, 0xe6, 0x08, 0x48, 0xc8, 0xc2, 0x1f, 0x90, 0x08, 0x48,
+    0xa9, 0xc2, 0x00, 0x3f, 0x08, 0x48, 0x40, 0xc3, 0x11, 0x9a, 0x08, 0x48,
+    0xa1, 0xc3, 0x02, 0xbf, 0x08, 0x48, 0x89, 0xc3, 0x7a, 0xbc, 0x08, 0x48,
+    0x70, 0xc2, 0x00, 0xaf, 0x08, 0x48, 0x79, 0xc2, 0x04, 0x32, 0x08, 0x48,
+    0x00, 0x96, 0x08, 0x48, 0x38, 0x83, 0x05, 0x42, 0x01, 0xc2, 0x00, 0xce,
+    0x05, 0x42, 0x08, 0x83, 0x05, 0x42, 0x11, 0xc2, 0x00, 0xeb, 0x05, 0x43,
+    0x28, 0xc2, 0x00, 0xeb, 0x05, 0x42, 0x19, 0xc2, 0x1a, 0x18, 0x05, 0x42,
+    0x39, 0x83, 0x05, 0x42, 0x59, 0xc2, 0x03, 0x83, 0x05, 0x43, 0x60, 0x83,
+    0x05, 0x42, 0x23, 0x02, 0x5f, 0x20, 0xc2, 0x00, 0xce, 0x05, 0x42, 0x28,
+    0x83, 0x05, 0x42, 0x41, 0xc2, 0x00, 0xce, 0x05, 0x42, 0x49, 0x15, 0xc2,
+    0x5f, 0x26, 0x16, 0x42, 0x5f, 0x30, 0x83, 0x05, 0x42, 0x51, 0xc2, 0x01,
+    0x16, 0x05, 0x42, 0x91, 0xc2, 0x0e, 0x60, 0x05, 0x43, 0x58, 0x83, 0x05,
+    0x42, 0x61, 0xc2, 0x00, 0xce, 0x05, 0x42, 0x68, 0xc2, 0x00, 0xce, 0x05,
+    0x42, 0xa1, 0x83, 0x05, 0x42, 0xa8, 0xc6, 0x22, 0xa6, 0x05, 0x42, 0xb1,
+    0xc2, 0x00, 0xce, 0x05, 0x42, 0xd1, 0x83, 0x05, 0x42, 0xd8, 0xcb, 0x90,
+    0x1f, 0x05, 0x43, 0x69, 0xcb, 0x8c, 0xd0, 0x05, 0x43, 0x80, 0x87, 0x05,
+    0x43, 0x30, 0xc8, 0xb9, 0x68, 0x05, 0x43, 0x71, 0xc4, 0x0d, 0x06, 0x05,
+    0x43, 0x78, 0x4f, 0x5e, 0x23, 0xc2, 0x5f, 0x3a, 0xd2, 0x4b, 0xcd, 0x05,
+    0x43, 0x90, 0xc9, 0xac, 0x3a, 0x08, 0x0e, 0x89, 0xc8, 0xbe, 0xc0, 0x08,
+    0x0f, 0x90, 0xc5, 0x67, 0x3b, 0x08, 0x0e, 0x99, 0xcd, 0x7e, 0x77, 0x08,
+    0x0f, 0x11, 0x96, 0x08, 0x0f, 0x60, 0xc2, 0x03, 0xb2, 0x08, 0x0f, 0x23,
+    0x02, 0x5f, 0x4c, 0xc4, 0xca, 0xf7, 0x08, 0x0f, 0x30, 0x99, 0x08, 0x0e,
+    0xd1, 0xc7, 0xc5, 0xcc, 0x08, 0x0f, 0x08, 0xc4, 0xd1, 0x72, 0x08, 0x0f,
+    0x38, 0xc3, 0x20, 0xdc, 0x08, 0x0e, 0xd9, 0x92, 0x08, 0x0f, 0x40, 0x45,
+    0x00, 0xb6, 0xc2, 0x5f, 0x52, 0x83, 0x01, 0x85, 0xa9, 0x8b, 0x01, 0x85,
+    0xb9, 0x97, 0x01, 0x85, 0xc9, 0x87, 0x01, 0x85, 0xd9, 0x91, 0x01, 0x85,
+    0xe8, 0x47, 0x76, 0xda, 0x42, 0x5f, 0x8f, 0x8b, 0x01, 0x86, 0xfb, 0x02,
+    0x5f, 0x9d, 0x83, 0x01, 0x86, 0xf1, 0x97, 0x01, 0x87, 0x01, 0x87, 0x01,
+    0x87, 0x09, 0x91, 0x01, 0x87, 0x10, 0x83, 0x01, 0x85, 0x59, 0x8b, 0x01,
+    0x85, 0x69, 0x97, 0x01, 0x85, 0x79, 0x87, 0x01, 0x85, 0x89, 0x91, 0x01,
+    0x85, 0x98, 0x83, 0x01, 0x85, 0x61, 0x8b, 0x01, 0x85, 0x71, 0x97, 0x01,
+    0x85, 0x81, 0x87, 0x01, 0x85, 0x91, 0x91, 0x01, 0x85, 0xa0, 0x83, 0x01,
+    0x85, 0xb1, 0x8b, 0x01, 0x85, 0xc1, 0x97, 0x01, 0x85, 0xd1, 0x87, 0x01,
+    0x85, 0xe1, 0x91, 0x01, 0x85, 0xf0, 0x83, 0x01, 0x85, 0xf9, 0x8b, 0x01,
+    0x86, 0x09, 0x97, 0x01, 0x86, 0x21, 0x87, 0x01, 0x86, 0x31, 0x91, 0x01,
+    0x86, 0x40, 0x83, 0x01, 0x86, 0x01, 0x8b, 0x01, 0x86, 0x11, 0x97, 0x01,
+    0x86, 0x29, 0x87, 0x01, 0x86, 0x39, 0x91, 0x01, 0x86, 0x48, 0x83, 0x01,
+    0x86, 0x51, 0x8b, 0x01, 0x86, 0x59, 0x97, 0x01, 0x86, 0x61, 0x87, 0x01,
+    0x86, 0x69, 0x91, 0x01, 0x86, 0x70, 0x83, 0x01, 0x86, 0x79, 0x8b, 0x01,
+    0x86, 0x91, 0x97, 0x01, 0x86, 0xa9, 0x87, 0x01, 0x86, 0xc1, 0x91, 0x01,
+    0x86, 0xd8, 0x83, 0x01, 0x86, 0x81, 0x8b, 0x01, 0x86, 0x99, 0x97, 0x01,
+    0x86, 0xb1, 0x87, 0x01, 0x86, 0xc9, 0x91, 0x01, 0x86, 0xe0, 0x83, 0x01,
+    0x86, 0x89, 0x8b, 0x01, 0x86, 0xa1, 0x97, 0x01, 0x86, 0xb9, 0x87, 0x01,
+    0x86, 0xd1, 0x91, 0x01, 0x86, 0xe8, 0x83, 0x01, 0x87, 0x21, 0x97, 0x01,
+    0x87, 0x31, 0x91, 0x01, 0x87, 0x40, 0x83, 0x01, 0x87, 0x49, 0x8b, 0x01,
+    0x87, 0x51, 0x97, 0x01, 0x87, 0x59, 0x87, 0x01, 0x87, 0x61, 0x91, 0x01,
+    0x87, 0x68, 0x83, 0x01, 0x87, 0x79, 0x8b, 0x01, 0x87, 0x81, 0x87, 0x01,
+    0x87, 0x89, 0x91, 0x01, 0x87, 0x90, 0x97, 0x01, 0x87, 0xa1, 0x83, 0x01,
+    0x87, 0xb9, 0x8b, 0x01, 0x87, 0xc1, 0x87, 0x01, 0x87, 0xc9, 0x91, 0x01,
+    0x87, 0xd0, 0xc4, 0x1f, 0xf7, 0x08, 0x85, 0xc9, 0xc5, 0x40, 0xb0, 0x08,
+    0x84, 0x10, 0xc2, 0x00, 0xce, 0x08, 0x84, 0xd9, 0xc3, 0x28, 0x16, 0x08,
+    0x84, 0xd1, 0x83, 0x08, 0x84, 0xc8, 0xc2, 0x00, 0xce, 0x08, 0x84, 0xc1,
+    0x83, 0x08, 0x84, 0xb8, 0xd2, 0x4a, 0xad, 0x00, 0x64, 0x01, 0xc6, 0xc8,
+    0xf2, 0x00, 0x64, 0x20, 0xc7, 0x14, 0x03, 0x00, 0x64, 0x11, 0xc7, 0x7e,
+    0x15, 0x00, 0x65, 0xe8, 0xc5, 0x40, 0xb0, 0x00, 0x64, 0x19, 0xc4, 0x1f,
+    0xf7, 0x00, 0x66, 0x68, 0x83, 0x00, 0x64, 0x2b, 0x02, 0x5f, 0xa3, 0x8b,
+    0x00, 0x64, 0x3b, 0x02, 0x5f, 0xaf, 0x97, 0x00, 0x64, 0x4b, 0x02, 0x5f,
+    0xb3, 0x18, 0xc2, 0x5f, 0xb7, 0x87, 0x00, 0x64, 0x73, 0x02, 0x5f, 0xc1,
+    0x91, 0x00, 0x64, 0x93, 0x02, 0x5f, 0xc5, 0x0d, 0xc2, 0x5f, 0xc9, 0x09,
+    0xc2, 0x5f, 0xd3, 0x10, 0xc2, 0x5f, 0xdd, 0x05, 0xc2, 0x5f, 0xf6, 0x0c,
+    0xc2, 0x60, 0x00, 0x16, 0xc2, 0x60, 0x0a, 0x06, 0xc2, 0x60, 0x18, 0x12,
+    0xc2, 0x60, 0x26, 0x04, 0xc2, 0x60, 0x30, 0xc2, 0x00, 0xb6, 0x00, 0x65,
+    0x71, 0xc2, 0x1a, 0x18, 0x00, 0x65, 0x79, 0x14, 0xc2, 0x60, 0x3a, 0x0e,
+    0xc2, 0x60, 0x44, 0x15, 0xc2, 0x60, 0x4c, 0xc2, 0x00, 0xce, 0x00, 0x65,
+    0xc9, 0xc2, 0x04, 0x70, 0x00, 0x66, 0xf0, 0x83, 0x00, 0x65, 0xf1, 0x8b,
+    0x00, 0x66, 0x41, 0x97, 0x00, 0x66, 0x60, 0x8b, 0x00, 0x66, 0x00, 0x97,
+    0x00, 0x66, 0x10, 0x94, 0x00, 0x66, 0x1b, 0x02, 0x60, 0x5c, 0x8e, 0x00,
+    0x67, 0x12, 0x02, 0x60, 0x60, 0x87, 0x00, 0x66, 0x38, 0x91, 0x00, 0x66,
+    0x58, 0xc2, 0x01, 0xa2, 0x00, 0x67, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x67,
+    0x48, 0xc3, 0x04, 0xa0, 0x00, 0x67, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x67,
+    0x58, 0xc2, 0x24, 0x36, 0x00, 0x67, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x67,
+    0x68, 0xc2, 0x00, 0xe1, 0x01, 0x78, 0x03, 0x02, 0x60, 0x64, 0x12, 0xc2,
+    0x60, 0x6a, 0xc2, 0x15, 0xf7, 0x01, 0x7b, 0xe0, 0x0b, 0xc2, 0x60, 0x76,
+    0x07, 0xc2, 0x60, 0x86, 0x03, 0xc2, 0x60, 0x96, 0xc3, 0x01, 0x0a, 0x01,
+    0x7d, 0x3a, 0x02, 0x60, 0xa2, 0x11, 0xc2, 0x60, 0xa8, 0x0b, 0xc2, 0x60,
+    0xcb, 0x14, 0xc2, 0x60, 0xdb, 0x07, 0x42, 0x60, 0xeb, 0x0e, 0xc2, 0x60,
+    0xf7, 0x07, 0xc2, 0x61, 0x01, 0x12, 0xc2, 0x61, 0x17, 0x05, 0xc2, 0x61,
+    0x2d, 0xc4, 0x00, 0xb6, 0x01, 0x79, 0x49, 0x0a, 0xc2, 0x61, 0x39, 0xc4,
+    0x9c, 0x1d, 0x01, 0x79, 0xc9, 0x16, 0xc2, 0x61, 0x41, 0xc5, 0x09, 0x2c,
+    0x01, 0x7a, 0x29, 0xc2, 0x05, 0x1f, 0x01, 0x7a, 0x39, 0x03, 0xc2, 0x61,
+    0x4f, 0xc4, 0x47, 0x78, 0x01, 0x7b, 0x11, 0x0b, 0xc2, 0x61, 0x5f, 0xc3,
+    0x2f, 0x1b, 0x01, 0x7b, 0x51, 0xc4, 0x0d, 0xd1, 0x01, 0x7d, 0x98, 0x11,
+    0xc2, 0x61, 0x6b, 0xcf, 0x63, 0xef, 0x01, 0x78, 0xb1, 0x07, 0xc2, 0x61,
+    0x75, 0x03, 0x42, 0x61, 0x7f, 0xc2, 0x01, 0xa2, 0x01, 0x78, 0x33, 0x02,
+    0x61, 0x8f, 0x03, 0xc2, 0x61, 0x95, 0xc2, 0x00, 0x79, 0x01, 0x78, 0xb9,
+    0x42, 0x00, 0x35, 0xc2, 0x61, 0xa7, 0x14, 0xc2, 0x61, 0xb3, 0x0b, 0xc2,
+    0x61, 0xc5, 0x11, 0x42, 0x61, 0xd1, 0xc2, 0x00, 0x6b, 0x01, 0x78, 0x41,
+    0x11, 0xc2, 0x61, 0xdd, 0x07, 0xc2, 0x61, 0xeb, 0x0b, 0x42, 0x61, 0xf7,
+    0x10, 0xc2, 0x62, 0x03, 0xc4, 0x00, 0x65, 0x01, 0x78, 0x59, 0x03, 0xc2,
+    0x62, 0x0f, 0xc3, 0x17, 0xf8, 0x01, 0x7e, 0x8b, 0x02, 0x62, 0x1a, 0xc2,
+    0x0d, 0x1e, 0x01, 0x7b, 0x61, 0xc9, 0xa9, 0xdf, 0x01, 0x7e, 0x58, 0x11,
+    0xc2, 0x62, 0x20, 0x0e, 0xc2, 0x62, 0x3c, 0xc4, 0xdf, 0x6c, 0x01, 0x79,
+    0x31, 0x03, 0xc2, 0x62, 0x4c, 0xc3, 0x31, 0x24, 0x01, 0x7d, 0x10, 0xc2,
+    0x01, 0x0e, 0x01, 0x78, 0x71, 0x10, 0x42, 0x62, 0x5e, 0xc4, 0x00, 0x2a,
+    0x01, 0x78, 0x91, 0x14, 0xc2, 0x62, 0x6a, 0xc3, 0x00, 0x29, 0x01, 0x7b,
+    0xf1, 0xc2, 0x00, 0x65, 0x01, 0x7c, 0xb8, 0x14, 0xc2, 0x62, 0x76, 0x11,
+    0xc2, 0x62, 0x82, 0x07, 0xc2, 0x62, 0x8e, 0x03, 0xc2, 0x62, 0x9a, 0x0a,
+    0xc2, 0x62, 0xa9, 0x42, 0x00, 0xaf, 0x42, 0x62, 0xb5, 0x0b, 0xc2, 0x62,
+    0xbd, 0xc3, 0xb7, 0x42, 0x01, 0x79, 0x39, 0x03, 0xc2, 0x62, 0xcf, 0xc2,
+    0x01, 0x47, 0x01, 0x7c, 0xd1, 0xc2, 0x05, 0x1f, 0x01, 0x7c, 0xd8, 0xc4,
+    0x46, 0x3a, 0x01, 0x78, 0xe1, 0xc2, 0x38, 0xf3, 0x01, 0x7a, 0x21, 0x42,
+    0x00, 0x84, 0xc2, 0x62, 0xdd, 0xc2, 0x00, 0x6c, 0x01, 0x7b, 0xe8, 0x91,
+    0x01, 0x79, 0x0b, 0x02, 0x62, 0xe9, 0x42, 0x00, 0x3b, 0xc2, 0x62, 0xf5,
+    0xc3, 0x01, 0xd9, 0x01, 0x7d, 0x41, 0xc4, 0x6b, 0x89, 0x01, 0x7e, 0x08,
+    0x0b, 0xc2, 0x63, 0x01, 0x11, 0xc2, 0x63, 0x11, 0x14, 0xc2, 0x63, 0x2d,
+    0x03, 0xc2, 0x63, 0x3f, 0x0e, 0xc2, 0x63, 0x4b, 0xc3, 0x0a, 0x48, 0x01,
+    0x7c, 0xb0, 0x11, 0xc2, 0x63, 0x5d, 0xc2, 0x00, 0x3f, 0x01, 0x7b, 0xc8,
+    0xc2, 0x00, 0x35, 0x01, 0x7a, 0x89, 0x0b, 0xc2, 0x63, 0x67, 0x03, 0xc2,
+    0x63, 0x7f, 0xc6, 0x15, 0x49, 0x01, 0x7b, 0xd9, 0xc3, 0x60, 0x46, 0x01,
+    0x7c, 0xe1, 0x0e, 0xc2, 0x63, 0x91, 0x14, 0x42, 0x63, 0x9b, 0xc2, 0x00,
+    0x06, 0x01, 0x7a, 0xf9, 0x94, 0x01, 0x7b, 0xc0, 0xc5, 0xd9, 0x22, 0x01,
+    0x7c, 0xa9, 0xc6, 0xcd, 0xf4, 0x01, 0x7d, 0x28, 0xc2, 0x00, 0xce, 0x08,
+    0x96, 0x59, 0xc2, 0x0e, 0x60, 0x08, 0x96, 0x49, 0x83, 0x08, 0x96, 0x40,
+    0xc2, 0x00, 0xce, 0x08, 0x96, 0x39, 0x83, 0x08, 0x96, 0x30, 0xc4, 0xdd,
+    0xba, 0x08, 0x91, 0xf1, 0xc5, 0xdc, 0xc9, 0x08, 0x91, 0xb8, 0xc2, 0x0e,
+    0x60, 0x08, 0x90, 0xe1, 0xc2, 0x00, 0xce, 0x08, 0x90, 0xb9, 0x83, 0x08,
+    0x90, 0xb0, 0xc2, 0x00, 0xce, 0x08, 0x90, 0xa9, 0x83, 0x08, 0x90, 0xa0,
+    0x1e, 0xc2, 0x63, 0xa7, 0x01, 0x42, 0x63, 0xb5, 0x43, 0x13, 0x74, 0xc2,
+    0x63, 0xc1, 0x43, 0x74, 0x8b, 0xc2, 0x63, 0xc9, 0xc9, 0xa8, 0xe3, 0x00,
+    0xcf, 0x00, 0x44, 0xde, 0xfc, 0xc2, 0x63, 0xd5, 0x43, 0x8d, 0x35, 0x42,
+    0x63, 0xe1, 0xc3, 0x1c, 0xd5, 0x00, 0xcf, 0x89, 0xc4, 0xe0, 0x34, 0x00,
+    0xcf, 0x08, 0x12, 0xc2, 0x63, 0xed, 0x04, 0xc2, 0x63, 0xfc, 0xc4, 0xdc,
+    0x15, 0x00, 0xbf, 0x89, 0xc3, 0x17, 0x4f, 0x00, 0xbf, 0x80, 0xc7, 0xc9,
+    0x0d, 0x00, 0xbe, 0xe9, 0xcc, 0x89, 0x7c, 0x00, 0xbe, 0xe1, 0xc4, 0xdf,
+    0x50, 0x00, 0xbe, 0x78, 0xc6, 0xd0, 0x5e, 0x00, 0xbe, 0xd1, 0xc3, 0x00,
+    0xce, 0x00, 0xbe, 0xa1, 0xc6, 0xce, 0x42, 0x00, 0xbe, 0x70, 0xc5, 0xdd,
+    0x05, 0x00, 0xbe, 0xc1, 0x03, 0x42, 0x64, 0x08, 0xce, 0x74, 0x84, 0x00,
+    0xbe, 0xb1, 0xc4, 0xe1, 0xb8, 0x00, 0xbe, 0x90, 0xca, 0xa0, 0xba, 0x00,
+    0xbe, 0x69, 0xc6, 0xca, 0xac, 0x00, 0xbe, 0x50, 0xc4, 0xe2, 0x5c, 0x00,
+    0xbe, 0x61, 0xc6, 0xce, 0x72, 0x00, 0xbe, 0x38, 0x97, 0x00, 0xbe, 0x29,
+    0x8b, 0x00, 0xbe, 0x19, 0x87, 0x00, 0xbe, 0x11, 0x83, 0x00, 0xbd, 0xb0,
+    0x91, 0x00, 0xbe, 0x21, 0x87, 0x00, 0xbd, 0xf0, 0x87, 0x00, 0xbe, 0x01,
+    0x8b, 0x00, 0xbd, 0xc0, 0x83, 0x00, 0xbd, 0xf9, 0x9b, 0x00, 0xbd, 0xd0,
+    0x83, 0x00, 0xbd, 0xe9, 0x97, 0x00, 0xbd, 0xe0, 0x97, 0x00, 0xbd, 0x99,
+    0x8b, 0x00, 0xbd, 0x81, 0x83, 0x00, 0xbd, 0x21, 0x93, 0x00, 0xbd, 0x18,
+    0xc3, 0x01, 0xa1, 0x00, 0xbd, 0x91, 0xc3, 0x05, 0x16, 0x00, 0xbd, 0x88,
+    0x97, 0x00, 0xbd, 0x4b, 0x02, 0x64, 0x1a, 0x8d, 0x00, 0xbd, 0x40, 0x8b,
+    0x00, 0xbd, 0x30, 0x91, 0x00, 0xbc, 0xb9, 0x83, 0x00, 0xbc, 0xa8, 0x91,
+    0x00, 0xbc, 0x91, 0x83, 0x00, 0xbc, 0x80, 0x91, 0x00, 0xbc, 0x69, 0x83,
+    0x00, 0xbc, 0x58, 0x91, 0x00, 0xbc, 0x41, 0x83, 0x00, 0xbc, 0x30, 0x91,
+    0x00, 0xbc, 0x19, 0x83, 0x00, 0xbc, 0x08, 0xca, 0x8c, 0xe7, 0x08, 0x52,
+    0xb9, 0x96, 0x08, 0x52, 0x80, 0x91, 0x08, 0x50, 0x31, 0x87, 0x08, 0x50,
+    0x29, 0xc9, 0xaa, 0xd2, 0x08, 0x50, 0x19, 0x97, 0x08, 0x50, 0x11, 0x8b,
+    0x08, 0x50, 0x08, 0x16, 0xc2, 0x64, 0x1e, 0xc2, 0x00, 0xce, 0x08, 0x50,
+    0xd9, 0x83, 0x08, 0x50, 0xd0, 0xc2, 0x00, 0xce, 0x08, 0x50, 0xe9, 0x83,
+    0x08, 0x50, 0xe0, 0xcc, 0x1a, 0xf6, 0x0f, 0xb0, 0xc9, 0xcb, 0x1f, 0xbe,
+    0x0f, 0xb0, 0xd0, 0xc4, 0x97, 0x36, 0x0e, 0x98, 0x21, 0xc5, 0x71, 0x29,
+    0x0e, 0x98, 0x18, 0xc9, 0x11, 0xa1, 0x01, 0x24, 0x81, 0xc5, 0x04, 0x0c,
+    0x0f, 0x88, 0x50, 0xc9, 0x11, 0xa1, 0x01, 0x24, 0x79, 0xc5, 0x04, 0x0c,
+    0x0f, 0x88, 0x48, 0x01, 0x42, 0x64, 0x28, 0x01, 0x42, 0x64, 0x34, 0x01,
+    0x42, 0x64, 0x40, 0x01, 0x42, 0x64, 0x4c, 0x01, 0x42, 0x64, 0x58, 0x01,
+    0x42, 0x64, 0x64, 0xc9, 0x11, 0xa1, 0x01, 0x24, 0x41, 0xc5, 0x04, 0x0c,
+    0x0f, 0x88, 0x10, 0xc9, 0x11, 0xa1, 0x0f, 0x88, 0x01, 0xc5, 0x04, 0x0c,
+    0x0f, 0x88, 0x08, 0xc4, 0x28, 0x74, 0x01, 0x3c, 0x91, 0xc5, 0x0a, 0xfd,
+    0x01, 0x3c, 0x89, 0x15, 0xc2, 0x64, 0x70, 0x08, 0xc2, 0x64, 0x7c, 0x16,
+    0xc2, 0x64, 0x88, 0xc3, 0x05, 0x16, 0x01, 0x3c, 0x51, 0xc4, 0x18, 0xa7,
+    0x0f, 0x88, 0x60, 0xc4, 0x17, 0xf7, 0x01, 0x3b, 0xe1, 0xc2, 0x24, 0x36,
+    0x01, 0x3b, 0xd8, 0xc3, 0x0c, 0xf7, 0x01, 0x3b, 0xd1, 0xc3, 0x04, 0xa0,
+    0x01, 0x3b, 0xc8, 0xc4, 0x03, 0xe0, 0x01, 0x3b, 0xc1, 0xc2, 0x01, 0xa2,
+    0x01, 0x3b, 0xb8, 0xc4, 0x17, 0xf7, 0x01, 0x3c, 0x31, 0xc2, 0x24, 0x36,
+    0x01, 0x3c, 0x28, 0xc3, 0x0c, 0xf7, 0x01, 0x3c, 0x21, 0xc3, 0x04, 0xa0,
+    0x01, 0x3c, 0x18, 0xc4, 0x03, 0xe0, 0x01, 0x3c, 0x11, 0xc2, 0x01, 0xa2,
+    0x01, 0x3c, 0x08, 0xc4, 0x28, 0x74, 0x08, 0xca, 0xc9, 0xc5, 0x0a, 0xfd,
+    0x08, 0xca, 0xc1, 0x15, 0xc2, 0x64, 0x94, 0x08, 0xc2, 0x64, 0xa0, 0x16,
+    0xc2, 0x64, 0xac, 0xc3, 0x05, 0x16, 0x08, 0xca, 0x89, 0xc4, 0x18, 0xa7,
+    0x08, 0xca, 0x80, 0x91, 0x08, 0xc9, 0xc1, 0x03, 0xc2, 0x64, 0xb8, 0x87,
+    0x08, 0xc9, 0xa9, 0x97, 0x08, 0xc9, 0x9b, 0x02, 0x64, 0xc0, 0x8b, 0x08,
+    0xc9, 0x8a, 0x02, 0x64, 0xc4, 0xc2, 0x00, 0x89, 0x08, 0xc9, 0x71, 0x83,
+    0x08, 0xc9, 0x40, 0x83, 0x08, 0xc9, 0x61, 0xc2, 0x0d, 0x01, 0x08, 0xc9,
+    0x59, 0xc2, 0x00, 0xce, 0x08, 0xc9, 0x50, 0xc2, 0x1a, 0x18, 0x08, 0xc9,
+    0x31, 0x83, 0x08, 0xc9, 0x28, 0xc2, 0x00, 0xce, 0x08, 0xc9, 0x19, 0x83,
+    0x08, 0xc9, 0x10, 0xc2, 0x00, 0xce, 0x08, 0xc9, 0x09, 0x83, 0x08, 0xc9,
+    0x00, 0x83, 0x08, 0xc8, 0xf9, 0xc2, 0x03, 0x83, 0x08, 0xc8, 0xd1, 0xc2,
+    0x1a, 0x18, 0x08, 0xc8, 0xa9, 0xc2, 0x00, 0xeb, 0x08, 0xc8, 0x80, 0xc2,
+    0x00, 0xce, 0x08, 0xc8, 0xf1, 0x83, 0x08, 0xc8, 0xe9, 0x06, 0x42, 0x64,
+    0xc8, 0xc2, 0x00, 0xce, 0x08, 0xc8, 0xe1, 0x83, 0x08, 0xc8, 0xd9, 0xc2,
+    0x00, 0x51, 0x08, 0xc8, 0xb0, 0xc2, 0x00, 0xce, 0x08, 0xc8, 0x91, 0x83,
+    0x08, 0xc8, 0x88, 0xc2, 0x00, 0xce, 0x08, 0xc8, 0x79, 0x83, 0x08, 0xc8,
+    0x70, 0xc2, 0x00, 0xce, 0x08, 0xc8, 0x69, 0x83, 0x08, 0xc8, 0x60, 0x97,
+    0x08, 0xc8, 0x28, 0x8b, 0x08, 0xc8, 0x18, 0x83, 0x08, 0xc8, 0x08, 0xc4,
+    0x00, 0xa5, 0x01, 0x10, 0xa9, 0xc3, 0x00, 0x8e, 0x00, 0x07, 0xb8, 0xcf,
+    0x66, 0x47, 0x01, 0x58, 0xb1, 0xd0, 0x59, 0x82, 0x01, 0x58, 0xb9, 0xce,
+    0x6f, 0x6e, 0x01, 0x58, 0xc1, 0xd1, 0x51, 0x46, 0x01, 0x58, 0xc8, 0xc9,
+    0x33, 0x31, 0x0f, 0xc8, 0x50, 0xc9, 0x33, 0x31, 0x0f, 0xc8, 0x58, 0x42,
+    0x00, 0x4c, 0xc2, 0x64, 0xd2, 0x42, 0x01, 0xa2, 0x42, 0x64, 0xde, 0xcf,
+    0x5b, 0xf3, 0x0f, 0xc2, 0x99, 0xcc, 0x86, 0xd0, 0x0f, 0xc1, 0xd8, 0x45,
+    0x10, 0xe5, 0xc2, 0x64, 0xea, 0x51, 0x05, 0x34, 0x42, 0x64, 0xf6, 0xc4,
+    0x00, 0x84, 0x01, 0x0c, 0x9b, 0x02, 0x65, 0x02, 0xc5, 0xda, 0x62, 0x01,
+    0x70, 0xa0, 0xda, 0x1b, 0x02, 0x0f, 0xc4, 0xb8, 0xcb, 0x84, 0xcd, 0x01,
+    0x0f, 0x19, 0xcb, 0x84, 0x85, 0x01, 0x0e, 0x98, 0xc5, 0x00, 0x83, 0x01,
+    0x58, 0x39, 0xd3, 0x45, 0x9b, 0x01, 0x5c, 0x58, 0xa5, 0x0f, 0x82, 0x99,
+    0x9f, 0x0f, 0x82, 0x69, 0xa0, 0x0f, 0x82, 0x71, 0xa1, 0x0f, 0x82, 0x79,
+    0xa2, 0x0f, 0x82, 0x81, 0xa3, 0x0f, 0x82, 0x89, 0xa4, 0x0f, 0x82, 0x90,
+    0xa5, 0x0f, 0x81, 0xf1, 0xa3, 0x0f, 0x81, 0xe1, 0x9f, 0x0f, 0x81, 0xc1,
+    0xa0, 0x0f, 0x81, 0xc9, 0xa1, 0x0f, 0x81, 0xd1, 0xa2, 0x0f, 0x81, 0xd9,
+    0xa4, 0x0f, 0x81, 0xe8, 0xa2, 0x0f, 0x81, 0xa1, 0xa1, 0x0f, 0x81, 0x99,
+    0xa0, 0x0f, 0x81, 0x91, 0x9f, 0x0f, 0x81, 0x89, 0xa3, 0x0f, 0x81, 0xa9,
+    0xa4, 0x0f, 0x81, 0xb1, 0xa5, 0x0f, 0x81, 0xb8, 0x9f, 0x0f, 0x81, 0xf9,
+    0xa0, 0x0f, 0x82, 0x01, 0xa1, 0x0f, 0x82, 0x09, 0xa2, 0x0f, 0x82, 0x11,
+    0xa3, 0x0f, 0x82, 0x19, 0xa4, 0x0f, 0x82, 0x21, 0xa5, 0x0f, 0x82, 0x28,
+    0x9f, 0x0f, 0x82, 0x31, 0xa0, 0x0f, 0x82, 0x39, 0xa1, 0x0f, 0x82, 0x41,
+    0xa2, 0x0f, 0x82, 0x49, 0xa3, 0x0f, 0x82, 0x51, 0xa4, 0x0f, 0x82, 0x59,
+    0xa5, 0x0f, 0x82, 0x60, 0x9f, 0x0f, 0x82, 0xa1, 0xa0, 0x0f, 0x82, 0xa9,
+    0xa1, 0x0f, 0x82, 0xb1, 0xa2, 0x0f, 0x82, 0xb9, 0xa3, 0x0f, 0x82, 0xc1,
+    0xa4, 0x0f, 0x82, 0xc9, 0xa5, 0x0f, 0x82, 0xd0, 0x9f, 0x0f, 0x82, 0xd9,
+    0xa0, 0x0f, 0x82, 0xe1, 0xa1, 0x0f, 0x82, 0xe9, 0xa2, 0x0f, 0x82, 0xf1,
+    0xa3, 0x0f, 0x82, 0xf9, 0xa4, 0x0f, 0x83, 0x01, 0xa5, 0x0f, 0x83, 0x08,
+    0x9f, 0x0f, 0x83, 0x19, 0xa0, 0x0f, 0x83, 0x21, 0xa1, 0x0f, 0x83, 0x29,
+    0xa2, 0x0f, 0x83, 0x31, 0xa3, 0x0f, 0x83, 0x39, 0xa4, 0x0f, 0x83, 0x41,
+    0xa5, 0x0f, 0x83, 0x48, 0x9f, 0x0f, 0x83, 0x51, 0xa0, 0x0f, 0x83, 0x59,
+    0xa1, 0x0f, 0x83, 0x61, 0xa2, 0x0f, 0x83, 0x69, 0xa3, 0x0f, 0x83, 0x71,
+    0xa4, 0x0f, 0x83, 0x79, 0xa5, 0x0f, 0x83, 0x80, 0x9f, 0x0f, 0x83, 0x89,
+    0xa0, 0x0f, 0x83, 0x91, 0xa1, 0x0f, 0x83, 0x99, 0xa2, 0x0f, 0x83, 0xa1,
+    0xa3, 0x0f, 0x83, 0xa9, 0xa4, 0x0f, 0x83, 0xb1, 0xa5, 0x0f, 0x83, 0xb8,
+    0x9f, 0x0f, 0x83, 0xc1, 0xa0, 0x0f, 0x83, 0xc9, 0xa1, 0x0f, 0x83, 0xd1,
+    0xa2, 0x0f, 0x83, 0xd9, 0xa3, 0x0f, 0x83, 0xe1, 0xa4, 0x0f, 0x83, 0xe9,
+    0xa5, 0x0f, 0x83, 0xf0, 0x9f, 0x0f, 0x83, 0xf9, 0xa0, 0x0f, 0x84, 0x01,
+    0xa1, 0x0f, 0x84, 0x09, 0xa2, 0x0f, 0x84, 0x11, 0xa3, 0x0f, 0x84, 0x19,
+    0xa4, 0x0f, 0x84, 0x21, 0xa5, 0x0f, 0x84, 0x28, 0xa0, 0x0f, 0x84, 0x39,
+    0xa1, 0x0f, 0x84, 0x41, 0xa2, 0x0f, 0x84, 0x49, 0xa3, 0x0f, 0x84, 0x51,
+    0xa4, 0x0f, 0x84, 0x59, 0xa5, 0x0f, 0x84, 0x61, 0x9f, 0x0f, 0x84, 0x30,
+    0x9f, 0x0f, 0x84, 0x69, 0xa0, 0x0f, 0x84, 0x71, 0xa1, 0x0f, 0x84, 0x79,
+    0xa2, 0x0f, 0x84, 0x81, 0xa3, 0x0f, 0x84, 0x89, 0xa4, 0x0f, 0x84, 0x91,
+    0xa5, 0x0f, 0x84, 0x98, 0xc9, 0xaf, 0xe2, 0x01, 0x3d, 0xf9, 0x47, 0x1d,
+    0x5f, 0xc2, 0x65, 0x06, 0xca, 0x9f, 0x5c, 0x01, 0x53, 0xa0, 0xc3, 0x02,
+    0xca, 0x01, 0x1f, 0xc3, 0x02, 0x65, 0x12, 0xc4, 0x00, 0xdf, 0x01, 0x00,
+    0xb0, 0xc4, 0x14, 0x9f, 0x01, 0x16, 0x99, 0xc6, 0xc8, 0x27, 0x01, 0x57,
+    0x58, 0xc8, 0x07, 0xe1, 0x01, 0x16, 0x91, 0xc4, 0x1e, 0x5e, 0x01, 0x11,
+    0x60, 0x17, 0xc2, 0x65, 0x16, 0x46, 0x1f, 0xa2, 0xc2, 0x65, 0x2e, 0x16,
+    0xc2, 0x65, 0x3a, 0xcf, 0x6b, 0x06, 0x01, 0x57, 0xe8, 0x14, 0xc2, 0x65,
+    0x46, 0xc3, 0x23, 0xe0, 0x01, 0x4f, 0xd0, 0xc5, 0xd2, 0xc3, 0x01, 0x01,
+    0x09, 0xc8, 0x32, 0xba, 0x01, 0x57, 0x50, 0xdd, 0x0f, 0x43, 0x01, 0x00,
+    0xf9, 0xc5, 0x58, 0x03, 0x01, 0x72, 0x00, 0x11, 0xc2, 0x65, 0x55, 0xdc,
+    0x13, 0xdf, 0x01, 0x4c, 0xa8, 0xc9, 0x02, 0xa0, 0x01, 0x55, 0x0b, 0x02,
+    0x65, 0x5f, 0xcc, 0x06, 0x09, 0x01, 0x55, 0x10, 0x47, 0xc8, 0x49, 0xc2,
+    0x65, 0x65, 0xcf, 0x65, 0xde, 0x01, 0x0a, 0x01, 0x48, 0x09, 0x39, 0xc2,
+    0x65, 0x71, 0x46, 0x00, 0xb5, 0x42, 0x65, 0x96, 0x4c, 0x21, 0xcd, 0xc2,
+    0x65, 0xa2, 0x48, 0x05, 0x5c, 0x42, 0x65, 0xae, 0xc4, 0x1f, 0xf7, 0x08,
+    0xc1, 0xc9, 0xc5, 0x40, 0xb0, 0x08, 0xc1, 0xc0, 0x97, 0x08, 0xc1, 0xb1,
+    0x8b, 0x08, 0xc1, 0xa1, 0x83, 0x08, 0xc1, 0x60, 0x94, 0x08, 0xc1, 0x90,
+    0x97, 0x08, 0xc1, 0x80, 0x8b, 0x08, 0xc1, 0x70, 0xc2, 0x00, 0x3b, 0x08,
+    0xc1, 0x59, 0x83, 0x08, 0xc1, 0x20, 0x83, 0x08, 0xc1, 0x49, 0xc2, 0x0d,
+    0x01, 0x08, 0xc1, 0x41, 0xc2, 0x00, 0xce, 0x08, 0xc1, 0x38, 0xc2, 0x00,
+    0xce, 0x08, 0xc1, 0x09, 0x83, 0x08, 0xc1, 0x00, 0xc2, 0x00, 0xce, 0x08,
+    0xc0, 0xf9, 0x83, 0x08, 0xc0, 0xf0, 0x83, 0x08, 0xc0, 0xe9, 0xc2, 0x03,
+    0x83, 0x08, 0xc0, 0xc1, 0xc2, 0x1a, 0x18, 0x08, 0xc0, 0x99, 0xc2, 0x00,
+    0xeb, 0x08, 0xc0, 0x70, 0xc2, 0x00, 0xce, 0x08, 0xc0, 0xe1, 0x83, 0x08,
+    0xc0, 0xd9, 0x06, 0x42, 0x65, 0xc0, 0xc2, 0x00, 0xce, 0x08, 0xc0, 0xd1,
+    0x83, 0x08, 0xc0, 0xc9, 0x16, 0x42, 0x65, 0xca, 0xc2, 0x00, 0xce, 0x08,
+    0xc0, 0x91, 0x83, 0x08, 0xc0, 0x88, 0xc2, 0x00, 0xce, 0x08, 0xc0, 0x81,
+    0x83, 0x08, 0xc0, 0x78, 0xc2, 0x00, 0xce, 0x08, 0xc0, 0x69, 0x83, 0x08,
+    0xc0, 0x60, 0xc2, 0x00, 0xce, 0x08, 0xc0, 0x59, 0x83, 0x08, 0xc0, 0x50,
+    0x97, 0x08, 0xc0, 0x49, 0x8b, 0x08, 0xc0, 0x39, 0x83, 0x08, 0xc0, 0x08,
+    0x97, 0x08, 0xc0, 0x28, 0x8b, 0x08, 0xc0, 0x18, 0x45, 0x2b, 0x80, 0xc2,
+    0x65, 0xd4, 0x46, 0x2c, 0x9e, 0xc2, 0x65, 0xea, 0xc2, 0x0d, 0x1d, 0x08,
+    0x20, 0x61, 0x11, 0xc2, 0x66, 0x00, 0xc2, 0x4c, 0x38, 0x08, 0x20, 0x71,
+    0xc3, 0xa7, 0xa2, 0x08, 0x20, 0x79, 0x8a, 0x08, 0x20, 0x81, 0xc3, 0x07,
+    0x67, 0x08, 0x20, 0x89, 0xc3, 0xa9, 0x6a, 0x08, 0x20, 0x91, 0x16, 0xc2,
+    0x66, 0x08, 0xc3, 0x0e, 0xc8, 0x08, 0x20, 0xa1, 0xc4, 0x46, 0x41, 0x08,
+    0x20, 0xa9, 0xc3, 0x30, 0x3f, 0x08, 0x20, 0xb1, 0xc3, 0x6d, 0x08, 0x08,
+    0x20, 0xb9, 0xc3, 0x8f, 0xf3, 0x08, 0x20, 0xc1, 0x07, 0xc2, 0x66, 0x14,
+    0xc3, 0x14, 0xf4, 0x08, 0x20, 0xd1, 0x1c, 0x42, 0x66, 0x3c, 0x45, 0x2b,
+    0x80, 0xc2, 0x66, 0x48, 0x46, 0x2c, 0x9e, 0xc2, 0x66, 0x5e, 0xc2, 0x0d,
+    0x1d, 0x08, 0x21, 0xa1, 0x11, 0xc2, 0x66, 0x74, 0xc2, 0x4c, 0x38, 0x08,
+    0x21, 0xb1, 0xc3, 0xa7, 0xa2, 0x08, 0x21, 0xb9, 0x8a, 0x08, 0x21, 0xc1,
+    0xc3, 0x07, 0x67, 0x08, 0x21, 0xc9, 0xc3, 0xa9, 0x6a, 0x08, 0x21, 0xd1,
+    0x16, 0xc2, 0x66, 0x7c, 0xc3, 0x0e, 0xc8, 0x08, 0x21, 0xe1, 0xc4, 0x46,
+    0x41, 0x08, 0x21, 0xe9, 0xc3, 0x30, 0x3f, 0x08, 0x21, 0xf1, 0xc3, 0x6d,
+    0x08, 0x08, 0x21, 0xf9, 0xc3, 0x8f, 0xf3, 0x08, 0x22, 0x01, 0x07, 0xc2,
+    0x66, 0x88, 0xc3, 0x14, 0xf4, 0x08, 0x22, 0x11, 0x1c, 0x42, 0x66, 0xb0,
+    0xc4, 0x00, 0x2f, 0x01, 0x1e, 0x61, 0xc5, 0x00, 0x64, 0x01, 0x1d, 0xf8,
+    0xc4, 0x00, 0x2f, 0x01, 0x1e, 0x59, 0xc5, 0x00, 0x64, 0x01, 0x1d, 0xf0,
+    0x0e, 0xc2, 0x66, 0xbc, 0x83, 0x00, 0x49, 0x90, 0xc2, 0x00, 0x3b, 0x00,
+    0x49, 0x89, 0x83, 0x00, 0x49, 0x81, 0xc2, 0x00, 0xce, 0x00, 0x4a, 0xe8,
+    0x83, 0x00, 0x49, 0x79, 0xc2, 0x1a, 0x18, 0x00, 0x4a, 0xf8, 0xc9, 0xb0,
+    0x96, 0x00, 0x4b, 0xc0, 0xc2, 0x00, 0xce, 0x00, 0x49, 0x69, 0x83, 0x00,
+    0x49, 0x61, 0xc2, 0x00, 0xa0, 0x00, 0x4b, 0xf8, 0xc2, 0x00, 0xce, 0x00,
+    0x49, 0x59, 0x83, 0x00, 0x49, 0x50, 0x10, 0xc2, 0x66, 0xc6, 0x83, 0x00,
+    0x49, 0x41, 0xc2, 0x1a, 0x18, 0x00, 0x48, 0xf1, 0xc2, 0x00, 0xeb, 0x00,
+    0x48, 0xc8, 0xc2, 0x00, 0xce, 0x00, 0x49, 0x39, 0x83, 0x00, 0x49, 0x31,
+    0x06, 0x42, 0x66, 0xd0, 0xc2, 0x00, 0xce, 0x00, 0x49, 0x29, 0x83, 0x00,
+    0x49, 0x21, 0x16, 0x42, 0x66, 0xde, 0xc2, 0x00, 0xce, 0x00, 0x48, 0xe9,
+    0x83, 0x00, 0x48, 0xe1, 0xc2, 0x21, 0x7d, 0x00, 0x4b, 0xe0, 0xc2, 0x00,
+    0xce, 0x00, 0x48, 0xd9, 0x83, 0x00, 0x48, 0xd2, 0x02, 0x66, 0xe8, 0x0a,
+    0xc2, 0x66, 0xee, 0x83, 0x00, 0x48, 0xb9, 0xcb, 0x22, 0xbe, 0x00, 0x4b,
+    0xe9, 0xc2, 0x00, 0xeb, 0x00, 0x4b, 0xd8, 0x0a, 0xc2, 0x66, 0xf8, 0x83,
+    0x00, 0x48, 0xa8, 0x97, 0x00, 0x48, 0xa1, 0x8b, 0x00, 0x48, 0x81, 0x83,
+    0x00, 0x48, 0x31, 0x9b, 0x05, 0x47, 0xf1, 0x99, 0x00, 0x4b, 0xa8, 0xc2,
+    0x0b, 0x28, 0x00, 0x4b, 0xa1, 0x87, 0x00, 0x4b, 0x98, 0x0a, 0xc2, 0x67,
+    0x02, 0xc2, 0x0d, 0x01, 0x00, 0x49, 0xb9, 0x83, 0x00, 0x49, 0xc0, 0x47,
+    0xaa, 0xd3, 0xc2, 0x67, 0x0c, 0x83, 0x00, 0x49, 0xa8, 0x97, 0x00, 0x48,
+    0x53, 0x02, 0x67, 0x1a, 0x87, 0x00, 0x4b, 0xb0, 0x8b, 0x00, 0x48, 0x40,
+    0xc7, 0xc3, 0x1e, 0x00, 0x4b, 0xd1, 0x83, 0x00, 0x49, 0xc8, 0xc2, 0x00,
+    0xce, 0x00, 0x4b, 0xc9, 0x83, 0x00, 0x4a, 0xd8, 0x42, 0x06, 0xb4, 0xc2,
+    0x67, 0x1e, 0x03, 0xc2, 0x67, 0x2a, 0xcb, 0x1f, 0xe9, 0x00, 0x48, 0x0b,
+    0x02, 0x67, 0x36, 0xd4, 0x39, 0x0a, 0x00, 0x48, 0x01, 0x15, 0xc2, 0x67,
+    0x3a, 0xc8, 0xbb, 0xa8, 0x05, 0x47, 0xc1, 0xd9, 0x1f, 0xe2, 0x05, 0x47,
+    0xa1, 0xd0, 0x5e, 0xe2, 0x00, 0x4b, 0x89, 0xc5, 0x34, 0xd9, 0x00, 0x49,
+    0xe0, 0xc6, 0x6c, 0x2e, 0x00, 0x4a, 0x89, 0xc8, 0x6c, 0x2c, 0x00, 0x4a,
+    0x90, 0x9b, 0x05, 0x47, 0xf9, 0x99, 0x00, 0x4a, 0x79, 0x97, 0x00, 0x4a,
+    0x61, 0x8b, 0x00, 0x4a, 0x41, 0x83, 0x00, 0x49, 0xf0, 0x87, 0x00, 0x49,
+    0xd1, 0xc2, 0x0b, 0x28, 0x00, 0x49, 0xd8, 0x91, 0x00, 0x4a, 0x51, 0x87,
+    0x00, 0x4a, 0x30, 0x91, 0x00, 0x4a, 0x49, 0x87, 0x00, 0x4a, 0x29, 0xc6,
+    0xce, 0xae, 0x00, 0x4a, 0xa8, 0x94, 0x00, 0x4a, 0x1b, 0x02, 0x67, 0x46,
+    0x8e, 0x00, 0x4b, 0x12, 0x02, 0x67, 0x4a, 0x97, 0x00, 0x4a, 0x13, 0x02,
+    0x67, 0x4e, 0x87, 0x00, 0x4a, 0xb0, 0x8b, 0x00, 0x4a, 0x00, 0xc4, 0x18,
+    0xa7, 0x00, 0x4b, 0x31, 0xc3, 0x05, 0x16, 0x00, 0x4b, 0x39, 0x16, 0xc2,
+    0x67, 0x52, 0x08, 0xc2, 0x67, 0x5e, 0x15, 0xc2, 0x67, 0x6a, 0xc5, 0x0a,
+    0xfd, 0x00, 0x4b, 0x71, 0xc4, 0x28, 0x74, 0x00, 0x4b, 0x78, 0x03, 0xc2,
+    0x67, 0x76, 0xc8, 0x03, 0xc1, 0x0d, 0xe4, 0xc3, 0x02, 0x67, 0x82, 0xc4,
+    0x54, 0xc6, 0x0d, 0xe4, 0xb9, 0x0e, 0xc2, 0x67, 0x88, 0xc6, 0x00, 0x7c,
+    0x0d, 0xe4, 0xa9, 0xc3, 0x01, 0xa5, 0x0d, 0xe4, 0xa1, 0xc5, 0x20, 0x53,
+    0x0d, 0xe4, 0x91, 0xcb, 0x8d, 0x3e, 0x0d, 0xe4, 0x88, 0xc7, 0x28, 0x55,
+    0x0d, 0xe3, 0xa8, 0xc3, 0x00, 0xe0, 0x0d, 0xe4, 0x31, 0xc9, 0xaa, 0xf6,
+    0x0d, 0xe4, 0x18, 0xc5, 0xdb, 0x0c, 0x0d, 0xe3, 0xc3, 0x02, 0x67, 0x94,
+    0xc2, 0x01, 0xd7, 0x0d, 0xe3, 0xc8, 0x99, 0x0d, 0xe3, 0x00, 0xc3, 0x00,
+    0x8b, 0x0d, 0xe1, 0xb9, 0x95, 0x0d, 0xe1, 0xb0, 0x92, 0x0d, 0xe1, 0xa3,
+    0x02, 0x67, 0x9a, 0x96, 0x0d, 0xe1, 0x93, 0x02, 0x67, 0xa0, 0x8c, 0x0d,
+    0xe1, 0x03, 0x02, 0x67, 0xa6, 0x95, 0x0d, 0xe1, 0x51, 0xc8, 0x33, 0x32,
+    0x0d, 0xe1, 0x2b, 0x02, 0x67, 0xac, 0x8d, 0x0d, 0xe1, 0xfb, 0x02, 0x67,
+    0xb2, 0x8f, 0x0d, 0xe1, 0xe1, 0x90, 0x0d, 0xe1, 0xd8, 0x8c, 0x0d, 0xe0,
+    0xa9, 0xc2, 0x17, 0x62, 0x0d, 0xe0, 0x91, 0x11, 0xc2, 0x67, 0xb8, 0xc2,
+    0x00, 0x6b, 0x0d, 0xe3, 0x41, 0x07, 0xc2, 0x67, 0xc0, 0x97, 0x0d, 0xe2,
+    0xc0, 0x90, 0x0d, 0xe1, 0x83, 0x02, 0x67, 0xcc, 0x95, 0x0d, 0xe1, 0x4b,
+    0x02, 0x67, 0xd2, 0x8f, 0x0d, 0xe0, 0xfb, 0x02, 0x67, 0xd8, 0xc8, 0x33,
+    0x32, 0x0d, 0xe1, 0x1a, 0x02, 0x67, 0xde, 0x8f, 0x0d, 0xe0, 0xf3, 0x02,
+    0x67, 0xe4, 0x95, 0x0d, 0xe1, 0x41, 0xc8, 0x33, 0x32, 0x0d, 0xe1, 0x10,
+    0x83, 0x0d, 0xe3, 0x21, 0x8b, 0x0d, 0xe3, 0x19, 0x91, 0x0d, 0xe3, 0x11,
+    0x97, 0x0d, 0xe3, 0x08, 0x90, 0x0d, 0xe0, 0xeb, 0x02, 0x67, 0xea, 0x95,
+    0x0d, 0xe1, 0x39, 0xc8, 0x33, 0x32, 0x0d, 0xe1, 0x08, 0x97, 0x0d, 0xe2,
+    0xb1, 0x8b, 0x0d, 0xe2, 0x68, 0x97, 0x0d, 0xe2, 0xa9, 0x8b, 0x0d, 0xe2,
+    0x78, 0x8f, 0x0d, 0xe0, 0x79, 0xc3, 0x00, 0x8b, 0x0d, 0xe1, 0xe8, 0x8f,
+    0x0d, 0xe3, 0x31, 0x90, 0x0d, 0xe3, 0x28, 0xd7, 0x2a, 0x3f, 0x0f, 0xd2,
+    0x68, 0x49, 0x2a, 0x3f, 0x42, 0x67, 0xf0, 0xc3, 0x00, 0xb1, 0x0f, 0xd0,
+    0x03, 0x02, 0x67, 0xfc, 0xc5, 0x8f, 0xe3, 0x0f, 0xd0, 0x22, 0x02, 0x68,
+    0x02, 0x49, 0x2a, 0x3f, 0x42, 0x68, 0x08, 0x49, 0x2a, 0x3f, 0x42, 0x68,
+    0x14, 0x49, 0x2a, 0x3f, 0x42, 0x68, 0x20, 0x0d, 0xc2, 0x68, 0x2c, 0xc5,
+    0xb0, 0x06, 0x0f, 0xd1, 0x59, 0xc4, 0xde, 0xd0, 0x0f, 0xd1, 0x61, 0xc6,
+    0xd1, 0xd8, 0x0f, 0xd1, 0x69, 0xc4, 0xe3, 0x24, 0x0f, 0xd1, 0x78, 0x43,
+    0x00, 0x8f, 0xc2, 0x68, 0x38, 0xc4, 0xe0, 0xb8, 0x08, 0xa2, 0x50, 0xcd,
+    0x7c, 0x7c, 0x08, 0xa2, 0xf9, 0x47, 0xaa, 0xd3, 0x42, 0x68, 0x60, 0x83,
+    0x08, 0xa1, 0x99, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0x89, 0xc2, 0x0d, 0x01,
+    0x08, 0xa1, 0x90, 0x83, 0x08, 0xa1, 0x19, 0xc2, 0x03, 0x83, 0x08, 0xa0,
+    0xf1, 0x1b, 0xc2, 0x68, 0x6e, 0x09, 0xc2, 0x68, 0x78, 0xc2, 0x00, 0xce,
+    0x08, 0xa1, 0x20, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0x11, 0x83, 0x08, 0xa1,
+    0x09, 0x06, 0x42, 0x68, 0x82, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0x01, 0x83,
+    0x08, 0xa0, 0xf9, 0x16, 0x42, 0x68, 0x8c, 0xc2, 0x00, 0xce, 0x08, 0xa0,
+    0xb9, 0x83, 0x08, 0xa0, 0xb0, 0xc2, 0x00, 0xce, 0x08, 0xa0, 0xa9, 0x83,
+    0x08, 0xa0, 0xa0, 0xc2, 0x00, 0xce, 0x08, 0xa0, 0x89, 0x83, 0x08, 0xa0,
+    0x80, 0xc2, 0x00, 0xce, 0x08, 0xa0, 0x79, 0x83, 0x08, 0xa0, 0x70, 0x97,
+    0x08, 0xa0, 0x69, 0x8b, 0x08, 0xa0, 0x59, 0x83, 0x08, 0xa0, 0x08, 0x97,
+    0x08, 0xa0, 0x28, 0x8b, 0x08, 0xa0, 0x18, 0x83, 0x08, 0xa1, 0x29, 0xc2,
+    0x00, 0xce, 0x08, 0xa1, 0x30, 0x83, 0x08, 0xa1, 0x39, 0xc2, 0x00, 0xce,
+    0x08, 0xa1, 0x40, 0x83, 0x08, 0xa1, 0x49, 0xc2, 0x00, 0xce, 0x08, 0xa1,
+    0x50, 0x83, 0x08, 0xa1, 0x61, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0x68, 0x83,
+    0x08, 0xa1, 0x71, 0xc2, 0x00, 0xce, 0x08, 0xa1, 0x78, 0xc5, 0x04, 0x0c,
+    0x08, 0xa2, 0xd1, 0xc5, 0x81, 0xf7, 0x08, 0xa2, 0x60, 0xc4, 0x28, 0x74,
+    0x08, 0xa2, 0xc9, 0xc5, 0x0a, 0xfd, 0x08, 0xa2, 0xc1, 0x15, 0xc2, 0x68,
+    0x96, 0x08, 0xc2, 0x68, 0xa2, 0x16, 0xc2, 0x68, 0xae, 0xc3, 0x05, 0x16,
+    0x08, 0xa2, 0x89, 0xc4, 0x18, 0xa7, 0x08, 0xa2, 0x80, 0x97, 0x08, 0xa2,
+    0x09, 0x8b, 0x08, 0xa1, 0xf9, 0x83, 0x08, 0xa1, 0xa8, 0x8e, 0x08, 0xa1,
+    0xe3, 0x02, 0x68, 0xba, 0x94, 0x08, 0xa1, 0xd2, 0x02, 0x68, 0xbe, 0x97,
+    0x08, 0xa1, 0xc8, 0x8b, 0x08, 0xa1, 0xb8, 0x98, 0x00, 0xce, 0xf8, 0xcd,
+    0x7e, 0xab, 0x00, 0xce, 0xd1, 0x49, 0xa9, 0x85, 0x42, 0x68, 0xc2, 0xc4,
+    0x28, 0x74, 0x00, 0xce, 0xc9, 0xc5, 0x0a, 0xfd, 0x00, 0xce, 0xc1, 0x15,
+    0xc2, 0x68, 0xca, 0x08, 0xc2, 0x68, 0xd6, 0x16, 0xc2, 0x68, 0xe2, 0xc3,
+    0x05, 0x16, 0x00, 0xce, 0x89, 0xc4, 0x18, 0xa7, 0x00, 0xce, 0x80, 0x46,
+    0x28, 0x97, 0xc2, 0x68, 0xee, 0x44, 0x0a, 0x78, 0xc2, 0x69, 0x09, 0x45,
+    0x08, 0xad, 0x42, 0x69, 0x57, 0x0b, 0xc2, 0x69, 0xa5, 0x97, 0x00, 0xcd,
+    0x9b, 0x02, 0x69, 0xad, 0x91, 0x00, 0xcd, 0xbb, 0x02, 0x69, 0xbc, 0x03,
+    0xc2, 0x69, 0xc7, 0x87, 0x00, 0xcd, 0xa9, 0xcf, 0x65, 0xc0, 0x00, 0xcd,
+    0x80, 0x9c, 0x0f, 0x8c, 0x49, 0x9b, 0x0f, 0x8c, 0x41, 0x9a, 0x0f, 0x8c,
+    0x39, 0x99, 0x0f, 0x8c, 0x31, 0x98, 0x0f, 0x8c, 0x29, 0x97, 0x0f, 0x8c,
+    0x21, 0x96, 0x0f, 0x8c, 0x19, 0x95, 0x0f, 0x8c, 0x11, 0x94, 0x0f, 0x8c,
+    0x09, 0x93, 0x0f, 0x8c, 0x01, 0x92, 0x0f, 0x8b, 0xf9, 0x91, 0x0f, 0x8b,
+    0xf1, 0x90, 0x0f, 0x8b, 0xe9, 0x8f, 0x0f, 0x8b, 0xe1, 0x8e, 0x0f, 0x8b,
+    0xd9, 0x8d, 0x0f, 0x8b, 0xd1, 0x8c, 0x0f, 0x8b, 0xc9, 0x8b, 0x0f, 0x8b,
+    0xc1, 0x8a, 0x0f, 0x8b, 0xb9, 0x89, 0x0f, 0x8b, 0xb1, 0x88, 0x0f, 0x8b,
+    0xa9, 0x87, 0x0f, 0x8b, 0xa1, 0x86, 0x0f, 0x8b, 0x99, 0x85, 0x0f, 0x8b,
+    0x91, 0x84, 0x0f, 0x8b, 0x89, 0x83, 0x0f, 0x8b, 0x80, 0x16, 0xc2, 0x69,
+    0xd6, 0xc8, 0x48, 0x01, 0x01, 0x27, 0x99, 0x07, 0xc2, 0x69, 0xe2, 0x15,
+    0xc2, 0x69, 0xee, 0x08, 0x42, 0x69, 0xfa, 0x9c, 0x0f, 0x8b, 0x49, 0x9b,
+    0x0f, 0x8b, 0x41, 0x9a, 0x0f, 0x8b, 0x39, 0x99, 0x0f, 0x8b, 0x31, 0x98,
+    0x0f, 0x8b, 0x29, 0x97, 0x0f, 0x8b, 0x21, 0x96, 0x0f, 0x8b, 0x19, 0x95,
+    0x0f, 0x8b, 0x11, 0x94, 0x0f, 0x8b, 0x09, 0x93, 0x0f, 0x8b, 0x01, 0x92,
+    0x0f, 0x8a, 0xf9, 0x91, 0x0f, 0x8a, 0xf1, 0x90, 0x0f, 0x8a, 0xe9, 0x8f,
+    0x0f, 0x8a, 0xe1, 0x8e, 0x0f, 0x8a, 0xd9, 0x8d, 0x0f, 0x8a, 0xd1, 0x8c,
+    0x0f, 0x8a, 0xc9, 0x8b, 0x0f, 0x8a, 0xc1, 0x8a, 0x0f, 0x8a, 0xb9, 0x89,
+    0x0f, 0x8a, 0xb1, 0x88, 0x0f, 0x8a, 0xa9, 0x87, 0x0f, 0x8a, 0xa1, 0x86,
+    0x0f, 0x8a, 0x99, 0x85, 0x0f, 0x8a, 0x91, 0x84, 0x0f, 0x8a, 0x89, 0x83,
+    0x0f, 0x8a, 0x80, 0x97, 0x08, 0xce, 0xe9, 0x8b, 0x08, 0xce, 0xd9, 0x83,
+    0x08, 0xce, 0x88, 0x94, 0x08, 0xce, 0xb8, 0x97, 0x08, 0xce, 0xa8, 0x8b,
+    0x08, 0xce, 0x98, 0xc7, 0x7e, 0x15, 0x08, 0xcf, 0x09, 0xc7, 0x14, 0x03,
+    0x08, 0xce, 0xf0, 0xc4, 0x1f, 0xf7, 0x08, 0xcf, 0x01, 0xc5, 0x40, 0xb0,
+    0x08, 0xce, 0xf8, 0xc2, 0x00, 0x3b, 0x08, 0xce, 0x81, 0x83, 0x08, 0xce,
+    0x40, 0xc2, 0x00, 0x89, 0x08, 0xce, 0x79, 0x83, 0x08, 0xce, 0x48, 0x83,
+    0x08, 0xce, 0x69, 0xc2, 0x0d, 0x01, 0x08, 0xce, 0x61, 0xc2, 0x00, 0xce,
+    0x08, 0xce, 0x58, 0x83, 0x08, 0xce, 0x51, 0xc8, 0xaa, 0xd3, 0x08, 0xcd,
+    0x32, 0x02, 0x6a, 0x06, 0xc2, 0x00, 0xce, 0x08, 0xce, 0x29, 0x83, 0x08,
+    0xce, 0x20, 0xc2, 0x00, 0xce, 0x08, 0xce, 0x19, 0x83, 0x08, 0xce, 0x10,
+    0x83, 0x08, 0xce, 0x09, 0xc2, 0x03, 0x83, 0x08, 0xcd, 0xe1, 0xc2, 0x1a,
+    0x18, 0x08, 0xcd, 0xb9, 0xc2, 0x00, 0xeb, 0x08, 0xcd, 0x90, 0xc2, 0x00,
+    0xce, 0x08, 0xce, 0x01, 0x83, 0x08, 0xcd, 0xf9, 0x06, 0x42, 0x6a, 0x0a,
+    0xc2, 0x00, 0xce, 0x08, 0xcd, 0xf1, 0x83, 0x08, 0xcd, 0xe9, 0x16, 0x42,
+    0x6a, 0x14, 0xc2, 0x00, 0xce, 0x08, 0xcd, 0xb1, 0x83, 0x08, 0xcd, 0xa8,
+    0xc2, 0x00, 0xce, 0x08, 0xcd, 0xa1, 0x83, 0x08, 0xcd, 0x98, 0xc2, 0x00,
+    0xce, 0x08, 0xcd, 0x89, 0x83, 0x08, 0xcd, 0x80, 0xc2, 0x00, 0xce, 0x08,
+    0xcd, 0x79, 0x83, 0x08, 0xcd, 0x70, 0x97, 0x08, 0xcd, 0x69, 0x8b, 0x08,
+    0xcd, 0x59, 0x83, 0x08, 0xcd, 0x08, 0x97, 0x08, 0xcd, 0x28, 0x8b, 0x08,
+    0xcd, 0x18, 0xc8, 0x0c, 0xe6, 0x08, 0x45, 0x78, 0x19, 0xc2, 0x6a, 0x1e,
+    0xc2, 0x00, 0x79, 0x08, 0x45, 0x69, 0xc4, 0x03, 0xe0, 0x08, 0x45, 0x48,
+    0xc3, 0x0c, 0xf7, 0x08, 0x45, 0x61, 0xc3, 0x04, 0xa0, 0x08, 0x45, 0x50,
+    0xc2, 0x2f, 0x05, 0x08, 0x44, 0xf1, 0xc3, 0x0a, 0xc8, 0x08, 0x44, 0x58,
+    0xc3, 0x11, 0x9a, 0x08, 0x44, 0xe9, 0x03, 0x42, 0x6a, 0x28, 0xc4, 0x3c,
+    0xf4, 0x08, 0x44, 0xe1, 0xc3, 0x20, 0xb0, 0x08, 0x44, 0xa1, 0xc3, 0x03,
+    0xb0, 0x08, 0x44, 0x91, 0xc6, 0xd0, 0xf4, 0x08, 0x44, 0x81, 0xc4, 0xe0,
+    0x58, 0x08, 0x44, 0x71, 0xc4, 0x4e, 0x09, 0x08, 0x44, 0x61, 0xc2, 0x00,
+    0x61, 0x08, 0x44, 0x31, 0xc4, 0xe0, 0x9c, 0x08, 0x44, 0x11, 0xc5, 0x9f,
+    0x89, 0x08, 0x44, 0x00, 0xc3, 0x16, 0xc8, 0x08, 0x44, 0xb9, 0xc4, 0x35,
+    0x13, 0x08, 0x44, 0x08, 0xc2, 0x00, 0x60, 0x08, 0x44, 0x50, 0x49, 0x01,
+    0x4c, 0xc2, 0x6a, 0x34, 0xcc, 0x84, 0x84, 0x01, 0x0e, 0xb9, 0x03, 0xc2,
+    0x6a, 0x46, 0xcb, 0x03, 0x3e, 0x01, 0x58, 0x01, 0xcb, 0x94, 0xc3, 0x01,
+    0x58, 0x41, 0xd5, 0x02, 0xb4, 0x01, 0x5b, 0x3b, 0x02, 0x6a, 0x55, 0xd0,
+    0x5b, 0xf2, 0x0f, 0xc2, 0xa8, 0x03, 0xc2, 0x6a, 0x5b, 0xcc, 0x84, 0x84,
+    0x01, 0x0e, 0xb1, 0xcb, 0x03, 0x3e, 0x01, 0x58, 0x09, 0xcb, 0x94, 0xc3,
+    0x01, 0x58, 0x49, 0xd5, 0x02, 0xb4, 0x01, 0x5b, 0x33, 0x02, 0x6a, 0x6a,
+    0x49, 0x01, 0x4c, 0xc2, 0x6a, 0x70, 0xd0, 0x5b, 0xf2, 0x0f, 0xc2, 0xa0,
+    0x49, 0x54, 0x43, 0xc2, 0x6a, 0x82, 0x43, 0x00, 0xe5, 0xc2, 0x6a, 0x8e,
+    0xd0, 0x5a, 0xb2, 0x05, 0x41, 0xb9, 0xca, 0xa1, 0xb4, 0x05, 0x41, 0xc0,
+    0xe0, 0x09, 0x09, 0x01, 0x3d, 0x78, 0xd7, 0x29, 0x59, 0x01, 0x17, 0x19,
+    0xd4, 0x3d, 0x7e, 0x01, 0x17, 0x10, 0xc9, 0x2f, 0xa0, 0x01, 0x14, 0x29,
+    0xc7, 0x38, 0x56, 0x01, 0x14, 0x20, 0xc2, 0x00, 0x89, 0x0f, 0x08, 0xf1,
+    0x83, 0x0f, 0x08, 0xe0, 0xc2, 0x66, 0x73, 0x0f, 0x08, 0x99, 0xc2, 0x0d,
+    0x01, 0x0f, 0x08, 0x69, 0x83, 0x0f, 0x08, 0x10, 0xcd, 0x7d, 0x59, 0x01,
+    0x24, 0xd9, 0xcd, 0x79, 0x70, 0x01, 0x24, 0x98, 0xcf, 0x60, 0xb6, 0x01,
+    0x24, 0xb9, 0xc2, 0x00, 0x8f, 0x00, 0x01, 0x18, 0xc2, 0x00, 0x3b, 0x00,
+    0x3f, 0x51, 0xc3, 0x19, 0x59, 0x00, 0x3f, 0x49, 0xc2, 0x21, 0x7d, 0x00,
+    0x3f, 0x40, 0xc7, 0xc4, 0x83, 0x00, 0x3f, 0x38, 0xc7, 0xc4, 0x83, 0x00,
+    0x3f, 0x00, 0xd0, 0x5f, 0x92, 0x01, 0x4d, 0xa1, 0xd1, 0x01, 0x78, 0x01,
+    0x4d, 0x99, 0xd2, 0x3b, 0x56, 0x01, 0x4d, 0x91, 0xc7, 0x78, 0xa6, 0x01,
+    0x4d, 0x88, 0x43, 0x04, 0xf1, 0x42, 0x6a, 0x9a, 0x03, 0xc2, 0x6a, 0xa4,
+    0xcd, 0x79, 0x15, 0x0f, 0x98, 0x68, 0xa7, 0x09, 0x87, 0xe9, 0xa6, 0x09,
+    0x87, 0xe1, 0xa5, 0x09, 0x87, 0xd9, 0xa3, 0x09, 0x87, 0xcb, 0x02, 0x6a,
+    0xb0, 0xa2, 0x09, 0x87, 0xc1, 0xa1, 0x09, 0x87, 0xb9, 0xa0, 0x09, 0x87,
+    0xb1, 0x9f, 0x09, 0x87, 0xa8, 0xa8, 0x09, 0x87, 0xa1, 0xa7, 0x09, 0x87,
+    0x93, 0x02, 0x6a, 0xb4, 0xa6, 0x09, 0x87, 0x89, 0xa5, 0x09, 0x87, 0x81,
+    0xa4, 0x09, 0x87, 0x79, 0xa3, 0x09, 0x87, 0x71, 0xa2, 0x09, 0x87, 0x69,
+    0xa1, 0x09, 0x87, 0x61, 0xa0, 0x09, 0x87, 0x59, 0x9f, 0x09, 0x87, 0x4a,
+    0x02, 0x6a, 0xb8, 0xa8, 0x09, 0x87, 0x41, 0xa7, 0x09, 0x87, 0x39, 0xa6,
+    0x09, 0x87, 0x2b, 0x02, 0x6a, 0xbc, 0xa5, 0x09, 0x87, 0x1b, 0x02, 0x6a,
+    0xc0, 0xa4, 0x09, 0x87, 0x11, 0xa3, 0x09, 0x87, 0x09, 0xa2, 0x09, 0x87,
+    0x01, 0xa1, 0x09, 0x86, 0xf9, 0xa0, 0x09, 0x86, 0xf1, 0x9f, 0x09, 0x86,
+    0xe8, 0xa8, 0x09, 0x86, 0xdb, 0x02, 0x6a, 0xc4, 0xa7, 0x09, 0x86, 0xcb,
+    0x02, 0x6a, 0xc8, 0xa6, 0x09, 0x86, 0xc1, 0xa5, 0x09, 0x86, 0xb9, 0xa4,
+    0x09, 0x86, 0xb1, 0xa3, 0x09, 0x86, 0xa9, 0xa2, 0x09, 0x86, 0xa1, 0xa1,
+    0x09, 0x86, 0x99, 0xa0, 0x09, 0x86, 0x90, 0x83, 0x09, 0x82, 0xa8, 0xa0,
+    0x09, 0x94, 0xd1, 0x9f, 0x09, 0x94, 0xba, 0x02, 0x6a, 0xcc, 0xa8, 0x09,
+    0x94, 0xb1, 0xa7, 0x09, 0x94, 0xa9, 0xa6, 0x09, 0x94, 0xa1, 0xa5, 0x09,
+    0x94, 0x99, 0xa4, 0x09, 0x94, 0x91, 0xa3, 0x09, 0x94, 0x89, 0xa2, 0x09,
+    0x94, 0x81, 0xa1, 0x09, 0x94, 0x79, 0xa0, 0x09, 0x94, 0x71, 0x9f, 0x09,
+    0x94, 0x68, 0xa8, 0x09, 0x94, 0x61, 0xa7, 0x09, 0x94, 0x59, 0xa6, 0x09,
+    0x94, 0x51, 0xa5, 0x09, 0x94, 0x2b, 0x02, 0x6a, 0xd4, 0xa4, 0x09, 0x94,
+    0x21, 0xa3, 0x09, 0x94, 0x19, 0xa2, 0x09, 0x94, 0x0b, 0x02, 0x6a, 0xe4,
+    0xa1, 0x09, 0x94, 0x01, 0xa0, 0x09, 0x93, 0xf9, 0x9f, 0x09, 0x93, 0xea,
+    0x02, 0x6a, 0xe8, 0xa8, 0x09, 0x93, 0xdb, 0x02, 0x6a, 0xec, 0xa7, 0x09,
+    0x93, 0xd1, 0xa6, 0x09, 0x93, 0xc9, 0xa5, 0x09, 0x93, 0xc1, 0xa4, 0x09,
+    0x93, 0xb3, 0x02, 0x6a, 0xf0, 0xa3, 0x09, 0x93, 0xa3, 0x02, 0x6a, 0xf4,
+    0xa2, 0x09, 0x93, 0x99, 0xa1, 0x09, 0x93, 0x91, 0xa0, 0x09, 0x93, 0x89,
+    0x9f, 0x09, 0x93, 0x7a, 0x02, 0x6a, 0xf8, 0xa8, 0x09, 0x93, 0x6b, 0x02,
+    0x6a, 0xfc, 0xa7, 0x09, 0x93, 0x61, 0xa6, 0x09, 0x93, 0x59, 0xa5, 0x09,
+    0x93, 0x51, 0xa4, 0x09, 0x93, 0x49, 0xa3, 0x09, 0x93, 0x41, 0xa2, 0x09,
+    0x93, 0x39, 0xa1, 0x09, 0x93, 0x31, 0xa0, 0x09, 0x93, 0x29, 0x9f, 0x09,
+    0x93, 0x0a, 0x02, 0x6b, 0x00, 0xa8, 0x09, 0x93, 0x01, 0xa7, 0x09, 0x92,
+    0xf9, 0xa6, 0x09, 0x92, 0xf1, 0xa5, 0x09, 0x92, 0xbb, 0x02, 0x6b, 0x0c,
+    0xa4, 0x09, 0x92, 0xab, 0x02, 0x6b, 0x24, 0xa3, 0x09, 0x92, 0xa1, 0xa2,
+    0x09, 0x92, 0x99, 0xa1, 0x09, 0x92, 0x91, 0xa0, 0x09, 0x92, 0x82, 0x02,
+    0x6b, 0x28, 0xc3, 0x01, 0x44, 0x09, 0xa1, 0xa9, 0xc5, 0xda, 0xe4, 0x09,
+    0xa1, 0x98, 0xc3, 0x01, 0x44, 0x09, 0xa1, 0xa1, 0xc5, 0xda, 0xe4, 0x09,
+    0xa1, 0x90, 0xa4, 0x09, 0x8c, 0xd1, 0xa3, 0x09, 0x8c, 0xc9, 0xa2, 0x09,
+    0x8c, 0xc1, 0xa1, 0x09, 0x8c, 0xb9, 0xa0, 0x09, 0x8c, 0xab, 0x02, 0x6b,
+    0x2c, 0x9f, 0x09, 0x8c, 0x9a, 0x02, 0x6b, 0x30, 0xa8, 0x09, 0x8c, 0x8b,
+    0x02, 0x6b, 0x34, 0xa7, 0x09, 0x8c, 0x81, 0xa6, 0x09, 0x8c, 0x79, 0xa5,
+    0x09, 0x8c, 0x71, 0xa4, 0x09, 0x8c, 0x63, 0x02, 0x6b, 0x38, 0xa3, 0x09,
+    0x8c, 0x59, 0xa2, 0x09, 0x8c, 0x51, 0xa1, 0x09, 0x8c, 0x49, 0xa0, 0x09,
+    0x8c, 0x40, 0x83, 0x09, 0x8c, 0x28, 0x83, 0x09, 0x9d, 0x70, 0xa8, 0x09,
+    0x9d, 0x61, 0xa7, 0x09, 0x9d, 0x59, 0xa6, 0x09, 0x9d, 0x4b, 0x02, 0x6b,
+    0x3c, 0xa5, 0x09, 0x9d, 0x41, 0xa4, 0x09, 0x9d, 0x39, 0xa3, 0x09, 0x9d,
+    0x31, 0xa2, 0x09, 0x9d, 0x23, 0x02, 0x6b, 0x40, 0xa1, 0x09, 0x9d, 0x19,
+    0xa0, 0x09, 0x9d, 0x0b, 0x02, 0x6b, 0x44, 0x9f, 0x09, 0x9c, 0xfa, 0x02,
+    0x6b, 0x48, 0xa8, 0x09, 0x9c, 0xeb, 0x02, 0x6b, 0x4c, 0xa7, 0x09, 0x9c,
+    0xdb, 0x02, 0x6b, 0x50, 0xa6, 0x09, 0x9c, 0xd1, 0xa5, 0x09, 0x9c, 0xc9,
+    0xa4, 0x09, 0x9c, 0xc1, 0xa3, 0x09, 0x9c, 0xb9, 0xa2, 0x09, 0x9c, 0xab,
+    0x02, 0x6b, 0x54, 0xa1, 0x09, 0x9c, 0xa1, 0xa0, 0x09, 0x9c, 0x99, 0x9f,
+    0x09, 0x9c, 0x32, 0x02, 0x6b, 0x58, 0xa8, 0x09, 0x9c, 0x29, 0xa7, 0x09,
+    0x9c, 0x21, 0xa6, 0x09, 0x9c, 0x19, 0xa5, 0x09, 0x9c, 0x11, 0xa4, 0x09,
+    0x9c, 0x09, 0xa3, 0x09, 0x9c, 0x01, 0xa2, 0x09, 0x9b, 0xf9, 0xa1, 0x09,
+    0x9b, 0xe3, 0x02, 0x6b, 0x88, 0xa0, 0x09, 0x9b, 0xc3, 0x02, 0x6b, 0x90,
+    0x9f, 0x09, 0x9b, 0xb8, 0xa8, 0x09, 0x9b, 0xb1, 0xa7, 0x09, 0x9b, 0xa9,
+    0xa6, 0x09, 0x9b, 0x93, 0x02, 0x6b, 0x9c, 0xa5, 0x09, 0x9b, 0x89, 0xa4,
+    0x09, 0x9b, 0x81, 0xa3, 0x09, 0x9b, 0x79, 0xa2, 0x09, 0x9b, 0x71, 0xa1,
+    0x09, 0x9b, 0x63, 0x02, 0x6b, 0xa4, 0xa0, 0x09, 0x9b, 0x12, 0x02, 0x6b,
+    0xa8, 0xa1, 0x09, 0xa1, 0x71, 0xa0, 0x09, 0xa1, 0x69, 0x9f, 0x09, 0xa1,
+    0x60, 0xa8, 0x09, 0xa1, 0x59, 0xa7, 0x09, 0xa1, 0x51, 0xa6, 0x09, 0xa1,
+    0x49, 0xa5, 0x09, 0xa1, 0x41, 0xa4, 0x09, 0xa1, 0x39, 0xa3, 0x09, 0xa1,
+    0x31, 0xa2, 0x09, 0xa1, 0x29, 0xa1, 0x09, 0xa1, 0x21, 0xa0, 0x09, 0xa1,
+    0x19, 0x9f, 0x09, 0xa1, 0x10, 0xa8, 0x09, 0xa1, 0x09, 0xa7, 0x09, 0xa1,
+    0x01, 0xa6, 0x09, 0xa0, 0xf9, 0xa5, 0x09, 0xa0, 0xf1, 0xa4, 0x09, 0xa0,
+    0xe9, 0xa3, 0x09, 0xa0, 0xe1, 0xa2, 0x09, 0xa0, 0xd9, 0xa1, 0x09, 0xa0,
+    0xd1, 0xa0, 0x09, 0xa0, 0xc9, 0x9f, 0x09, 0xa0, 0xc0, 0xa8, 0x09, 0xa0,
+    0xb9, 0xa7, 0x09, 0xa0, 0xb1, 0xa6, 0x09, 0xa0, 0x9b, 0x02, 0x6b, 0xcc,
+    0xa5, 0x09, 0xa0, 0x91, 0xa4, 0x09, 0xa0, 0x89, 0xa3, 0x09, 0xa0, 0x81,
+    0xa2, 0x09, 0xa0, 0x79, 0xa1, 0x09, 0xa0, 0x71, 0xa0, 0x09, 0xa0, 0x68,
+    0xa8, 0x09, 0x82, 0x71, 0xa7, 0x09, 0x82, 0x69, 0xa6, 0x09, 0x82, 0x61,
+    0xa5, 0x09, 0x82, 0x59, 0xa4, 0x09, 0x82, 0x51, 0xa3, 0x09, 0x82, 0x49,
+    0xa2, 0x09, 0x82, 0x41, 0xa1, 0x09, 0x82, 0x39, 0xa0, 0x09, 0x82, 0x31,
+    0x9f, 0x09, 0x82, 0x28, 0xa8, 0x09, 0x82, 0x21, 0xa7, 0x09, 0x82, 0x19,
+    0xa6, 0x09, 0x82, 0x11, 0xa5, 0x09, 0x82, 0x09, 0xa4, 0x09, 0x82, 0x01,
+    0xa3, 0x09, 0x81, 0xf9, 0xa2, 0x09, 0x81, 0xf1, 0xa1, 0x09, 0x81, 0xe9,
+    0xa0, 0x09, 0x81, 0xe1, 0x9f, 0x09, 0x81, 0xd8, 0xa8, 0x09, 0x81, 0xd1,
+    0xa7, 0x09, 0x81, 0xc9, 0xa6, 0x09, 0x81, 0xc1, 0xa5, 0x09, 0x81, 0xb9,
+    0xa4, 0x09, 0x81, 0xab, 0x02, 0x6b, 0xd4, 0xa3, 0x09, 0x81, 0xa1, 0xa2,
+    0x09, 0x81, 0x93, 0x02, 0x6b, 0xd8, 0xa1, 0x09, 0x81, 0x83, 0x02, 0x6b,
+    0xdc, 0xa0, 0x09, 0x81, 0x79, 0x9f, 0x09, 0x81, 0x6a, 0x02, 0x6b, 0xe0,
+    0xa8, 0x09, 0x81, 0x61, 0xa7, 0x09, 0x81, 0x59, 0xa6, 0x09, 0x81, 0x51,
+    0xa5, 0x09, 0x81, 0x49, 0xa4, 0x09, 0x81, 0x41, 0xa3, 0x09, 0x81, 0x39,
+    0xa2, 0x09, 0x81, 0x31, 0xa1, 0x09, 0x81, 0x23, 0x02, 0x6b, 0xe4, 0xa0,
+    0x09, 0x81, 0x19, 0x9f, 0x09, 0x81, 0x10, 0xa8, 0x09, 0x81, 0x09, 0xa7,
+    0x09, 0x81, 0x01, 0xa6, 0x09, 0x80, 0xf9, 0xa5, 0x09, 0x80, 0xf1, 0xa4,
+    0x09, 0x80, 0xe9, 0xa3, 0x09, 0x80, 0xe1, 0xa2, 0x09, 0x80, 0xd9, 0xa1,
+    0x09, 0x80, 0xd1, 0xa0, 0x09, 0x80, 0xc9, 0x9f, 0x09, 0x80, 0xc0, 0xa8,
+    0x09, 0x80, 0xb9, 0xa7, 0x09, 0x80, 0xb1, 0xa6, 0x09, 0x80, 0xa3, 0x02,
+    0x6b, 0xe8, 0xa5, 0x09, 0x80, 0x99, 0xa4, 0x09, 0x80, 0x91, 0xa3, 0x09,
+    0x80, 0x83, 0x02, 0x6b, 0xec, 0xa2, 0x09, 0x80, 0x79, 0xa1, 0x09, 0x80,
+    0x71, 0xa0, 0x09, 0x80, 0x69, 0x9f, 0x09, 0x80, 0x60, 0xa8, 0x09, 0x80,
+    0x59, 0xa7, 0x09, 0x80, 0x51, 0xa6, 0x09, 0x80, 0x49, 0xa5, 0x09, 0x80,
+    0x33, 0x02, 0x6b, 0xf0, 0xa4, 0x09, 0x80, 0x23, 0x02, 0x6b, 0xf8, 0xa3,
+    0x09, 0x80, 0x19, 0xa2, 0x09, 0x80, 0x11, 0xa1, 0x09, 0x80, 0x09, 0xa0,
+    0x09, 0x80, 0x00, 0x8a, 0x09, 0xa0, 0x61, 0x89, 0x09, 0xa0, 0x59, 0x88,
+    0x09, 0xa0, 0x51, 0x87, 0x09, 0xa0, 0x49, 0x86, 0x09, 0xa0, 0x41, 0x85,
+    0x09, 0xa0, 0x39, 0x84, 0x09, 0xa0, 0x31, 0x83, 0x09, 0xa0, 0x28, 0x8b,
+    0x09, 0xa0, 0x19, 0x8a, 0x09, 0xa0, 0x11, 0x89, 0x09, 0xa0, 0x09, 0x88,
+    0x09, 0xa0, 0x01, 0x87, 0x09, 0x9f, 0xf9, 0x86, 0x09, 0x9f, 0xf1, 0x85,
+    0x09, 0x9f, 0xe9, 0x84, 0x09, 0x9f, 0xe1, 0x83, 0x09, 0x9f, 0xd8, 0x83,
+    0x09, 0x9f, 0x80, 0x83, 0x09, 0x9f, 0x70, 0x84, 0x09, 0x9f, 0x61, 0x83,
+    0x09, 0x9f, 0x58, 0x86, 0x09, 0x9f, 0x49, 0x85, 0x09, 0x9f, 0x41, 0x84,
+    0x09, 0x9f, 0x39, 0x83, 0x09, 0x9f, 0x30, 0x83, 0x09, 0x9e, 0x68, 0x83,
+    0x09, 0x9e, 0x30, 0x83, 0x09, 0x9e, 0x20, 0x83, 0x09, 0x9e, 0x00, 0x83,
+    0x09, 0x9d, 0xd8, 0x83, 0x09, 0x9d, 0xc8, 0x83, 0x09, 0x9d, 0x90, 0x83,
+    0x09, 0x9a, 0xb8, 0x83, 0x09, 0x9a, 0x98, 0x83, 0x09, 0x9a, 0x60, 0x84,
+    0x09, 0x99, 0xd1, 0x83, 0x09, 0x99, 0xc8, 0x83, 0x09, 0x99, 0x78, 0x83,
+    0x09, 0x99, 0x68, 0x83, 0x09, 0x98, 0xe0, 0x83, 0x09, 0x98, 0xb0, 0x83,
+    0x09, 0x98, 0x98, 0x83, 0x09, 0x98, 0x88, 0x83, 0x09, 0x98, 0x78, 0x83,
+    0x09, 0x98, 0x50, 0x83, 0x09, 0x97, 0xd8, 0x84, 0x09, 0x97, 0x89, 0x83,
+    0x09, 0x97, 0x80, 0x83, 0x09, 0x97, 0x30, 0x84, 0x09, 0x97, 0x11, 0x83,
+    0x09, 0x97, 0x08, 0x83, 0x09, 0x96, 0xc0, 0x83, 0x09, 0x96, 0x98, 0x83,
+    0x09, 0x96, 0x18, 0x83, 0x09, 0x95, 0xe0, 0x84, 0x09, 0x95, 0xa1, 0x83,
+    0x09, 0x95, 0x98, 0x83, 0x09, 0x95, 0x88, 0x83, 0x09, 0x94, 0xf8, 0x83,
+    0x09, 0x94, 0xe0, 0xa1, 0x09, 0x92, 0x73, 0x02, 0x6b, 0xfc, 0xa0, 0x09,
+    0x92, 0x69, 0x9f, 0x09, 0x92, 0x60, 0xa8, 0x09, 0x92, 0x59, 0xa7, 0x09,
+    0x92, 0x4b, 0x02, 0x6c, 0x00, 0xa6, 0x09, 0x92, 0x41, 0xa5, 0x09, 0x92,
+    0x39, 0xa4, 0x09, 0x92, 0x31, 0xa3, 0x09, 0x92, 0x29, 0xa2, 0x09, 0x92,
+    0x21, 0xa1, 0x09, 0x92, 0x19, 0xa0, 0x09, 0x92, 0x0b, 0x02, 0x6c, 0x04,
+    0x9f, 0x09, 0x91, 0xfa, 0x02, 0x6c, 0x08, 0xa8, 0x09, 0x91, 0xf1, 0xa7,
+    0x09, 0x91, 0xe9, 0xa6, 0x09, 0x91, 0xe1, 0xa5, 0x09, 0x91, 0xd9, 0xa4,
+    0x09, 0x91, 0xd1, 0xa3, 0x09, 0x91, 0xc9, 0xa2, 0x09, 0x91, 0xc1, 0xa1,
+    0x09, 0x91, 0xb9, 0xa0, 0x09, 0x91, 0xb0, 0xa8, 0x09, 0x91, 0xa1, 0xa7,
+    0x09, 0x91, 0x99, 0xa6, 0x09, 0x91, 0x8b, 0x02, 0x6c, 0x0c, 0xa5, 0x09,
+    0x91, 0x81, 0xa4, 0x09, 0x91, 0x79, 0xa3, 0x09, 0x91, 0x71, 0xa2, 0x09,
+    0x91, 0x69, 0xa1, 0x09, 0x91, 0x61, 0xa0, 0x09, 0x91, 0x59, 0x9f, 0x09,
+    0x91, 0x50, 0xa8, 0x09, 0x91, 0x49, 0xa7, 0x09, 0x91, 0x41, 0xa6, 0x09,
+    0x91, 0x39, 0xa5, 0x09, 0x91, 0x31, 0xa4, 0x09, 0x91, 0x23, 0x02, 0x6c,
+    0x10, 0xa3, 0x09, 0x91, 0x19, 0xa2, 0x09, 0x91, 0x11, 0xa1, 0x09, 0x91,
+    0x09, 0xa0, 0x09, 0x91, 0x00, 0xa1, 0x09, 0x90, 0xf9, 0xa0, 0x09, 0x90,
+    0xf1, 0x9f, 0x09, 0x90, 0xe8, 0xa8, 0x09, 0x90, 0xe1, 0xa7, 0x09, 0x90,
+    0xd9, 0xa6, 0x09, 0x90, 0xcb, 0x02, 0x6c, 0x14, 0xa5, 0x09, 0x90, 0xc1,
+    0xa4, 0x09, 0x90, 0xb3, 0x02, 0x6c, 0x18, 0xa3, 0x09, 0x90, 0xa3, 0x02,
+    0x6c, 0x1c, 0xa2, 0x09, 0x90, 0x93, 0x02, 0x6c, 0x20, 0xa1, 0x09, 0x90,
+    0x89, 0xa0, 0x09, 0x90, 0x81, 0x9f, 0x09, 0x90, 0x78, 0xa8, 0x09, 0x90,
+    0x71, 0xa7, 0x09, 0x90, 0x69, 0xa6, 0x09, 0x90, 0x61, 0xa5, 0x09, 0x90,
+    0x59, 0xa4, 0x09, 0x90, 0x4b, 0x02, 0x6c, 0x24, 0xa3, 0x09, 0x90, 0x41,
+    0xa2, 0x09, 0x90, 0x39, 0xa1, 0x09, 0x90, 0x31, 0xa0, 0x09, 0x90, 0x29,
+    0x9f, 0x09, 0x90, 0x20, 0xa8, 0x09, 0x90, 0x19, 0xa7, 0x09, 0x90, 0x03,
+    0x02, 0x6c, 0x28, 0xa6, 0x09, 0x8f, 0xf9, 0xa5, 0x09, 0x8f, 0xf1, 0xa4,
+    0x09, 0x8f, 0xe9, 0xa3, 0x09, 0x8f, 0xe1, 0xa2, 0x09, 0x8f, 0xd9, 0xa1,
+    0x09, 0x8f, 0xd1, 0xa0, 0x09, 0x8f, 0xc9, 0x9f, 0x09, 0x8f, 0xc0, 0xa8,
+    0x09, 0x8f, 0xb9, 0xa7, 0x09, 0x8f, 0xb1, 0xa6, 0x09, 0x8f, 0xa9, 0xa5,
+    0x09, 0x8f, 0xa1, 0xa4, 0x09, 0x8f, 0x99, 0xa3, 0x09, 0x8f, 0x91, 0xa2,
+    0x09, 0x8f, 0x89, 0xa1, 0x09, 0x8f, 0x81, 0xa0, 0x09, 0x8f, 0x78, 0x83,
+    0x09, 0x8f, 0x50, 0x84, 0x09, 0x8f, 0x11, 0x83, 0x09, 0x8f, 0x08, 0x83,
+    0x09, 0x8e, 0xf0, 0x83, 0x09, 0x8e, 0xd0, 0x83, 0x09, 0x8e, 0xa8, 0x83,
+    0x09, 0x8e, 0x90, 0x83, 0x09, 0x8e, 0x60, 0x83, 0x09, 0x8e, 0x50, 0x83,
+    0x09, 0x8e, 0x40, 0x8a, 0x09, 0x8e, 0x21, 0x89, 0x09, 0x8e, 0x19, 0x88,
+    0x09, 0x8e, 0x11, 0x87, 0x09, 0x8e, 0x09, 0x86, 0x09, 0x8e, 0x01, 0x85,
+    0x09, 0x8d, 0xf9, 0x84, 0x09, 0x8d, 0xf1, 0x83, 0x09, 0x8d, 0xe8, 0x83,
+    0x09, 0x8d, 0xd0, 0x83, 0x09, 0x8d, 0x90, 0x84, 0x09, 0x8d, 0x79, 0x83,
+    0x09, 0x8d, 0x70, 0x83, 0x09, 0x8b, 0xa8, 0x83, 0x09, 0x8b, 0x90, 0x83,
+    0x09, 0x8b, 0x58, 0x83, 0x09, 0x8b, 0x48, 0x83, 0x09, 0x8a, 0xf0, 0x83,
+    0x09, 0x8a, 0xb8, 0x83, 0x09, 0x8a, 0x68, 0x84, 0x09, 0x8a, 0x41, 0x83,
+    0x09, 0x8a, 0x38, 0x83, 0x09, 0x8a, 0x28, 0x85, 0x09, 0x89, 0xe1, 0x84,
+    0x09, 0x89, 0xd9, 0x83, 0x09, 0x89, 0xd0, 0x83, 0x09, 0x89, 0xa8, 0x83,
+    0x09, 0x89, 0x98, 0x83, 0x09, 0x89, 0x88, 0x83, 0x09, 0x89, 0x48, 0x83,
+    0x09, 0x89, 0x38, 0x83, 0x09, 0x89, 0x00, 0x83, 0x09, 0x88, 0xa8, 0x83,
+    0x09, 0x88, 0x60, 0x83, 0x09, 0x87, 0xf8, 0x8a, 0x09, 0x86, 0x89, 0x89,
+    0x09, 0x86, 0x81, 0x88, 0x09, 0x86, 0x79, 0x87, 0x09, 0x86, 0x71, 0x86,
+    0x09, 0x86, 0x69, 0x85, 0x09, 0x86, 0x61, 0x84, 0x09, 0x86, 0x59, 0x83,
+    0x09, 0x86, 0x50, 0x83, 0x09, 0x85, 0xe0, 0x83, 0x09, 0x85, 0xc8, 0x8b,
+    0x09, 0x85, 0xb1, 0x8a, 0x09, 0x85, 0xa9, 0x89, 0x09, 0x85, 0xa1, 0x88,
+    0x09, 0x85, 0x99, 0x87, 0x09, 0x85, 0x91, 0x86, 0x09, 0x85, 0x89, 0x85,
+    0x09, 0x85, 0x81, 0x84, 0x09, 0x85, 0x79, 0x83, 0x09, 0x85, 0x70, 0x83,
+    0x09, 0x85, 0x58, 0x83, 0x09, 0x85, 0x40, 0x83, 0x09, 0x84, 0xd8, 0x83,
+    0x09, 0x84, 0xb8, 0x83, 0x09, 0x84, 0x90, 0x83, 0x09, 0x83, 0xf0, 0x83,
+    0x09, 0x83, 0x38, 0x85, 0x09, 0x82, 0xf1, 0x84, 0x09, 0x82, 0xe9, 0x83,
+    0x09, 0x82, 0xe0, 0xc6, 0x00, 0x7c, 0x0f, 0xbc, 0x49, 0xc6, 0x09, 0x2b,
+    0x0f, 0xbc, 0x98, 0xc6, 0x13, 0x38, 0x0f, 0xbd, 0x71, 0xd2, 0x4c, 0xa5,
+    0x0f, 0xbd, 0xd0, 0x45, 0x53, 0xac, 0x42, 0x6c, 0x30, 0x83, 0x00, 0x95,
+    0x03, 0x02, 0x6c, 0x60, 0x97, 0x00, 0x95, 0x09, 0x8b, 0x00, 0x95, 0x11,
+    0x87, 0x00, 0x95, 0x2b, 0x02, 0x6c, 0x64, 0x91, 0x00, 0x95, 0x33, 0x02,
+    0x6c, 0x68, 0xc2, 0x00, 0x71, 0x00, 0x95, 0x38, 0x83, 0x00, 0x98, 0x58,
+    0x87, 0x00, 0x98, 0x60, 0x83, 0x00, 0x98, 0x78, 0x83, 0x00, 0x98, 0x83,
+    0x02, 0x6c, 0x6c, 0x8b, 0x00, 0x98, 0x91, 0x87, 0x00, 0x98, 0xaa, 0x02,
+    0x6c, 0x70, 0x83, 0x00, 0x98, 0xc3, 0x02, 0x6c, 0x74, 0x97, 0x00, 0x98,
+    0xc9, 0x8b, 0x00, 0x98, 0xd1, 0x87, 0x00, 0x98, 0xeb, 0x02, 0x6c, 0x78,
+    0x91, 0x00, 0x98, 0xf1, 0x19, 0x42, 0x6c, 0x7c, 0x83, 0x01, 0x6e, 0xc3,
+    0x02, 0x6c, 0x8e, 0x97, 0x01, 0x6e, 0xc9, 0x8b, 0x01, 0x6e, 0xd1, 0x87,
+    0x01, 0x6e, 0xeb, 0x02, 0x6c, 0x92, 0x91, 0x01, 0x6e, 0xf0, 0x19, 0xc2,
+    0x6c, 0x96, 0x1b, 0xc2, 0x6c, 0xa5, 0x83, 0x00, 0x90, 0x83, 0x02, 0x6c,
+    0xbf, 0x97, 0x00, 0x90, 0x89, 0x8b, 0x00, 0x90, 0x91, 0x87, 0x00, 0x90,
+    0xab, 0x02, 0x6c, 0xc3, 0x91, 0x00, 0x90, 0xb0, 0x83, 0x00, 0x90, 0x18,
+    0x87, 0x00, 0x90, 0x20, 0x83, 0x00, 0x90, 0x38, 0x91, 0x05, 0x59, 0x71,
+    0x87, 0x05, 0x59, 0x6b, 0x02, 0x6c, 0xc7, 0x83, 0x05, 0x59, 0x43, 0x02,
+    0x6c, 0xcb, 0x8b, 0x05, 0x59, 0x51, 0x97, 0x05, 0x59, 0x48, 0x83, 0x00,
+    0x93, 0x18, 0x87, 0x00, 0x93, 0x20, 0x83, 0x01, 0x6c, 0x28, 0x83, 0x00,
+    0x93, 0x39, 0x8b, 0x00, 0x9c, 0x29, 0x87, 0x00, 0x9c, 0x3a, 0x02, 0x6c,
+    0xcf, 0x0a, 0xc2, 0x6c, 0xd3, 0x83, 0x01, 0x6d, 0x43, 0x02, 0x6c, 0xf1,
+    0x97, 0x01, 0x6d, 0x49, 0x8b, 0x01, 0x6d, 0x51, 0x87, 0x01, 0x6d, 0x6b,
+    0x02, 0x6c, 0xf5, 0x91, 0x01, 0x6d, 0x70, 0x83, 0x00, 0x93, 0xd8, 0x87,
+    0x00, 0x93, 0xe0, 0x83, 0x01, 0x6c, 0x38, 0x83, 0x00, 0x99, 0x43, 0x02,
+    0x6c, 0xf9, 0x97, 0x00, 0x99, 0x49, 0x8b, 0x00, 0x99, 0x51, 0x87, 0x00,
+    0x99, 0x6b, 0x02, 0x6c, 0xfd, 0x91, 0x00, 0x99, 0x73, 0x02, 0x6d, 0x01,
+    0xc2, 0x00, 0x71, 0x00, 0x99, 0x78, 0x91, 0x05, 0x58, 0xb1, 0x87, 0x05,
+    0x58, 0xab, 0x02, 0x6d, 0x05, 0xc2, 0x12, 0x99, 0x05, 0x58, 0x99, 0x8b,
+    0x05, 0x58, 0x91, 0x97, 0x05, 0x58, 0x88, 0x0a, 0xc2, 0x6d, 0x09, 0x83,
+    0x00, 0x97, 0xc3, 0x02, 0x6d, 0x22, 0x97, 0x00, 0x97, 0xc9, 0x8b, 0x00,
+    0x97, 0xd1, 0x87, 0x00, 0x97, 0xeb, 0x02, 0x6d, 0x26, 0x91, 0x00, 0x97,
+    0xf3, 0x02, 0x6d, 0x2a, 0xc2, 0x00, 0x71, 0x00, 0x97, 0xf8, 0x83, 0x00,
+    0x97, 0x98, 0x87, 0x00, 0x97, 0xa0, 0x83, 0x01, 0x6c, 0x60, 0x91, 0x05,
+    0x58, 0x31, 0x87, 0x05, 0x58, 0x2b, 0x02, 0x6d, 0x2e, 0xc2, 0x12, 0x99,
+    0x05, 0x58, 0x19, 0x8b, 0x05, 0x58, 0x11, 0x97, 0x05, 0x58, 0x08, 0x83,
+    0x00, 0x93, 0x98, 0x87, 0x00, 0x93, 0xa0, 0x83, 0x01, 0x6c, 0x30, 0x83,
+    0x00, 0x99, 0x03, 0x02, 0x6d, 0x32, 0x97, 0x00, 0x99, 0x09, 0x8b, 0x00,
+    0x99, 0x11, 0x87, 0x00, 0x99, 0x2b, 0x02, 0x6d, 0x36, 0x91, 0x00, 0x99,
+    0x33, 0x02, 0x6d, 0x3a, 0xc2, 0x00, 0x71, 0x00, 0x99, 0x38, 0x83, 0x00,
+    0x99, 0xc3, 0x02, 0x6d, 0x3e, 0x97, 0x00, 0x99, 0xc9, 0x8b, 0x00, 0x99,
+    0xd1, 0x87, 0x00, 0x99, 0xeb, 0x02, 0x6d, 0x42, 0x91, 0x00, 0x99, 0xf1,
+    0xc2, 0x00, 0x71, 0x00, 0x99, 0xf8, 0x83, 0x00, 0x9a, 0x03, 0x02, 0x6d,
+    0x46, 0x97, 0x00, 0x9a, 0x09, 0x8b, 0x00, 0x9a, 0x11, 0x87, 0x00, 0x9a,
+    0x2b, 0x02, 0x6d, 0x4a, 0x91, 0x00, 0x9a, 0x32, 0x02, 0x6d, 0x4e, 0x83,
+    0x00, 0x90, 0x58, 0x87, 0x00, 0x90, 0x60, 0x83, 0x01, 0x6c, 0x00, 0x83,
+    0x00, 0x90, 0xd8, 0x87, 0x00, 0x90, 0xe0, 0x83, 0x01, 0x6c, 0x08, 0x83,
+    0x00, 0x90, 0xf9, 0x8b, 0x00, 0x9c, 0x09, 0x87, 0x00, 0x9c, 0x1a, 0x02,
+    0x6d, 0x52, 0x83, 0x00, 0x91, 0x03, 0x02, 0x6d, 0x56, 0x97, 0x00, 0x91,
+    0x09, 0x8b, 0x00, 0x91, 0x11, 0x87, 0x00, 0x91, 0x2b, 0x02, 0x6d, 0x5a,
+    0x91, 0x00, 0x91, 0x31, 0xc2, 0x00, 0x71, 0x00, 0x91, 0x38, 0x83, 0x00,
+    0x91, 0x98, 0x87, 0x00, 0x91, 0xa1, 0x48, 0xbe, 0x48, 0x42, 0x6d, 0x5e,
+    0x83, 0x01, 0x6c, 0x18, 0x83, 0x00, 0x91, 0xc3, 0x02, 0x6d, 0x76, 0x97,
+    0x00, 0x91, 0xc9, 0x8b, 0x00, 0x91, 0xd1, 0x87, 0x00, 0x91, 0xeb, 0x02,
+    0x6d, 0x7a, 0x91, 0x00, 0x91, 0xf3, 0x02, 0x6d, 0x7e, 0xc2, 0x00, 0x71,
+    0x00, 0x91, 0xf8, 0x83, 0x01, 0x6d, 0x03, 0x02, 0x6d, 0x82, 0x97, 0x01,
+    0x6d, 0x09, 0x8b, 0x01, 0x6d, 0x11, 0x87, 0x01, 0x6d, 0x2b, 0x02, 0x6d,
+    0x86, 0x91, 0x01, 0x6d, 0x30, 0x83, 0x00, 0x91, 0x58, 0x87, 0x00, 0x91,
+    0x60, 0x83, 0x01, 0x6c, 0x10, 0x83, 0x00, 0x92, 0x18, 0x87, 0x00, 0x92,
+    0x20, 0x83, 0x00, 0x92, 0x38, 0x83, 0x00, 0x92, 0x43, 0x02, 0x6d, 0x8a,
+    0x8b, 0x00, 0x92, 0x51, 0x87, 0x00, 0x92, 0x6a, 0x02, 0x6d, 0x8e, 0x83,
+    0x00, 0x92, 0x83, 0x02, 0x6d, 0x92, 0x97, 0x00, 0x92, 0x89, 0x8b, 0x00,
+    0x92, 0x91, 0x87, 0x00, 0x92, 0xab, 0x02, 0x6d, 0x96, 0x91, 0x00, 0x92,
+    0xb1, 0x19, 0x42, 0x6d, 0x9a, 0x83, 0x01, 0x6e, 0x03, 0x02, 0x6d, 0xac,
+    0x97, 0x01, 0x6e, 0x09, 0x8b, 0x01, 0x6e, 0x11, 0x87, 0x01, 0x6e, 0x2b,
+    0x02, 0x6d, 0xb0, 0x91, 0x01, 0x6e, 0x30, 0x83, 0x00, 0x93, 0x58, 0x87,
+    0x00, 0x93, 0x60, 0x83, 0x00, 0x94, 0x18, 0x87, 0x00, 0x94, 0x20, 0x83,
+    0x00, 0x94, 0x38, 0x83, 0x00, 0x94, 0x43, 0x02, 0x6d, 0xb4, 0x8b, 0x00,
+    0x94, 0x51, 0x87, 0x00, 0x94, 0x6a, 0x02, 0x6d, 0xb8, 0x83, 0x01, 0x6e,
+    0x83, 0x02, 0x6d, 0xbc, 0x97, 0x01, 0x6e, 0x89, 0x8b, 0x01, 0x6e, 0x91,
+    0x87, 0x01, 0x6e, 0xab, 0x02, 0x6d, 0xc0, 0x91, 0x01, 0x6e, 0xb0, 0x83,
+    0x00, 0x94, 0x98, 0x87, 0x00, 0x94, 0xa0, 0x83, 0x01, 0x6c, 0x40, 0x83,
+    0x00, 0x94, 0xc3, 0x02, 0x6d, 0xc4, 0x97, 0x00, 0x94, 0xc9, 0x8b, 0x00,
+    0x94, 0xd1, 0x87, 0x00, 0x94, 0xeb, 0x02, 0x6d, 0xc8, 0x91, 0x00, 0x94,
+    0xf3, 0x02, 0x6d, 0xcc, 0xc2, 0x00, 0x71, 0x00, 0x94, 0xf8, 0x83, 0x00,
+    0x95, 0x58, 0x87, 0x00, 0x95, 0x60, 0x83, 0x00, 0x95, 0x78, 0x83, 0x00,
+    0x95, 0x83, 0x02, 0x6d, 0xd0, 0x8b, 0x00, 0x95, 0x91, 0x87, 0x00, 0x95,
+    0xaa, 0x02, 0x6d, 0xd4, 0x83, 0x00, 0x95, 0xc3, 0x02, 0x6d, 0xd8, 0x97,
+    0x00, 0x95, 0xc9, 0x8b, 0x00, 0x95, 0xd1, 0x87, 0x00, 0x95, 0xeb, 0x02,
+    0x6d, 0xdc, 0x91, 0x00, 0x95, 0xf1, 0x19, 0x42, 0x6d, 0xe0, 0x83, 0x01,
+    0x6e, 0x43, 0x02, 0x6d, 0xf2, 0x97, 0x01, 0x6e, 0x49, 0x8b, 0x01, 0x6e,
+    0x51, 0x87, 0x01, 0x6e, 0x6b, 0x02, 0x6d, 0xf6, 0x91, 0x01, 0x6e, 0x70,
+    0x83, 0x00, 0x96, 0x58, 0x87, 0x00, 0x96, 0x60, 0x83, 0x00, 0x96, 0x78,
+    0x83, 0x00, 0x99, 0x83, 0x02, 0x6d, 0xfa, 0x97, 0x00, 0x99, 0x89, 0x8b,
+    0x00, 0x99, 0x91, 0x87, 0x00, 0x99, 0xab, 0x02, 0x6e, 0x04, 0x91, 0x00,
+    0x99, 0xb3, 0x02, 0x6e, 0x08, 0xc2, 0x00, 0x71, 0x00, 0x99, 0xb8, 0x83,
+    0x00, 0x9a, 0x98, 0x87, 0x00, 0x9a, 0xa0, 0x83, 0x01, 0x6c, 0x90, 0x83,
+    0x00, 0x9a, 0xb9, 0x8b, 0x00, 0x9c, 0x69, 0x87, 0x00, 0x9c, 0x7a, 0x02,
+    0x6e, 0x0c, 0x83, 0x00, 0x96, 0xd8, 0x87, 0x00, 0x96, 0xe0, 0x83, 0x01,
+    0x6c, 0x58, 0x83, 0x00, 0x97, 0x03, 0x02, 0x6e, 0x10, 0x97, 0x00, 0x97,
+    0x09, 0x8b, 0x00, 0x97, 0x11, 0x87, 0x00, 0x97, 0x2b, 0x02, 0x6e, 0x14,
+    0x91, 0x00, 0x97, 0x31, 0xc2, 0x00, 0x71, 0x00, 0x97, 0x38, 0x83, 0x01,
+    0x6d, 0x83, 0x02, 0x6e, 0x18, 0x97, 0x01, 0x6d, 0x89, 0x8b, 0x01, 0x6d,
+    0x91, 0x87, 0x01, 0x6d, 0xab, 0x02, 0x6e, 0x1c, 0x91, 0x01, 0x6d, 0xb0,
+    0x83, 0x00, 0x97, 0x58, 0x87, 0x00, 0x97, 0x60, 0x83, 0x00, 0x97, 0x78,
+    0x83, 0x00, 0x98, 0x18, 0x87, 0x00, 0x98, 0x20, 0x83, 0x01, 0x6c, 0x70,
+    0x83, 0x00, 0x9a, 0x58, 0x87, 0x00, 0x9a, 0x60, 0x83, 0x00, 0x9a, 0x79,
+    0x8b, 0x00, 0x9c, 0x49, 0x87, 0x00, 0x9c, 0x5a, 0x02, 0x6e, 0x20, 0xd5,
+    0x35, 0x62, 0x00, 0x9a, 0xe9, 0xc4, 0x01, 0x65, 0x00, 0x9a, 0xf8, 0xc7,
+    0x00, 0x6f, 0x01, 0x3e, 0x91, 0xc9, 0x05, 0xca, 0x01, 0x56, 0xc8, 0xd6,
+    0x2e, 0xda, 0x01, 0x17, 0xc9, 0xc8, 0x50, 0x50, 0x01, 0x17, 0xc1, 0xc7,
+    0x78, 0xa6, 0x01, 0x17, 0xb1, 0xc9, 0x18, 0x17, 0x01, 0x17, 0xa9, 0x48,
+    0x03, 0xc1, 0xc2, 0x6e, 0x24, 0xd6, 0x2b, 0x80, 0x01, 0x17, 0x90, 0xc3,
+    0x17, 0x62, 0x08, 0x7f, 0x89, 0xc4, 0xd9, 0x0f, 0x08, 0x7f, 0x70, 0xc6,
+    0x06, 0x83, 0x00, 0x00, 0xb8, 0xc8, 0xbd, 0xd0, 0x01, 0x16, 0xf9, 0xc8,
+    0xbe, 0x38, 0x01, 0x16, 0xf1, 0xcc, 0x06, 0x09, 0x01, 0x16, 0xe9, 0xc9,
+    0x02, 0xa0, 0x01, 0x16, 0xe0, 0x03, 0xc2, 0x6e, 0x2a, 0x45, 0x00, 0x92,
+    0x42, 0x6e, 0x39, 0x97, 0x08, 0xec, 0xa1, 0x8b, 0x08, 0xec, 0x89, 0x83,
+    0x08, 0xec, 0x50, 0x97, 0x08, 0xec, 0x70, 0x8b, 0x08, 0xec, 0x60, 0xc2,
+    0x00, 0xce, 0x08, 0xec, 0x19, 0x83, 0x08, 0xec, 0x10, 0xc2, 0x00, 0xce,
+    0x08, 0xeb, 0xf1, 0x83, 0x08, 0xeb, 0xe8, 0x83, 0x00, 0x50, 0xb1, 0xc2,
+    0x00, 0xce, 0x00, 0x52, 0xc8, 0x83, 0x00, 0x50, 0xc1, 0xc2, 0x00, 0xce,
+    0x00, 0x52, 0xd0, 0x83, 0x00, 0x50, 0xf9, 0xc2, 0x00, 0xce, 0x00, 0x51,
+    0x00, 0x83, 0x00, 0x51, 0x09, 0xc2, 0x00, 0xce, 0x00, 0x51, 0x10, 0x94,
+    0x00, 0x54, 0x5b, 0x02, 0x6e, 0x4f, 0x8e, 0x00, 0x54, 0x62, 0x02, 0x6e,
+    0x53, 0x83, 0x00, 0x54, 0xf9, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x00, 0x83,
+    0x00, 0x55, 0x09, 0xc2, 0x00, 0xce, 0x00, 0x55, 0x10, 0x83, 0x00, 0x55,
+    0xf1, 0x8b, 0x00, 0x56, 0x41, 0x97, 0x00, 0x56, 0x60, 0x8b, 0x00, 0x56,
+    0x00, 0x97, 0x00, 0x56, 0x10, 0x94, 0x00, 0x56, 0x1b, 0x02, 0x6e, 0x57,
+    0x8e, 0x00, 0x57, 0x12, 0x02, 0x6e, 0x5b, 0x87, 0x00, 0x56, 0x29, 0x91,
+    0x00, 0x56, 0x48, 0xcd, 0x7c, 0xd7, 0x0e, 0x92, 0x29, 0xcc, 0x80, 0xdc,
+    0x08, 0x0c, 0x08, 0x5b, 0x16, 0x8b, 0xc2, 0x6e, 0x5f, 0xcc, 0x83, 0x40,
+    0x08, 0x0c, 0x68, 0x55, 0x37, 0x30, 0xc2, 0x6e, 0x87, 0xc4, 0x2a, 0x72,
+    0x00, 0xff, 0x78, 0xc4, 0x5d, 0x33, 0x00, 0xff, 0xf3, 0x02, 0x6e, 0xb4,
+    0x49, 0x62, 0x5b, 0xc2, 0x6e, 0xba, 0xcb, 0x94, 0x08, 0x08, 0x0b, 0xd8,
+    0xc3, 0x45, 0xb0, 0x00, 0xff, 0xe9, 0x43, 0x00, 0xe1, 0xc2, 0x6e, 0xc6,
+    0xc8, 0xbb, 0x88, 0x08, 0x0b, 0xe1, 0xca, 0x9a, 0x8e, 0x08, 0x0c, 0x20,
+    0x0e, 0xc2, 0x6e, 0xd5, 0xca, 0xa2, 0x0e, 0x00, 0x1e, 0x79, 0xcc, 0x8a,
+    0x90, 0x00, 0x1f, 0xa1, 0x49, 0x10, 0xab, 0xc2, 0x6e, 0xe1, 0xda, 0x1d,
+    0x3e, 0x00, 0x1f, 0xf0, 0x45, 0x00, 0xb6, 0xc2, 0x6e, 0xed, 0x56, 0x2f,
+    0x48, 0xc2, 0x6e, 0xff, 0xcc, 0x85, 0x80, 0x08, 0x0c, 0x61, 0xcd, 0x7f,
+    0x61, 0x08, 0x0d, 0x00, 0xc4, 0x7c, 0xca, 0x00, 0xfd, 0xfb, 0x02, 0x6f,
+    0x1d, 0xca, 0x95, 0xd7, 0x00, 0xfe, 0x01, 0xcd, 0x40, 0xce, 0x00, 0xfd,
+    0xf1, 0xc8, 0xa0, 0x8a, 0x00, 0x1e, 0xb1, 0xc9, 0xaa, 0x4b, 0x00, 0x1e,
+    0xa8, 0xc6, 0x5c, 0xcc, 0x00, 0xfd, 0xe9, 0x03, 0xc2, 0x6f, 0x23, 0xd0,
+    0x5a, 0x42, 0x08, 0x0c, 0x10, 0x46, 0x01, 0x93, 0xc2, 0x6f, 0x2f, 0xd1,
+    0x52, 0xab, 0x00, 0x1b, 0xa9, 0x46, 0x11, 0xb3, 0xc2, 0x6f, 0x4b, 0xc9,
+    0xab, 0xfb, 0x08, 0x0c, 0x18, 0xcc, 0x48, 0x3d, 0x00, 0x1b, 0xd1, 0xc8,
+    0xb3, 0x79, 0x08, 0x0b, 0xc8, 0xc4, 0x62, 0x65, 0x00, 0x1c, 0x21, 0x0a,
+    0xc2, 0x6f, 0x57, 0x43, 0x01, 0xa2, 0xc2, 0x6f, 0x63, 0xca, 0x9a, 0x52,
+    0x08, 0x0b, 0xd1, 0xd1, 0x54, 0xdc, 0x08, 0x0c, 0x48, 0xc9, 0xb2, 0xf1,
+    0x00, 0x1c, 0x39, 0x4a, 0xa7, 0xb8, 0xc2, 0x6f, 0x6f, 0x14, 0x42, 0x6f,
+    0xa1, 0x43, 0x61, 0x7d, 0xc2, 0x6f, 0xad, 0xdd, 0x11, 0xaa, 0x00, 0x1f,
+    0xb0, 0xce, 0x6d, 0xa0, 0x08, 0x0b, 0xf9, 0xce, 0x74, 0x14, 0x08, 0x0c,
+    0x00, 0xcb, 0x20, 0xd1, 0x00, 0x1e, 0x91, 0xd5, 0x34, 0xf9, 0x00, 0x1e,
+    0x99, 0xd9, 0x20, 0xc3, 0x00, 0x1e, 0xa0, 0xca, 0x34, 0x32, 0x01, 0x17,
+    0x39, 0xc5, 0x0b, 0x24, 0x01, 0x13, 0x48, 0xc9, 0x02, 0xa0, 0x01, 0x13,
+    0xb9, 0x43, 0x00, 0xe4, 0xc2, 0x6f, 0xb9, 0xd0, 0x5d, 0xd2, 0x01, 0x53,
+    0xf3, 0x02, 0x6f, 0xc5, 0xcb, 0x1c, 0x8c, 0x01, 0x54, 0x30, 0xc9, 0x0b,
+    0x20, 0x01, 0x13, 0x39, 0xd1, 0x56, 0x52, 0x01, 0x55, 0x20, 0xd0, 0x02,
+    0xf9, 0x01, 0x4b, 0xc1, 0x06, 0xc2, 0x6f, 0xcb, 0x15, 0xc2, 0x6f, 0xd1,
+    0x0e, 0x42, 0x6f, 0xdd, 0xd8, 0x23, 0x4d, 0x01, 0x54, 0x41, 0xcf, 0x6a,
+    0x16, 0x01, 0x54, 0x50, 0x8e, 0x08, 0x9b, 0x13, 0x02, 0x6f, 0xe3, 0x94,
+    0x08, 0x9a, 0x1a, 0x02, 0x6f, 0xe7, 0x97, 0x08, 0x9a, 0x61, 0x8b, 0x08,
+    0x9a, 0x41, 0x83, 0x08, 0x99, 0xf0, 0x97, 0x08, 0x9a, 0x10, 0x8b, 0x08,
+    0x9a, 0x00, 0x47, 0xaa, 0xd3, 0xc2, 0x6f, 0xeb, 0x45, 0x03, 0x51, 0xc2,
+    0x6f, 0xf9, 0x83, 0x08, 0x99, 0xa8, 0x83, 0x08, 0x99, 0xc1, 0xc2, 0x0d,
+    0x01, 0x08, 0x99, 0xb9, 0xc2, 0x00, 0xce, 0x08, 0x99, 0xb0, 0xc2, 0x00,
+    0x89, 0x08, 0x99, 0x99, 0x83, 0x08, 0x99, 0x90, 0xc2, 0x00, 0xce, 0x08,
+    0x99, 0x69, 0x83, 0x08, 0x99, 0x60, 0xc2, 0x00, 0xce, 0x08, 0x99, 0x59,
+    0x83, 0x08, 0x99, 0x50, 0xc2, 0x00, 0xce, 0x08, 0x99, 0x39, 0x83, 0x08,
+    0x99, 0x31, 0x06, 0x42, 0x70, 0x05, 0xc2, 0x00, 0xce, 0x08, 0x99, 0x29,
+    0x16, 0xc2, 0x70, 0x0f, 0x83, 0x08, 0x99, 0x20, 0xc2, 0x1a, 0x18, 0x08,
+    0x98, 0xf1, 0xc2, 0x00, 0xeb, 0x08, 0x98, 0xc9, 0xc2, 0x03, 0x83, 0x08,
+    0x99, 0x19, 0x83, 0x08, 0x99, 0x40, 0xc2, 0x00, 0xce, 0x08, 0x98, 0xe9,
+    0x83, 0x08, 0x98, 0xe0, 0xc2, 0x00, 0xce, 0x08, 0x98, 0xd9, 0x83, 0x08,
+    0x98, 0xd0, 0xc2, 0x00, 0xce, 0x08, 0x98, 0xc1, 0x83, 0x08, 0x98, 0xb8,
+    0xc2, 0x00, 0xce, 0x08, 0x98, 0xb1, 0x83, 0x08, 0x98, 0xa8, 0x97, 0x08,
+    0x98, 0xa1, 0x8b, 0x08, 0x98, 0x81, 0x83, 0x08, 0x98, 0x30, 0x97, 0x08,
+    0x98, 0x50, 0x8b, 0x08, 0x98, 0x40, 0xc4, 0x1f, 0xf7, 0x08, 0x9a, 0x69,
+    0xc5, 0x40, 0xb0, 0x08, 0x98, 0x18, 0xc7, 0x7e, 0x15, 0x08, 0x99, 0xe9,
+    0xc7, 0x14, 0x03, 0x08, 0x98, 0x10, 0xca, 0x1f, 0xea, 0x08, 0x98, 0x09,
+    0xd7, 0x2a, 0xe0, 0x08, 0x98, 0x00, 0x15, 0xc2, 0x70, 0x19, 0xdb, 0x18,
+    0xdd, 0x0f, 0xc9, 0x50, 0xc9, 0xa9, 0xbb, 0x00, 0xe5, 0xf9, 0x95, 0x00,
+    0xe4, 0xd0, 0x03, 0xc2, 0x70, 0x25, 0xc2, 0x0b, 0x28, 0x00, 0xe5, 0xa9,
+    0xc2, 0x01, 0xac, 0x00, 0xe5, 0x91, 0x87, 0x00, 0xe5, 0x88, 0xc2, 0x00,
+    0x79, 0x00, 0xe5, 0xe9, 0xc2, 0x00, 0xaf, 0x00, 0xe5, 0xd1, 0x90, 0x00,
+    0xe4, 0x80, 0xc9, 0xaf, 0x9a, 0x00, 0xe5, 0xc9, 0x03, 0x42, 0x70, 0x30,
+    0xc4, 0x76, 0xbe, 0x00, 0xe5, 0xc1, 0x90, 0x00, 0xe4, 0xa0, 0xc3, 0x00,
+    0xce, 0x00, 0xe5, 0x79, 0xc2, 0x01, 0xd7, 0x00, 0xe5, 0x58, 0x0a, 0xc2,
+    0x70, 0x38, 0xc2, 0x01, 0xd7, 0x00, 0xe5, 0x61, 0xc2, 0x00, 0x6b, 0x00,
+    0xe5, 0x50, 0xc3, 0x11, 0x9a, 0x00, 0xe5, 0x41, 0xc2, 0x00, 0x6b, 0x00,
+    0xe5, 0x08, 0xc3, 0x00, 0xce, 0x00, 0xe5, 0x31, 0xc2, 0x00, 0x6b, 0x00,
+    0xe4, 0x90, 0xc3, 0x03, 0x4b, 0x00, 0xe5, 0x29, 0xc2, 0x00, 0x6b, 0x00,
+    0xe4, 0xc8, 0xc3, 0x03, 0x4b, 0x00, 0xe5, 0x21, 0xc2, 0x00, 0x72, 0x00,
+    0xe4, 0xf0, 0xc3, 0x03, 0x4b, 0x00, 0xe4, 0xf9, 0xc2, 0x00, 0x79, 0x00,
+    0xe4, 0xb0, 0x90, 0x00, 0x85, 0x01, 0xc2, 0x00, 0x79, 0x00, 0x86, 0x68,
+    0xc2, 0x00, 0x6b, 0x00, 0x85, 0x11, 0xc3, 0x00, 0xce, 0x00, 0x85, 0xb0,
+    0xc2, 0x00, 0x79, 0x00, 0x85, 0x31, 0xc3, 0x03, 0x4b, 0x00, 0x85, 0x78,
+    0x90, 0x00, 0x85, 0x39, 0x94, 0x00, 0x85, 0x90, 0xc2, 0x00, 0x6b, 0x00,
+    0x85, 0x49, 0xc3, 0x03, 0x4b, 0x00, 0x85, 0xa8, 0xc2, 0x00, 0x72, 0x00,
+    0x85, 0x71, 0xc3, 0x03, 0x4b, 0x00, 0x85, 0xa0, 0xc2, 0x00, 0x6b, 0x00,
+    0x85, 0x89, 0xc3, 0x11, 0x9a, 0x00, 0x85, 0xc0, 0x0a, 0xc2, 0x70, 0x44,
+    0xc2, 0x00, 0x6b, 0x00, 0x85, 0xd1, 0xc2, 0x01, 0xd7, 0x00, 0x85, 0xe0,
+    0xc2, 0x01, 0xd7, 0x00, 0x85, 0xd9, 0xc3, 0x00, 0xce, 0x00, 0x85, 0xf8,
+    0x03, 0xc2, 0x70, 0x50, 0x87, 0x00, 0x86, 0x09, 0xc2, 0x01, 0xac, 0x00,
+    0x86, 0x11, 0xc2, 0x0b, 0x28, 0x00, 0x86, 0x28, 0x90, 0x00, 0x86, 0x81,
+    0xc2, 0x00, 0xaf, 0x00, 0x87, 0xd1, 0xc2, 0x00, 0x79, 0x00, 0x87, 0xe8,
+    0xc2, 0x00, 0x6b, 0x00, 0x86, 0x91, 0xc3, 0x00, 0xce, 0x00, 0x87, 0x30,
+    0x90, 0x00, 0x86, 0xa1, 0xc4, 0x76, 0xbe, 0x00, 0x87, 0xc0, 0xc2, 0x00,
+    0x79, 0x00, 0x86, 0xb1, 0xc3, 0x03, 0x4b, 0x00, 0x86, 0xf8, 0x03, 0xc2,
+    0x70, 0x58, 0xc9, 0xaf, 0x9a, 0x00, 0x87, 0xc8, 0xc2, 0x00, 0x6b, 0x00,
+    0x86, 0xc9, 0xc3, 0x03, 0x4b, 0x00, 0x87, 0x28, 0x95, 0x00, 0x86, 0xd1,
+    0xc9, 0xa9, 0xbb, 0x00, 0x87, 0xf8, 0xc2, 0x00, 0x72, 0x00, 0x86, 0xf1,
+    0xc3, 0x03, 0x4b, 0x00, 0x87, 0x20, 0xc2, 0x00, 0x6b, 0x00, 0x87, 0x09,
+    0xc3, 0x11, 0x9a, 0x00, 0x87, 0x40, 0x0a, 0xc2, 0x70, 0x60, 0xc2, 0x00,
+    0x6b, 0x00, 0x87, 0x51, 0xc2, 0x01, 0xd7, 0x00, 0x87, 0x60, 0xc2, 0x01,
+    0xd7, 0x00, 0x87, 0x59, 0xc3, 0x00, 0xce, 0x00, 0x87, 0x78, 0x03, 0xc2,
+    0x70, 0x6c, 0x87, 0x00, 0x87, 0x89, 0xc2, 0x01, 0xac, 0x00, 0x87, 0x91,
+    0xc2, 0x0b, 0x28, 0x00, 0x87, 0xa8, 0x90, 0x01, 0x68, 0x01, 0xc2, 0x00,
+    0x79, 0x01, 0x69, 0x68, 0xc2, 0x00, 0x6b, 0x01, 0x68, 0x11, 0xc3, 0x00,
+    0xce, 0x01, 0x68, 0xb0, 0xc2, 0x00, 0x79, 0x01, 0x68, 0x31, 0xc3, 0x03,
+    0x4b, 0x01, 0x68, 0x78, 0x90, 0x01, 0x68, 0x39, 0x94, 0x01, 0x68, 0x90,
+    0xc2, 0x00, 0x6b, 0x01, 0x68, 0x49, 0xc3, 0x03, 0x4b, 0x01, 0x68, 0xa8,
+    0xc2, 0x00, 0x72, 0x01, 0x68, 0x71, 0xc3, 0x03, 0x4b, 0x01, 0x68, 0xa0,
+    0xc2, 0x00, 0x6b, 0x01, 0x68, 0x89, 0xc3, 0x11, 0x9a, 0x01, 0x68, 0xc0,
+    0x0a, 0xc2, 0x70, 0x77, 0xc2, 0x00, 0x6b, 0x01, 0x68, 0xd1, 0xc2, 0x01,
+    0xd7, 0x01, 0x68, 0xe0, 0xc2, 0x01, 0xd7, 0x01, 0x68, 0xd9, 0xc3, 0x00,
+    0xce, 0x01, 0x68, 0xf8, 0x03, 0xc2, 0x70, 0x83, 0x87, 0x01, 0x69, 0x09,
+    0xc2, 0x01, 0xac, 0x01, 0x69, 0x11, 0xc2, 0x0b, 0x28, 0x01, 0x69, 0x28,
+    0xc3, 0xe5, 0x47, 0x01, 0x60, 0x09, 0xc6, 0xc4, 0xc3, 0x01, 0x61, 0x40,
+    0xc4, 0xe2, 0x58, 0x01, 0x60, 0x21, 0xc4, 0xe2, 0x78, 0x01, 0x60, 0x39,
+    0xc5, 0xda, 0x5d, 0x01, 0x60, 0x60, 0x07, 0xc2, 0x70, 0x8b, 0xc3, 0x01,
+    0x17, 0x01, 0x61, 0x09, 0x97, 0x01, 0x61, 0x19, 0x91, 0x01, 0x61, 0x30,
+    0xc6, 0xd1, 0x72, 0x01, 0x60, 0x31, 0xc5, 0xd5, 0xf8, 0x01, 0x60, 0x40,
+    0x42, 0x25, 0x73, 0xc2, 0x70, 0x95, 0xcb, 0x8c, 0x78, 0x01, 0x60, 0x51,
+    0x47, 0x19, 0xb0, 0x42, 0x70, 0x9f, 0xc6, 0xc2, 0x00, 0x01, 0x60, 0x71,
+    0xcf, 0x62, 0x2d, 0x01, 0x61, 0x70, 0xc2, 0x0c, 0x66, 0x01, 0x60, 0x89,
+    0xc2, 0x00, 0x16, 0x01, 0x60, 0xc8, 0xc5, 0xca, 0x6b, 0x01, 0x60, 0x91,
+    0x87, 0x01, 0x60, 0xd0, 0xc4, 0xe4, 0x68, 0x01, 0x60, 0xa1, 0x0a, 0xc2,
+    0x70, 0xab, 0xc9, 0xac, 0x43, 0x01, 0x61, 0x11, 0xc8, 0xaf, 0x2f, 0x01,
+    0x61, 0x22, 0x02, 0x70, 0xb8, 0xc5, 0xd8, 0x7d, 0x01, 0x60, 0xa9, 0xc2,
+    0x00, 0x8d, 0x01, 0x60, 0xe1, 0xcb, 0x93, 0x16, 0x01, 0x61, 0x68, 0xc4,
+    0xab, 0x80, 0x01, 0x60, 0xb9, 0xc3, 0x02, 0x66, 0x01, 0x61, 0x50, 0xc5,
+    0x76, 0x6c, 0x01, 0x60, 0xe9, 0xcd, 0x76, 0x64, 0x01, 0x61, 0x78, 0xc3,
+    0xe5, 0x47, 0x01, 0x61, 0x89, 0xc6, 0xc4, 0xc3, 0x01, 0x62, 0xc0, 0xc4,
+    0xe2, 0x58, 0x01, 0x61, 0xa1, 0xc4, 0xe2, 0x78, 0x01, 0x61, 0xb9, 0xc5,
+    0xda, 0x5d, 0x01, 0x61, 0xe0, 0x07, 0xc2, 0x70, 0xbe, 0xc3, 0x01, 0x17,
+    0x01, 0x62, 0x89, 0x97, 0x01, 0x62, 0x99, 0x91, 0x01, 0x62, 0xb0, 0xc6,
+    0xd1, 0x72, 0x01, 0x61, 0xb1, 0xc5, 0xd5, 0xf8, 0x01, 0x61, 0xc0, 0x42,
+    0x25, 0x73, 0xc2, 0x70, 0xc8, 0xcb, 0x8c, 0x78, 0x01, 0x61, 0xd1, 0x47,
+    0x19, 0xb0, 0x42, 0x70, 0xd2, 0xc6, 0xc2, 0x00, 0x01, 0x61, 0xf1, 0xcf,
+    0x62, 0x2d, 0x01, 0x62, 0xf0, 0xc2, 0x0c, 0x66, 0x01, 0x62, 0x09, 0xc2,
+    0x00, 0x16, 0x01, 0x62, 0x48, 0xc5, 0xca, 0x6b, 0x01, 0x62, 0x11, 0x87,
+    0x01, 0x62, 0x50, 0xc4, 0xe4, 0x68, 0x01, 0x62, 0x21, 0x0a, 0xc2, 0x70,
+    0xde, 0xc9, 0xac, 0x43, 0x01, 0x62, 0x91, 0xc8, 0xaf, 0x2f, 0x01, 0x62,
+    0xa2, 0x02, 0x70, 0xeb, 0xc5, 0xd8, 0x7d, 0x01, 0x62, 0x29, 0xc2, 0x00,
+    0x8d, 0x01, 0x62, 0x61, 0xcb, 0x93, 0x16, 0x01, 0x62, 0xe8, 0xc4, 0xab,
+    0x80, 0x01, 0x62, 0x39, 0xc3, 0x02, 0x66, 0x01, 0x62, 0xd0, 0xc5, 0x76,
+    0x6c, 0x01, 0x62, 0x69, 0xcd, 0x76, 0x64, 0x01, 0x62, 0xf8, 0xc7, 0x14,
+    0x03, 0x00, 0x58, 0x11, 0xc7, 0x7e, 0x15, 0x00, 0x59, 0xe8, 0xc5, 0x40,
+    0xb0, 0x00, 0x58, 0x19, 0xc4, 0x1f, 0xf7, 0x00, 0x5a, 0x68, 0x83, 0x00,
+    0x58, 0x31, 0x8b, 0x00, 0x58, 0x81, 0x97, 0x00, 0x58, 0xa0, 0x8b, 0x00,
+    0x58, 0x40, 0x97, 0x00, 0x58, 0x50, 0x47, 0xaa, 0xd3, 0xc2, 0x70, 0xf1,
+    0x83, 0x00, 0x59, 0xa8, 0x83, 0x00, 0x58, 0xa9, 0xc2, 0x00, 0xce, 0x00,
+    0x58, 0xb0, 0x83, 0x00, 0x58, 0xb9, 0xc2, 0x00, 0xce, 0x00, 0x58, 0xc0,
+    0xc2, 0x00, 0xeb, 0x00, 0x58, 0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x58, 0xf1,
+    0xc2, 0x03, 0x83, 0x00, 0x59, 0x19, 0x83, 0x00, 0x59, 0x40, 0x83, 0x00,
+    0x58, 0xd1, 0xc2, 0x00, 0xce, 0x00, 0x58, 0xd8, 0x83, 0x00, 0x58, 0xe1,
+    0xc2, 0x00, 0xce, 0x00, 0x58, 0xe8, 0x16, 0xc2, 0x70, 0xff, 0x83, 0x00,
+    0x59, 0x21, 0xc2, 0x00, 0xce, 0x00, 0x59, 0x28, 0x06, 0xc2, 0x71, 0x09,
+    0x83, 0x00, 0x59, 0x31, 0xc2, 0x00, 0xce, 0x00, 0x59, 0x38, 0x83, 0x00,
+    0x59, 0x51, 0xc2, 0x00, 0xce, 0x00, 0x59, 0x58, 0x83, 0x00, 0x59, 0x61,
+    0xc2, 0x00, 0xce, 0x00, 0x59, 0x68, 0x83, 0x00, 0x59, 0x79, 0xc2, 0x1a,
+    0x18, 0x00, 0x5a, 0xf8, 0x83, 0x00, 0x59, 0x81, 0xc2, 0x00, 0x3b, 0x00,
+    0x5a, 0xe1, 0xc2, 0x00, 0xce, 0x00, 0x5a, 0xe8, 0x83, 0x00, 0x59, 0x91,
+    0xc2, 0x00, 0x89, 0x00, 0x59, 0x98, 0xc2, 0x00, 0xce, 0x00, 0x59, 0xb1,
+    0xc2, 0x0d, 0x01, 0x00, 0x59, 0xb9, 0x83, 0x00, 0x59, 0xc0, 0x83, 0x00,
+    0x59, 0xf1, 0x8b, 0x00, 0x5a, 0x41, 0x97, 0x00, 0x5a, 0x60, 0x8b, 0x00,
+    0x5a, 0x00, 0x97, 0x00, 0x5a, 0x10, 0x94, 0x00, 0x5a, 0x1b, 0x02, 0x71,
+    0x13, 0x8e, 0x00, 0x5b, 0x12, 0x02, 0x71, 0x17, 0xc2, 0x01, 0xa2, 0x00,
+    0x5b, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x5b, 0x48, 0xc3, 0x04, 0xa0, 0x00,
+    0x5b, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x5b, 0x58, 0xc2, 0x24, 0x36, 0x00,
+    0x5b, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x5b, 0x68, 0xc7, 0x06, 0x7b, 0x00,
+    0x5b, 0x91, 0xc4, 0x04, 0x30, 0x00, 0x5b, 0x99, 0xc9, 0x69, 0x08, 0x00,
+    0x5b, 0xa9, 0xc6, 0x0a, 0xfd, 0x00, 0x5b, 0xb0, 0xc8, 0x06, 0x7b, 0x00,
+    0x5b, 0xa1, 0xca, 0xa2, 0x2c, 0x00, 0x5b, 0xb8, 0xc2, 0x00, 0x98, 0x0f,
+    0x68, 0x2b, 0x02, 0x71, 0x1b, 0xc3, 0x43, 0x20, 0x0f, 0x68, 0x72, 0x02,
+    0x71, 0x1f, 0xc2, 0x00, 0x35, 0x0f, 0x68, 0x23, 0x02, 0x71, 0x25, 0xc3,
+    0x0c, 0xf2, 0x0f, 0x68, 0x6a, 0x02, 0x71, 0x29, 0xc3, 0x03, 0xe1, 0x0f,
+    0x68, 0x1b, 0x02, 0x71, 0x2f, 0xc4, 0x0c, 0xf1, 0x0f, 0x68, 0x62, 0x02,
+    0x71, 0x33, 0x91, 0x0f, 0x68, 0x13, 0x02, 0x71, 0x39, 0xc4, 0x17, 0xf9,
+    0x0f, 0x68, 0x5a, 0x02, 0x71, 0x3d, 0xc9, 0x53, 0xcf, 0x0f, 0x69, 0x28,
+    0xc7, 0x0c, 0xe7, 0x0f, 0x68, 0x99, 0xc8, 0x53, 0xd0, 0x0f, 0x68, 0xe0,
+    0xc2, 0x0c, 0xf3, 0x0f, 0x68, 0x7b, 0x02, 0x71, 0x43, 0x01, 0x42, 0x71,
+    0x49, 0xc2, 0x0c, 0xf3, 0x0f, 0x68, 0x83, 0x02, 0x71, 0x55, 0x01, 0x42,
+    0x71, 0x5b, 0xc9, 0x53, 0xcf, 0x0f, 0x69, 0x60, 0xc7, 0x0c, 0xe7, 0x0f,
+    0x68, 0xd1, 0xc8, 0x53, 0xd0, 0x0f, 0x69, 0x18, 0xc9, 0x53, 0xcf, 0x0f,
+    0x69, 0x68, 0xc7, 0x0c, 0xe7, 0x0f, 0x68, 0xd9, 0xc8, 0x53, 0xd0, 0x0f,
+    0x69, 0x20, 0xc9, 0x53, 0xcf, 0x0f, 0x69, 0xd0, 0xc9, 0x53, 0xcf, 0x0f,
+    0x69, 0xd8, 0xc8, 0x0c, 0xe6, 0x0f, 0x69, 0xc0, 0xc8, 0x0c, 0xe6, 0x0f,
+    0x69, 0xc8, 0xc6, 0x2f, 0xa0, 0x01, 0x3e, 0x21, 0xc4, 0x0e, 0x6c, 0x01,
+    0x3e, 0x18, 0xd8, 0x25, 0x8d, 0x01, 0x39, 0xe1, 0xc8, 0x09, 0x81, 0x01,
+    0x39, 0x91, 0xca, 0x23, 0xd3, 0x01, 0x39, 0x59, 0xc5, 0x0d, 0x22, 0x01,
+    0x38, 0xd8, 0x9a, 0x01, 0x21, 0x19, 0xc2, 0x00, 0x58, 0x0f, 0xa6, 0xb0,
+    0xc5, 0x5a, 0xb8, 0x0f, 0xae, 0x09, 0xca, 0x9b, 0x60, 0x0f, 0xa6, 0x10,
+    0xcc, 0x8b, 0x08, 0x0f, 0xa7, 0x69, 0xcb, 0x95, 0x9f, 0x0f, 0xa7, 0x60,
+    0xcd, 0x7b, 0x51, 0x01, 0x1c, 0x81, 0xcd, 0x7d, 0x18, 0x01, 0x1c, 0x78,
+    0xc9, 0x3c, 0xcf, 0x08, 0x7c, 0x49, 0x44, 0x01, 0xa1, 0xc2, 0x71, 0x67,
+    0xc3, 0x02, 0xca, 0x08, 0x7c, 0x30, 0x49, 0x03, 0x1b, 0xc2, 0x71, 0x73,
+    0x44, 0x05, 0x1a, 0x42, 0x71, 0x7f, 0x0e, 0xc2, 0x71, 0x8b, 0xc3, 0x6e,
+    0xe0, 0x08, 0x7c, 0x01, 0xc2, 0x00, 0x78, 0x08, 0x7b, 0xe1, 0x15, 0xc2,
+    0x71, 0x97, 0xc3, 0x20, 0xb0, 0x08, 0x7b, 0xd1, 0xc3, 0x03, 0xb0, 0x08,
+    0x7b, 0xc9, 0xc4, 0xe0, 0x58, 0x08, 0x7b, 0xb9, 0xc4, 0x4e, 0x09, 0x08,
+    0x7b, 0xb1, 0xca, 0x9c, 0x8c, 0x08, 0x7b, 0xa9, 0xc5, 0x4e, 0x03, 0x08,
+    0x7b, 0xa1, 0xc3, 0x76, 0xe6, 0x08, 0x7b, 0x99, 0xca, 0x9b, 0xd8, 0x08,
+    0x7b, 0x91, 0xc4, 0xe0, 0x9c, 0x08, 0x7b, 0x89, 0xc5, 0x9f, 0x89, 0x08,
+    0x7b, 0x81, 0xc4, 0x5a, 0xd2, 0x08, 0x7b, 0xf0, 0xd1, 0x54, 0x43, 0x08,
+    0x79, 0x31, 0x47, 0x37, 0xb8, 0xc2, 0x71, 0xa1, 0x0e, 0x42, 0x71, 0xb2,
+    0x43, 0x2c, 0xda, 0xc2, 0x71, 0xbe, 0x47, 0x01, 0x92, 0x42, 0x71, 0xca,
+    0xc3, 0x01, 0x43, 0x08, 0x67, 0xe1, 0x42, 0x01, 0x3a, 0xc2, 0x72, 0x27,
+    0xc3, 0x05, 0x16, 0x08, 0x67, 0xd2, 0x02, 0x72, 0x33, 0x97, 0x08, 0x67,
+    0x53, 0x02, 0x72, 0x37, 0x87, 0x08, 0x66, 0x4b, 0x02, 0x72, 0x45, 0x4a,
+    0xa0, 0x56, 0xc2, 0x72, 0xa5, 0x4b, 0x92, 0x87, 0xc2, 0x72, 0xb1, 0xc8,
+    0xb9, 0x88, 0x08, 0x67, 0x19, 0x91, 0x08, 0x66, 0xdb, 0x02, 0x72, 0xbd,
+    0x83, 0x08, 0x66, 0x03, 0x02, 0x72, 0xc7, 0x8b, 0x08, 0x66, 0x83, 0x02,
+    0x72, 0xdb, 0xc7, 0xc3, 0x6b, 0x08, 0x66, 0x50, 0x87, 0x08, 0x64, 0x4b,
+    0x02, 0x72, 0xdf, 0xc8, 0xb9, 0x88, 0x08, 0x65, 0x19, 0x91, 0x08, 0x64,
+    0xdb, 0x02, 0x73, 0x3f, 0x4a, 0xa0, 0x56, 0xc2, 0x73, 0x49, 0x4b, 0x92,
+    0x87, 0xc2, 0x73, 0x55, 0x97, 0x08, 0x65, 0x53, 0x02, 0x73, 0x61, 0x83,
+    0x08, 0x64, 0x03, 0x02, 0x73, 0x6f, 0x8b, 0x08, 0x64, 0x83, 0x02, 0x73,
+    0x83, 0xc7, 0xc3, 0x6b, 0x08, 0x64, 0x50, 0xc4, 0xe1, 0x50, 0x08, 0x62,
+    0x41, 0x91, 0x08, 0x60, 0x33, 0x02, 0x73, 0x87, 0x83, 0x08, 0x60, 0x03,
+    0x02, 0x73, 0x9a, 0x07, 0xc2, 0x73, 0xc9, 0x8b, 0x08, 0x60, 0x1a, 0x02,
+    0x73, 0xe9, 0x83, 0x08, 0x60, 0x0b, 0x02, 0x73, 0xf1, 0x87, 0x08, 0x60,
+    0x2b, 0x02, 0x74, 0x24, 0x11, 0xc2, 0x74, 0x36, 0x8b, 0x08, 0x60, 0x22,
+    0x02, 0x74, 0x41, 0x16, 0xc2, 0x74, 0x45, 0xc3, 0x05, 0x16, 0x08, 0x54,
+    0xe8, 0x42, 0x01, 0x16, 0xc2, 0x74, 0x51, 0x16, 0xc2, 0x74, 0x5b, 0xc3,
+    0x2d, 0x8d, 0x08, 0x54, 0xd1, 0x09, 0xc2, 0x74, 0x6b, 0x42, 0x0e, 0x60,
+    0xc2, 0x74, 0x77, 0x43, 0x2c, 0xb2, 0xc2, 0x74, 0x7f, 0xc3, 0x76, 0xe6,
+    0x08, 0x54, 0x29, 0xc3, 0x0f, 0xba, 0x08, 0x54, 0x21, 0xc4, 0x1b, 0xb8,
+    0x08, 0x54, 0x19, 0x0a, 0xc2, 0x74, 0x8b, 0xc3, 0x0e, 0xf0, 0x08, 0x54,
+    0x09, 0xc3, 0x6e, 0xc6, 0x08, 0x54, 0x39, 0xc3, 0x88, 0x5c, 0x08, 0x54,
+    0x41, 0x0d, 0xc2, 0x74, 0x97, 0xc4, 0x3f, 0x67, 0x08, 0x54, 0x61, 0xc3,
+    0x0f, 0xd8, 0x08, 0x54, 0x71, 0xc3, 0xb3, 0x1e, 0x08, 0x54, 0x81, 0x03,
+    0x42, 0x74, 0xa3, 0xcd, 0x78, 0x79, 0x0f, 0xad, 0x99, 0x44, 0x1a, 0x00,
+    0x42, 0x74, 0xaf, 0xc2, 0x00, 0x6b, 0x08, 0x1a, 0x81, 0xc3, 0x2b, 0xcc,
+    0x08, 0x1a, 0x89, 0xc3, 0x46, 0x3a, 0x08, 0x1a, 0x91, 0x06, 0xc2, 0x74,
+    0xc1, 0x87, 0x08, 0x1a, 0xa3, 0x02, 0x74, 0xcb, 0x1c, 0xc2, 0x74, 0xcf,
+    0x8b, 0x08, 0x1a, 0xcb, 0x02, 0x74, 0xdb, 0xc4, 0xe0, 0x30, 0x08, 0x1a,
+    0xd1, 0xc3, 0x7c, 0xde, 0x08, 0x1a, 0xd9, 0xc5, 0xdb, 0xac, 0x08, 0x1a,
+    0xe1, 0xc5, 0xda, 0x8f, 0x08, 0x1a, 0xe9, 0x18, 0xc2, 0x74, 0xe3, 0xc4,
+    0xe3, 0x20, 0x08, 0x1a, 0xf9, 0xc3, 0x28, 0x32, 0x08, 0x1b, 0x01, 0x15,
+    0xc2, 0x74, 0xef, 0x16, 0xc2, 0x74, 0xf9, 0x97, 0x08, 0x1b, 0x19, 0xc5,
+    0xd4, 0xc2, 0x08, 0x1b, 0x21, 0x1b, 0xc2, 0x75, 0x05, 0x91, 0x08, 0x1b,
+    0x4b, 0x02, 0x75, 0x1f, 0xc2, 0x00, 0xce, 0x08, 0x1b, 0x60, 0xc2, 0x01,
+    0x24, 0x08, 0x18, 0x09, 0x0d, 0xc2, 0x75, 0x23, 0xc2, 0x00, 0x06, 0x08,
+    0x18, 0x19, 0x87, 0x08, 0x18, 0x23, 0x02, 0x75, 0x35, 0xc2, 0x00, 0x98,
+    0x08, 0x18, 0x29, 0xc2, 0x0a, 0x44, 0x08, 0x18, 0x31, 0xc2, 0x00, 0x61,
+    0x08, 0x18, 0x39, 0x16, 0xc2, 0x75, 0x59, 0x8b, 0x08, 0x18, 0x4b, 0x02,
+    0x75, 0x63, 0x83, 0x08, 0x18, 0x01, 0x91, 0x08, 0x18, 0x79, 0x12, 0xc2,
+    0x75, 0x67, 0x15, 0xc2, 0x75, 0x71, 0x97, 0x08, 0x18, 0xb3, 0x02, 0x75,
+    0x7d, 0xc3, 0x29, 0xdf, 0x08, 0x18, 0xe1, 0xc2, 0x0d, 0x1e, 0x08, 0x19,
+    0x69, 0xcc, 0x84, 0x24, 0x08, 0x19, 0x70, 0xc3, 0x05, 0x16, 0x08, 0x19,
+    0x01, 0x42, 0x01, 0x3a, 0xc2, 0x75, 0x81, 0xc3, 0x01, 0x43, 0x08, 0x19,
+    0x10, 0x83, 0x00, 0xe2, 0xf8, 0x99, 0x00, 0xe3, 0x19, 0x8f, 0x00, 0xe3,
+    0x11, 0x8c, 0x00, 0xe3, 0x09, 0x8d, 0x00, 0xe3, 0x00, 0xc7, 0x4e, 0xca,
+    0x01, 0x5d, 0xd1, 0xd1, 0x4e, 0xc0, 0x01, 0x5d, 0xd8, 0x90, 0x08, 0x25,
+    0x90, 0xc3, 0x19, 0x59, 0x08, 0x25, 0xb1, 0xc2, 0x02, 0x4d, 0x08, 0x25,
+    0xe9, 0xc2, 0x04, 0xf2, 0x08, 0x26, 0x29, 0x16, 0x42, 0x75, 0x8d, 0x83,
+    0x08, 0x26, 0x51, 0xc2, 0x00, 0xce, 0x08, 0x26, 0x60, 0x90, 0x08, 0x26,
+    0xd0, 0xc3, 0x19, 0x59, 0x08, 0x26, 0xf1, 0xc2, 0x02, 0x4d, 0x08, 0x27,
+    0x29, 0xc2, 0x04, 0xf2, 0x08, 0x27, 0x69, 0x16, 0x42, 0x75, 0x97, 0x83,
+    0x08, 0x27, 0x91, 0xc2, 0x00, 0xce, 0x08, 0x27, 0xa0, 0x0d, 0xc2, 0x75,
+    0xa1, 0xcb, 0x93, 0xdc, 0x0e, 0x7d, 0x89, 0xc8, 0x4a, 0x93, 0x0e, 0x7d,
+    0x80, 0xc6, 0xd2, 0xbc, 0x0e, 0x7a, 0x88, 0x0d, 0xc2, 0x75, 0xad, 0x16,
+    0xc2, 0x75, 0xb9, 0x44, 0xe0, 0xfc, 0xc2, 0x75, 0xc5, 0x49, 0x7e, 0xb8,
+    0xc2, 0x75, 0xd2, 0xce, 0x69, 0x90, 0x0e, 0x7c, 0xb9, 0x12, 0xc2, 0x75,
+    0xdf, 0xce, 0x6f, 0x1a, 0x0e, 0x7c, 0x98, 0x01, 0x42, 0x75, 0xe9, 0x01,
+    0x42, 0x75, 0xfe, 0x42, 0x00, 0x5b, 0xc2, 0x76, 0x0a, 0xc8, 0xb8, 0xc0,
+    0x0e, 0x7b, 0xf8, 0xcb, 0x85, 0x15, 0x0e, 0x7b, 0xe1, 0xce, 0x69, 0x90,
+    0x0e, 0x7b, 0xd9, 0xc8, 0x4a, 0x93, 0x0e, 0x7b, 0xd1, 0xc8, 0xbd, 0x80,
+    0x0e, 0x7b, 0xc8, 0x45, 0x4a, 0x8e, 0xc2, 0x76, 0x16, 0xce, 0x69, 0x90,
+    0x0e, 0x7b, 0xb8, 0xc6, 0x6f, 0x22, 0x0e, 0x7b, 0xa1, 0xca, 0x93, 0xdd,
+    0x0e, 0x7b, 0x98, 0xcc, 0x83, 0x94, 0x0e, 0x7d, 0x59, 0xc7, 0xc6, 0x27,
+    0x0e, 0x7d, 0x51, 0xc3, 0xe4, 0xab, 0x0e, 0x7d, 0x48, 0xc8, 0xba, 0xe0,
+    0x0e, 0x79, 0x68, 0xc8, 0xb9, 0xc0, 0x0e, 0x79, 0xc8, 0xc9, 0x7e, 0xc5,
+    0x0e, 0x78, 0xc1, 0x43, 0x00, 0x47, 0x42, 0x76, 0x22, 0xc5, 0x00, 0x64,
+    0x0e, 0x78, 0x89, 0xc4, 0x00, 0x2f, 0x0e, 0x78, 0x28, 0xc7, 0x98, 0xfc,
+    0x0e, 0x79, 0xb3, 0x02, 0x76, 0x2e, 0xc6, 0xcf, 0x20, 0x0e, 0x79, 0x30,
+    0x15, 0xc2, 0x76, 0x34, 0x43, 0x00, 0x47, 0x42, 0x76, 0x40, 0xc3, 0xe4,
+    0x8a, 0x0e, 0x79, 0x51, 0xc2, 0x00, 0x29, 0x0e, 0x79, 0x00, 0x43, 0x00,
+    0x47, 0xc2, 0x76, 0x4c, 0x4d, 0x7e, 0xc5, 0x42, 0x76, 0x58, 0xc6, 0x40,
+    0xee, 0x0e, 0x78, 0xf1, 0x42, 0x02, 0x4c, 0x42, 0x76, 0x64, 0xc5, 0x00,
+    0x64, 0x0e, 0x78, 0x91, 0xc4, 0x00, 0x2f, 0x0e, 0x78, 0x30, 0xc6, 0x7e,
+    0xc8, 0x0e, 0x78, 0xe9, 0x4b, 0x93, 0xb0, 0x42, 0x76, 0x70, 0xc5, 0x00,
+    0x64, 0x0e, 0x78, 0xa1, 0xc4, 0x00, 0x2f, 0x0e, 0x78, 0x40, 0xc5, 0x00,
+    0x64, 0x0e, 0x78, 0x81, 0xc4, 0x00, 0x2f, 0x0e, 0x78, 0x20, 0xc5, 0x00,
+    0x64, 0x0e, 0x78, 0x69, 0xc4, 0x00, 0x2f, 0x0e, 0x78, 0x08, 0xce, 0x1e,
+    0x44, 0x08, 0xd1, 0xb0, 0xc3, 0x0c, 0xfb, 0x05, 0x4e, 0x53, 0x02, 0x76,
+    0x7c, 0xc4, 0xe4, 0x20, 0x05, 0x4e, 0x18, 0xc6, 0xcb, 0xf6, 0x05, 0x4e,
+    0x39, 0xc6, 0x46, 0x1a, 0x05, 0x4e, 0x60, 0x17, 0xc2, 0x76, 0x82, 0xc5,
+    0xda, 0xbc, 0x05, 0x4e, 0x40, 0xc6, 0xcd, 0xca, 0x05, 0x4c, 0x98, 0x42,
+    0x01, 0x32, 0x42, 0x76, 0x8e, 0xc6, 0xcc, 0xe0, 0x05, 0x4d, 0x60, 0xc6,
+    0xcd, 0xca, 0x05, 0x4d, 0x40, 0x01, 0x42, 0x76, 0x9a, 0x83, 0x05, 0x4d,
+    0x23, 0x02, 0x76, 0xa6, 0xc2, 0x1a, 0x18, 0x05, 0x4c, 0xd3, 0x02, 0x76,
+    0xac, 0xc2, 0x00, 0xeb, 0x05, 0x4c, 0xa2, 0x02, 0x76, 0xb2, 0x83, 0x05,
+    0x4d, 0x13, 0x02, 0x76, 0xbb, 0xc2, 0x0e, 0x60, 0x05, 0x4c, 0xea, 0x02,
+    0x76, 0xc1, 0x83, 0x05, 0x4d, 0x03, 0x02, 0x76, 0xc7, 0xc2, 0x00, 0x51,
+    0x05, 0x4c, 0xda, 0x02, 0x76, 0xcd, 0xca, 0x66, 0x1f, 0x05, 0x4c, 0xc8,
+    0xc6, 0xcd, 0xca, 0x05, 0x4c, 0xb0, 0x01, 0x42, 0x76, 0xd3, 0x8b, 0x05,
+    0x4c, 0x68, 0x8b, 0x05, 0x4c, 0x39, 0xc5, 0xd8, 0x1e, 0x05, 0x4c, 0x28,
+    0xc4, 0x0a, 0xb7, 0x05, 0x4d, 0xd1, 0xc4, 0xcc, 0xd3, 0x05, 0x4d, 0xa0,
+    0xcf, 0x69, 0x17, 0x01, 0x2c, 0xf2, 0x02, 0x76, 0xdf, 0x45, 0x00, 0x6a,
+    0x42, 0x76, 0xe5, 0x97, 0x05, 0x22, 0x03, 0x02, 0x76, 0xf1, 0x8b, 0x05,
+    0x21, 0x9b, 0x02, 0x77, 0x07, 0x91, 0x05, 0x21, 0xeb, 0x02, 0x77, 0x1a,
+    0x9b, 0x05, 0x22, 0x32, 0x02, 0x77, 0x26, 0x9b, 0x05, 0x1d, 0x3b, 0x02,
+    0x77, 0x39, 0x97, 0x05, 0x1d, 0x0b, 0x02, 0x77, 0x4c, 0x87, 0x05, 0x1c,
+    0xeb, 0x02, 0x77, 0x5f, 0x91, 0x05, 0x1c, 0xcb, 0x02, 0x77, 0x6b, 0x83,
+    0x05, 0x1c, 0xb2, 0x02, 0x77, 0x73, 0x87, 0x05, 0x13, 0x63, 0x02, 0x77,
+    0x7f, 0x91, 0x05, 0x13, 0x4b, 0x02, 0x77, 0x87, 0xc2, 0x01, 0x5c, 0x05,
+    0x13, 0x33, 0x02, 0x77, 0x93, 0x83, 0x05, 0x13, 0x13, 0x02, 0x77, 0x9b,
+    0xc2, 0x01, 0xac, 0x05, 0x12, 0xf2, 0x02, 0x77, 0xa7, 0x8b, 0x05, 0x17,
+    0x7b, 0x02, 0x77, 0xaf, 0x83, 0x05, 0x17, 0xb3, 0x02, 0x77, 0xc2, 0x97,
+    0x05, 0x17, 0xfb, 0x02, 0x77, 0xce, 0x11, 0xc2, 0x77, 0xe4, 0x87, 0x05,
+    0x17, 0xeb, 0x02, 0x77, 0xec, 0x9b, 0x05, 0x18, 0x2a, 0x02, 0x77, 0xf0,
+    0x8b, 0x05, 0x22, 0x63, 0x02, 0x78, 0x03, 0x97, 0x05, 0x22, 0xdb, 0x02,
+    0x78, 0x16, 0x91, 0x05, 0x22, 0xba, 0x02, 0x78, 0x29, 0x8b, 0x05, 0x03,
+    0xc3, 0x02, 0x78, 0x35, 0x83, 0x05, 0x03, 0xfb, 0x02, 0x78, 0x48, 0x91,
+    0x05, 0x04, 0x1b, 0x02, 0x78, 0x54, 0x97, 0x05, 0x04, 0x3b, 0x02, 0x78,
+    0x60, 0x9b, 0x05, 0x04, 0x6a, 0x02, 0x78, 0x73, 0x8b, 0x05, 0x0a, 0x9b,
+    0x02, 0x78, 0x86, 0x83, 0x05, 0x0a, 0xcb, 0x02, 0x78, 0x99, 0x91, 0x05,
+    0x0a, 0xeb, 0x02, 0x78, 0xa5, 0x87, 0x05, 0x0b, 0x03, 0x02, 0x78, 0xb1,
+    0x97, 0x05, 0x0b, 0x22, 0x02, 0x78, 0xb9, 0x96, 0x05, 0x0b, 0xe9, 0x9a,
+    0x05, 0x0b, 0xf1, 0x92, 0x05, 0x0c, 0x01, 0x87, 0x05, 0x0c, 0x12, 0x02,
+    0x78, 0xcc, 0x9a, 0x05, 0x0c, 0x21, 0x92, 0x05, 0x0c, 0x30, 0x91, 0x05,
+    0x0c, 0x43, 0x02, 0x78, 0xd4, 0x96, 0x05, 0x0c, 0x89, 0x9a, 0x05, 0x0c,
+    0x91, 0x92, 0x05, 0x0c, 0xa1, 0x94, 0x05, 0x0c, 0xb2, 0x02, 0x78, 0xdc,
+    0x96, 0x05, 0x0c, 0x51, 0x9a, 0x05, 0x0c, 0x59, 0x92, 0x05, 0x0c, 0x68,
+    0x9a, 0x05, 0x0c, 0x71, 0x92, 0x05, 0x0c, 0x80, 0x9b, 0x05, 0x21, 0x7b,
+    0x02, 0x78, 0xe0, 0x97, 0x05, 0x21, 0x4b, 0x02, 0x78, 0xec, 0x91, 0x05,
+    0x21, 0x2b, 0x02, 0x79, 0x06, 0x8b, 0x05, 0x20, 0xd2, 0x02, 0x79, 0x12,
+    0x94, 0x05, 0x1f, 0xdb, 0x02, 0x79, 0x25, 0x92, 0x05, 0x1f, 0xc9, 0x9a,
+    0x05, 0x1f, 0xb9, 0x96, 0x05, 0x1f, 0xb0, 0x94, 0x05, 0x1f, 0xab, 0x02,
+    0x79, 0x29, 0x92, 0x05, 0x1f, 0x99, 0x9a, 0x05, 0x1f, 0x89, 0x96, 0x05,
+    0x1f, 0x81, 0x91, 0x05, 0x1f, 0x52, 0x02, 0x79, 0x2d, 0x92, 0x05, 0x1f,
+    0x79, 0x9a, 0x05, 0x1f, 0x69, 0x96, 0x05, 0x1f, 0x60, 0x87, 0x05, 0x1f,
+    0x33, 0x02, 0x79, 0x39, 0x92, 0x05, 0x1f, 0x19, 0x9a, 0x05, 0x1f, 0x09,
+    0x96, 0x05, 0x1f, 0x00, 0x94, 0x05, 0x20, 0xbb, 0x02, 0x79, 0x45, 0x92,
+    0x05, 0x20, 0xa9, 0x9a, 0x05, 0x20, 0x99, 0x96, 0x05, 0x20, 0x90, 0x94,
+    0x05, 0x20, 0x8b, 0x02, 0x79, 0x49, 0x92, 0x05, 0x20, 0x79, 0x9a, 0x05,
+    0x20, 0x69, 0x96, 0x05, 0x20, 0x61, 0x91, 0x05, 0x20, 0x32, 0x02, 0x79,
+    0x4d, 0x92, 0x05, 0x20, 0x59, 0x9a, 0x05, 0x20, 0x49, 0x96, 0x05, 0x20,
+    0x40, 0x87, 0x05, 0x20, 0x13, 0x02, 0x79, 0x59, 0x92, 0x05, 0x1f, 0xf9,
+    0x9a, 0x05, 0x1f, 0xe9, 0x96, 0x05, 0x1f, 0xe0, 0x94, 0x05, 0x1e, 0xfb,
+    0x02, 0x79, 0x65, 0x92, 0x05, 0x1e, 0xe9, 0x9a, 0x05, 0x1e, 0xd9, 0x96,
+    0x05, 0x1e, 0xd0, 0x94, 0x05, 0x1e, 0xcb, 0x02, 0x79, 0x69, 0x92, 0x05,
+    0x1e, 0xb9, 0x9a, 0x05, 0x1e, 0xa9, 0x96, 0x05, 0x1e, 0xa1, 0x91, 0x05,
+    0x1e, 0x5a, 0x02, 0x79, 0x6d, 0x92, 0x05, 0x1e, 0x99, 0x9a, 0x05, 0x1e,
+    0x88, 0x92, 0x05, 0x1e, 0x81, 0x9a, 0x05, 0x1e, 0x71, 0x96, 0x05, 0x1e,
+    0x68, 0x92, 0x05, 0x1e, 0x49, 0x9a, 0x05, 0x1e, 0x39, 0x96, 0x05, 0x1e,
+    0x30, 0x9b, 0x05, 0x1c, 0x83, 0x02, 0x79, 0x75, 0x97, 0x05, 0x1c, 0x53,
+    0x02, 0x79, 0x88, 0x87, 0x05, 0x1c, 0x33, 0x02, 0x79, 0xa2, 0x91, 0x05,
+    0x1c, 0x13, 0x02, 0x79, 0xae, 0x83, 0x05, 0x1b, 0xea, 0x02, 0x79, 0xba,
+    0x9b, 0x05, 0x1e, 0x13, 0x02, 0x79, 0xbe, 0x97, 0x05, 0x1d, 0xe3, 0x02,
+    0x79, 0xd1, 0x87, 0x05, 0x1d, 0xc3, 0x02, 0x79, 0xeb, 0x91, 0x05, 0x1d,
+    0xa3, 0x02, 0x79, 0xf7, 0x83, 0x05, 0x1d, 0x6a, 0x02, 0x7a, 0x03, 0x9b,
+    0x05, 0x1a, 0x13, 0x02, 0x7a, 0x0f, 0x97, 0x05, 0x19, 0xf3, 0x02, 0x7a,
+    0x22, 0x87, 0x05, 0x19, 0xd3, 0x02, 0x7a, 0x2e, 0x91, 0x05, 0x19, 0xbb,
+    0x02, 0x7a, 0x36, 0x83, 0x05, 0x19, 0x9b, 0x02, 0x7a, 0x42, 0x8b, 0x05,
+    0x19, 0x62, 0x02, 0x7a, 0x4e, 0x94, 0x05, 0x19, 0x4b, 0x02, 0x7a, 0x61,
+    0x92, 0x05, 0x19, 0x39, 0x9a, 0x05, 0x19, 0x29, 0x96, 0x05, 0x19, 0x20,
+    0x94, 0x05, 0x19, 0x1b, 0x02, 0x7a, 0x65, 0x91, 0x05, 0x18, 0xab, 0x02,
+    0x7a, 0x69, 0x96, 0x05, 0x18, 0xf1, 0x9a, 0x05, 0x18, 0xf9, 0x92, 0x05,
+    0x19, 0x08, 0x96, 0x05, 0x18, 0x49, 0x9a, 0x05, 0x18, 0x51, 0x92, 0x05,
+    0x18, 0x61, 0x87, 0x05, 0x18, 0x72, 0x02, 0x7a, 0x71, 0x96, 0x05, 0x18,
+    0x81, 0x9a, 0x05, 0x18, 0x89, 0x92, 0x05, 0x18, 0x98, 0x96, 0x05, 0x18,
+    0xb9, 0x9a, 0x05, 0x18, 0xc1, 0x92, 0x05, 0x18, 0xd0, 0x9a, 0x05, 0x18,
+    0xd9, 0x92, 0x05, 0x18, 0xe8, 0x9b, 0x05, 0x1b, 0xc3, 0x02, 0x7a, 0x79,
+    0x97, 0x05, 0x1b, 0x93, 0x02, 0x7a, 0x8c, 0x87, 0x05, 0x1b, 0x7b, 0x02,
+    0x7a, 0xa2, 0x91, 0x05, 0x1b, 0x5b, 0x02, 0x7a, 0xae, 0x83, 0x05, 0x1b,
+    0x1a, 0x02, 0x7a, 0xba, 0x96, 0x05, 0x15, 0x71, 0x9a, 0x05, 0x15, 0x79,
+    0x92, 0x05, 0x15, 0x89, 0x87, 0x05, 0x15, 0xa2, 0x02, 0x7a, 0xc6, 0x96,
+    0x05, 0x15, 0xb1, 0x9a, 0x05, 0x15, 0xb9, 0x92, 0x05, 0x15, 0xc8, 0x91,
+    0x05, 0x15, 0xdb, 0x02, 0x7a, 0xd2, 0x96, 0x05, 0x16, 0x21, 0x9a, 0x05,
+    0x16, 0x29, 0x92, 0x05, 0x16, 0x39, 0x94, 0x05, 0x16, 0x4a, 0x02, 0x7a,
+    0xda, 0x96, 0x05, 0x15, 0xe9, 0x9a, 0x05, 0x15, 0xf1, 0x92, 0x05, 0x16,
+    0x00, 0x9a, 0x05, 0x16, 0x09, 0x92, 0x05, 0x16, 0x18, 0x96, 0x05, 0x16,
+    0x51, 0x9a, 0x05, 0x16, 0x59, 0x92, 0x05, 0x16, 0x69, 0x94, 0x05, 0x16,
+    0x7a, 0x02, 0x7a, 0xde, 0x9b, 0x05, 0x1a, 0xeb, 0x02, 0x7a, 0xe2, 0x97,
+    0x05, 0x1a, 0xbb, 0x02, 0x7a, 0xf5, 0x87, 0x05, 0x1a, 0x9b, 0x02, 0x7b,
+    0x0f, 0x91, 0x05, 0x1a, 0x7b, 0x02, 0x7b, 0x1b, 0x83, 0x05, 0x1a, 0x42,
+    0x02, 0x7b, 0x27, 0x9a, 0x05, 0x14, 0xf9, 0x92, 0x05, 0x15, 0x08, 0x92,
+    0x05, 0x14, 0xf1, 0x9a, 0x05, 0x14, 0xe1, 0x96, 0x05, 0x14, 0xd8, 0x91,
+    0x05, 0x14, 0xcb, 0x02, 0x7b, 0x33, 0x96, 0x05, 0x15, 0x11, 0x9a, 0x05,
+    0x15, 0x19, 0x92, 0x05, 0x15, 0x29, 0x94, 0x05, 0x15, 0x3a, 0x02, 0x7b,
+    0x3b, 0x92, 0x05, 0x14, 0xb9, 0x9a, 0x05, 0x14, 0xa9, 0x96, 0x05, 0x14,
+    0xa0, 0x87, 0x05, 0x14, 0x93, 0x02, 0x7b, 0x3f, 0x92, 0x05, 0x14, 0x81,
+    0x9a, 0x05, 0x14, 0x71, 0x96, 0x05, 0x14, 0x68, 0x96, 0x05, 0x15, 0x41,
+    0x9a, 0x05, 0x15, 0x49, 0x92, 0x05, 0x15, 0x59, 0x94, 0x05, 0x15, 0x6a,
+    0x02, 0x7b, 0x47, 0x8b, 0x05, 0x16, 0x93, 0x02, 0x7b, 0x4b, 0x83, 0x05,
+    0x16, 0xd3, 0x02, 0x7b, 0x5e, 0x91, 0x05, 0x16, 0xeb, 0x02, 0x7b, 0x6a,
+    0x87, 0x05, 0x17, 0x03, 0x02, 0x7b, 0x72, 0x97, 0x05, 0x17, 0x1b, 0x02,
+    0x7b, 0x7a, 0x9b, 0x05, 0x17, 0x4a, 0x02, 0x7b, 0x89, 0x92, 0x05, 0x14,
+    0x61, 0x9a, 0x05, 0x14, 0x50, 0x92, 0x05, 0x14, 0x49, 0x9a, 0x05, 0x14,
+    0x38, 0x91, 0x05, 0x14, 0x2a, 0x02, 0x7b, 0x9c, 0x92, 0x05, 0x14, 0x19,
+    0x9a, 0x05, 0x14, 0x09, 0x96, 0x05, 0x14, 0x00, 0x92, 0x05, 0x13, 0xf9,
+    0x9a, 0x05, 0x13, 0xe8, 0x92, 0x05, 0x13, 0xe1, 0x9a, 0x05, 0x13, 0xd1,
+    0x96, 0x05, 0x13, 0xc8, 0x92, 0x05, 0x13, 0xc1, 0x9a, 0x05, 0x13, 0xb1,
+    0x96, 0x05, 0x13, 0xa8, 0x92, 0x05, 0x13, 0xa1, 0x9a, 0x05, 0x13, 0x91,
+    0x96, 0x05, 0x13, 0x88, 0x87, 0x05, 0x13, 0x83, 0x02, 0x7b, 0xa4, 0x96,
+    0x05, 0x13, 0x70, 0x8b, 0x05, 0x12, 0x43, 0x02, 0x7b, 0xa8, 0x83, 0x05,
+    0x12, 0x83, 0x02, 0x7b, 0xbb, 0xc2, 0x01, 0x5c, 0x05, 0x12, 0xa3, 0x02,
+    0x7b, 0xc7, 0x91, 0x05, 0x12, 0xc3, 0x02, 0x7b, 0xd3, 0x87, 0x05, 0x12,
+    0xda, 0x02, 0x7b, 0xdf, 0x8b, 0x05, 0x04, 0x9b, 0x02, 0x7b, 0xe7, 0x83,
+    0x05, 0x04, 0xd3, 0x02, 0x7b, 0xfa, 0x97, 0x05, 0x05, 0x2b, 0x02, 0x7c,
+    0x06, 0x91, 0x05, 0x05, 0x0b, 0x02, 0x7c, 0x20, 0x9b, 0x05, 0x05, 0x52,
+    0x02, 0x7c, 0x2c, 0x8b, 0x05, 0x0b, 0x53, 0x02, 0x7c, 0x3b, 0x83, 0x05,
+    0x0b, 0x93, 0x02, 0x7c, 0x4e, 0x17, 0xc2, 0x7c, 0x5a, 0x11, 0xc2, 0x7c,
+    0x65, 0x87, 0x05, 0x0b, 0xd2, 0x02, 0x7c, 0x71, 0x8b, 0x05, 0x0c, 0xcb,
+    0x02, 0x7c, 0x79, 0x83, 0x05, 0x0d, 0x03, 0x02, 0x7c, 0x8c, 0x97, 0x05,
+    0x0d, 0x6b, 0x02, 0x7c, 0x98, 0x91, 0x05, 0x0d, 0x33, 0x02, 0x7c, 0xb2,
+    0x87, 0x05, 0x0d, 0x4b, 0x02, 0x7c, 0xba, 0x9b, 0x05, 0x0d, 0x9a, 0x02,
+    0x7c, 0xc2, 0x87, 0x05, 0x11, 0xf3, 0x02, 0x7c, 0xd5, 0x91, 0x05, 0x11,
+    0xdb, 0x02, 0x7c, 0xdd, 0x97, 0x05, 0x12, 0x13, 0x02, 0x7c, 0xe9, 0x83,
+    0x05, 0x11, 0xa3, 0x02, 0x7d, 0x03, 0xc2, 0x01, 0xac, 0x05, 0x11, 0x8a,
+    0x02, 0x7d, 0x0f, 0x96, 0x05, 0x05, 0x71, 0x9a, 0x05, 0x05, 0x79, 0x92,
+    0x05, 0x05, 0x89, 0x87, 0x05, 0x05, 0x9a, 0x02, 0x7d, 0x13, 0x96, 0x05,
+    0x05, 0xa9, 0x9a, 0x05, 0x05, 0xb1, 0x92, 0x05, 0x05, 0xc0, 0x91, 0x05,
+    0x05, 0xdb, 0x02, 0x7d, 0x1b, 0x96, 0x05, 0x06, 0x19, 0x9a, 0x05, 0x06,
+    0x21, 0x92, 0x05, 0x06, 0x31, 0x94, 0x05, 0x06, 0x42, 0x02, 0x7d, 0x27,
+    0x96, 0x05, 0x05, 0xe9, 0x9a, 0x05, 0x05, 0xf1, 0x92, 0x05, 0x06, 0x00,
+    0x9a, 0x05, 0x06, 0x08, 0x96, 0x05, 0x06, 0x49, 0x9a, 0x05, 0x06, 0x51,
+    0x92, 0x05, 0x06, 0x60, 0x97, 0x05, 0x11, 0x63, 0x02, 0x7d, 0x2b, 0x91,
+    0x05, 0x11, 0x23, 0x02, 0x7d, 0x45, 0x87, 0x05, 0x11, 0x43, 0x02, 0x7d,
+    0x51, 0x8b, 0x05, 0x10, 0xb3, 0x02, 0x7d, 0x5d, 0x83, 0x05, 0x10, 0xe2,
+    0x02, 0x7d, 0x6c, 0x96, 0x05, 0x0e, 0xd1, 0x9a, 0x05, 0x0e, 0xd9, 0x92,
+    0x05, 0x0e, 0xe9, 0x87, 0x05, 0x0f, 0x02, 0x02, 0x7d, 0x78, 0x96, 0x05,
+    0x0f, 0x11, 0x9a, 0x05, 0x0f, 0x19, 0x92, 0x05, 0x0f, 0x28, 0x91, 0x05,
+    0x0f, 0x43, 0x02, 0x7d, 0x84, 0x96, 0x05, 0x0f, 0x91, 0x9a, 0x05, 0x0f,
+    0x99, 0x92, 0x05, 0x0f, 0xa9, 0x94, 0x05, 0x0f, 0xba, 0x02, 0x7d, 0x90,
+    0x96, 0x05, 0x0f, 0x51, 0x9a, 0x05, 0x0f, 0x59, 0x92, 0x05, 0x0f, 0x68,
+    0x96, 0x05, 0x0f, 0x71, 0x9a, 0x05, 0x0f, 0x79, 0x92, 0x05, 0x0f, 0x88,
+    0x96, 0x05, 0x22, 0xe9, 0x9a, 0x05, 0x22, 0xf1, 0x92, 0x05, 0x23, 0x01,
+    0x87, 0x05, 0x23, 0x1a, 0x02, 0x7d, 0x94, 0x9a, 0x05, 0x23, 0x28, 0x96,
+    0x05, 0x23, 0x39, 0x9a, 0x05, 0x23, 0x41, 0x92, 0x05, 0x23, 0x50, 0x96,
+    0x05, 0x23, 0x59, 0x9a, 0x05, 0x23, 0x61, 0x92, 0x05, 0x23, 0x71, 0x94,
+    0x05, 0x23, 0x82, 0x02, 0x7d, 0xa0, 0x96, 0x05, 0x23, 0x89, 0x9a, 0x05,
+    0x23, 0x91, 0x92, 0x05, 0x23, 0xa1, 0x87, 0x05, 0x23, 0xba, 0x02, 0x7d,
+    0xa4, 0x91, 0x05, 0x23, 0xdb, 0x02, 0x7d, 0xb0, 0x96, 0x05, 0x24, 0x09,
+    0x9a, 0x05, 0x24, 0x11, 0x92, 0x05, 0x24, 0x21, 0x94, 0x05, 0x24, 0x32,
+    0x02, 0x7d, 0xbc, 0x96, 0x05, 0x23, 0xe9, 0x9a, 0x05, 0x23, 0xf1, 0x92,
+    0x05, 0x24, 0x00, 0x96, 0x05, 0x24, 0x39, 0x9a, 0x05, 0x24, 0x41, 0x92,
+    0x05, 0x24, 0x51, 0x94, 0x05, 0x24, 0x62, 0x02, 0x7d, 0xc0, 0xcc, 0x1a,
+    0x5a, 0x05, 0x00, 0xa8, 0x96, 0x05, 0x00, 0x21, 0x9a, 0x05, 0x00, 0x29,
+    0x92, 0x05, 0x00, 0x38, 0x96, 0x05, 0x00, 0xb1, 0x9a, 0x05, 0x00, 0xb9,
+    0x92, 0x05, 0x00, 0xc9, 0x87, 0x05, 0x00, 0xe2, 0x02, 0x7d, 0xc4, 0x96,
+    0x05, 0x00, 0xf1, 0x9a, 0x05, 0x00, 0xf9, 0x92, 0x05, 0x01, 0x08, 0x91,
+    0x05, 0x01, 0x1b, 0x02, 0x7d, 0xd0, 0x96, 0x05, 0x01, 0x61, 0x9a, 0x05,
+    0x01, 0x69, 0x92, 0x05, 0x01, 0x79, 0x94, 0x05, 0x01, 0x8a, 0x02, 0x7d,
+    0xd8, 0x96, 0x05, 0x01, 0x29, 0x9a, 0x05, 0x01, 0x31, 0x92, 0x05, 0x01,
+    0x40, 0x9a, 0x05, 0x01, 0x49, 0x92, 0x05, 0x01, 0x58, 0x96, 0x05, 0x01,
+    0x91, 0x9a, 0x05, 0x01, 0x99, 0x92, 0x05, 0x01, 0xa9, 0x94, 0x05, 0x01,
+    0xba, 0x02, 0x7d, 0xdc, 0x8b, 0x05, 0x02, 0xc3, 0x02, 0x7d, 0xe0, 0x83,
+    0x05, 0x03, 0x03, 0x02, 0x7d, 0xf3, 0x97, 0x05, 0x03, 0x73, 0x02, 0x7d,
+    0xff, 0x91, 0x05, 0x03, 0x3b, 0x02, 0x7e, 0x19, 0x87, 0x05, 0x03, 0x53,
+    0x02, 0x7e, 0x25, 0x9b, 0x05, 0x03, 0xa2, 0x02, 0x7e, 0x2d, 0x96, 0x05,
+    0x01, 0xc1, 0x9a, 0x05, 0x01, 0xc9, 0x92, 0x05, 0x01, 0xd9, 0x87, 0x05,
+    0x01, 0xea, 0x02, 0x7e, 0x39, 0x96, 0x05, 0x01, 0xf9, 0x9a, 0x05, 0x02,
+    0x01, 0x92, 0x05, 0x02, 0x10, 0x91, 0x05, 0x02, 0x23, 0x02, 0x7e, 0x41,
+    0x96, 0x05, 0x02, 0x51, 0x9a, 0x05, 0x02, 0x59, 0x92, 0x05, 0x02, 0x69,
+    0x94, 0x05, 0x02, 0x7a, 0x02, 0x7e, 0x49, 0x96, 0x05, 0x02, 0x31, 0x9a,
+    0x05, 0x02, 0x39, 0x92, 0x05, 0x02, 0x48, 0x96, 0x05, 0x02, 0x81, 0x9a,
+    0x05, 0x02, 0x89, 0x92, 0x05, 0x02, 0x99, 0x94, 0x05, 0x02, 0xaa, 0x02,
+    0x7e, 0x4d, 0x96, 0x05, 0x06, 0x69, 0x9a, 0x05, 0x06, 0x71, 0x92, 0x05,
+    0x06, 0x80, 0x96, 0x05, 0x06, 0x89, 0x9a, 0x05, 0x06, 0x91, 0x92, 0x05,
+    0x06, 0xa0, 0x9a, 0x05, 0x06, 0xa9, 0x92, 0x05, 0x06, 0xb8, 0x96, 0x05,
+    0x06, 0xc1, 0x9a, 0x05, 0x06, 0xc9, 0x92, 0x05, 0x06, 0xd9, 0x94, 0x05,
+    0x06, 0xea, 0x02, 0x7e, 0x51, 0x96, 0x05, 0x06, 0xf1, 0x9a, 0x05, 0x06,
+    0xf9, 0x92, 0x05, 0x07, 0x08, 0x96, 0x05, 0x07, 0x11, 0x9a, 0x05, 0x07,
+    0x19, 0x92, 0x05, 0x07, 0x29, 0x87, 0x05, 0x07, 0x42, 0x02, 0x7e, 0x55,
+    0x96, 0x05, 0x07, 0x51, 0x9a, 0x05, 0x07, 0x59, 0x92, 0x05, 0x07, 0x68,
+    0x96, 0x05, 0x07, 0x71, 0x9a, 0x05, 0x07, 0x79, 0x92, 0x05, 0x07, 0x88,
+    0x9a, 0x05, 0x07, 0x91, 0x92, 0x05, 0x07, 0x98, 0x96, 0x05, 0x07, 0xa1,
+    0x9a, 0x05, 0x07, 0xa9, 0x92, 0x05, 0x07, 0xb9, 0x94, 0x05, 0x07, 0xca,
+    0x02, 0x7e, 0x61, 0x96, 0x05, 0x07, 0xd1, 0x9a, 0x05, 0x07, 0xd9, 0x92,
+    0x05, 0x07, 0xe9, 0x94, 0x05, 0x07, 0xfa, 0x02, 0x7e, 0x65, 0x96, 0x05,
+    0x08, 0x01, 0x9a, 0x05, 0x08, 0x09, 0x92, 0x05, 0x08, 0x19, 0x87, 0x05,
+    0x08, 0x2a, 0x02, 0x7e, 0x69, 0x96, 0x05, 0x08, 0x39, 0x9a, 0x05, 0x08,
+    0x41, 0x92, 0x05, 0x08, 0x50, 0x91, 0x05, 0x08, 0x63, 0x02, 0x7e, 0x71,
+    0x96, 0x05, 0x08, 0xa1, 0x9a, 0x05, 0x08, 0xa9, 0x92, 0x05, 0x08, 0xb9,
+    0x94, 0x05, 0x08, 0xca, 0x02, 0x7e, 0x75, 0x96, 0x05, 0x08, 0x69, 0x9a,
+    0x05, 0x08, 0x71, 0x92, 0x05, 0x08, 0x80, 0x9a, 0x05, 0x08, 0x89, 0x92,
+    0x05, 0x08, 0x98, 0x8b, 0x05, 0x09, 0xc3, 0x02, 0x7e, 0x79, 0x83, 0x05,
+    0x09, 0xfb, 0x02, 0x7e, 0x8c, 0x97, 0x05, 0x0a, 0x6b, 0x02, 0x7e, 0x98,
+    0x91, 0x05, 0x0a, 0x33, 0x02, 0x7e, 0xb2, 0x87, 0x05, 0x0a, 0x4a, 0x02,
+    0x7e, 0xbe, 0x96, 0x05, 0x08, 0xd1, 0x9a, 0x05, 0x08, 0xd9, 0x92, 0x05,
+    0x08, 0xe9, 0x87, 0x05, 0x08, 0xfa, 0x02, 0x7e, 0xc6, 0x96, 0x05, 0x09,
+    0x09, 0x9a, 0x05, 0x09, 0x11, 0x92, 0x05, 0x09, 0x20, 0x91, 0x05, 0x09,
+    0x3b, 0x02, 0x7e, 0xce, 0x96, 0x05, 0x09, 0x81, 0x9a, 0x05, 0x09, 0x89,
+    0x92, 0x05, 0x09, 0x99, 0x94, 0x05, 0x09, 0xaa, 0x02, 0x7e, 0xda, 0x96,
+    0x05, 0x09, 0x49, 0x9a, 0x05, 0x09, 0x51, 0x92, 0x05, 0x09, 0x60, 0x9a,
+    0x05, 0x09, 0x69, 0x92, 0x05, 0x09, 0x78, 0x96, 0x05, 0x0d, 0xb9, 0x9a,
+    0x05, 0x0d, 0xc1, 0x92, 0x05, 0x0d, 0xd1, 0x87, 0x05, 0x0d, 0xea, 0x02,
+    0x7e, 0xde, 0x96, 0x05, 0x0d, 0xf9, 0x9a, 0x05, 0x0e, 0x01, 0x92, 0x05,
+    0x0e, 0x10, 0x91, 0x05, 0x0e, 0x2b, 0x02, 0x7e, 0xea, 0x96, 0x05, 0x0e,
+    0x71, 0x9a, 0x05, 0x0e, 0x79, 0x92, 0x05, 0x0e, 0x89, 0x94, 0x05, 0x0e,
+    0x9a, 0x02, 0x7e, 0xf6, 0x96, 0x05, 0x0e, 0x39, 0x9a, 0x05, 0x0e, 0x41,
+    0x92, 0x05, 0x0e, 0x50, 0x9a, 0x05, 0x0e, 0x59, 0x92, 0x05, 0x0e, 0x68,
+    0x96, 0x05, 0x0e, 0xa1, 0x9a, 0x05, 0x0e, 0xa9, 0x92, 0x05, 0x0e, 0xb9,
+    0x94, 0x05, 0x0e, 0xca, 0x02, 0x7e, 0xfa, 0x96, 0x05, 0x0f, 0xc1, 0x9a,
+    0x05, 0x0f, 0xc9, 0x92, 0x05, 0x0f, 0xd9, 0x87, 0x05, 0x0f, 0xea, 0x02,
+    0x7e, 0xfe, 0x96, 0x05, 0x0f, 0xf9, 0x9a, 0x05, 0x10, 0x01, 0x92, 0x05,
+    0x10, 0x10, 0x91, 0x05, 0x10, 0x23, 0x02, 0x7f, 0x06, 0x96, 0x05, 0x10,
+    0x71, 0x9a, 0x05, 0x10, 0x79, 0x92, 0x05, 0x10, 0x89, 0x94, 0x05, 0x10,
+    0x9a, 0x02, 0x7f, 0x0e, 0x96, 0x05, 0x10, 0x31, 0x9a, 0x05, 0x10, 0x39,
+    0x92, 0x05, 0x10, 0x48, 0x96, 0x05, 0x10, 0x51, 0x9a, 0x05, 0x10, 0x59,
+    0x92, 0x05, 0x10, 0x68, 0x87, 0x05, 0x25, 0xd8, 0xc2, 0x02, 0x13, 0x05,
+    0x24, 0x99, 0xc2, 0x00, 0x11, 0x05, 0x25, 0x38, 0x92, 0x05, 0x24, 0xa1,
+    0x96, 0x05, 0x25, 0x18, 0x9b, 0x05, 0x25, 0x81, 0xc2, 0x00, 0x35, 0x05,
+    0x25, 0xd1, 0xc2, 0x01, 0x17, 0x05, 0x26, 0x01, 0xc2, 0x00, 0x11, 0x05,
+    0x26, 0x10, 0xc2, 0x00, 0x11, 0x05, 0x24, 0xb1, 0xc2, 0x01, 0x5c, 0x05,
+    0x25, 0x30, 0xc2, 0x00, 0x93, 0x05, 0x24, 0xc9, 0xc2, 0x01, 0x5c, 0x05,
+    0x24, 0xf9, 0xc2, 0x00, 0x11, 0x05, 0x25, 0xf8, 0x92, 0x05, 0x25, 0x11,
+    0x94, 0x05, 0x26, 0x08, 0xc2, 0x06, 0x4d, 0x05, 0x25, 0x51, 0x9b, 0x05,
+    0x25, 0xa9, 0xc2, 0x01, 0xac, 0x05, 0x25, 0xb8, 0x8e, 0x08, 0x74, 0x60,
+    0xc3, 0x33, 0x78, 0x08, 0x74, 0x41, 0xc2, 0x00, 0xf0, 0x08, 0x74, 0x38,
+    0x90, 0x05, 0x28, 0x08, 0x87, 0x05, 0x28, 0x11, 0x90, 0x05, 0x2f, 0x28,
+    0x90, 0x05, 0x29, 0x38, 0x90, 0x05, 0x2a, 0x68, 0x91, 0x05, 0x2b, 0x99,
+    0x90, 0x05, 0x2d, 0xf0, 0x90, 0x05, 0x2c, 0xc0, 0x87, 0x05, 0x28, 0x1b,
+    0x02, 0x7f, 0x12, 0x90, 0x05, 0x2f, 0x38, 0x90, 0x05, 0x29, 0x48, 0x90,
+    0x05, 0x2a, 0x78, 0x91, 0x05, 0x2b, 0xa3, 0x02, 0x7f, 0x16, 0x90, 0x05,
+    0x2e, 0x00, 0x90, 0x05, 0x2c, 0xd0, 0x87, 0x05, 0x28, 0x28, 0x91, 0x05,
+    0x2b, 0xb0, 0x87, 0x05, 0x2f, 0x4b, 0x02, 0x7f, 0x1a, 0x8b, 0x05, 0x29,
+    0x59, 0x83, 0x05, 0x2a, 0x89, 0x91, 0x05, 0x2e, 0x13, 0x02, 0x7f, 0x1e,
+    0x97, 0x05, 0x2c, 0xe0, 0x87, 0x05, 0x28, 0x38, 0x91, 0x05, 0x2b, 0xc0,
+    0x87, 0x05, 0x2f, 0x5b, 0x02, 0x7f, 0x22, 0x8b, 0x05, 0x29, 0x69, 0x83,
+    0x05, 0x2a, 0x99, 0x91, 0x05, 0x2e, 0x23, 0x02, 0x7f, 0x26, 0x97, 0x05,
+    0x2c, 0xf0, 0x87, 0x05, 0x2f, 0x73, 0x02, 0x7f, 0x2a, 0x8b, 0x05, 0x29,
+    0x79, 0x83, 0x05, 0x2a, 0xb1, 0x91, 0x05, 0x2e, 0x33, 0x02, 0x7f, 0x2e,
+    0x97, 0x05, 0x2d, 0x00, 0x87, 0x05, 0x29, 0x08, 0x91, 0x05, 0x2c, 0x90,
+    0x87, 0x05, 0x2f, 0x63, 0x02, 0x7f, 0x32, 0x8b, 0x05, 0x29, 0x71, 0x83,
+    0x05, 0x2a, 0xa3, 0x02, 0x7f, 0x3a, 0x91, 0x05, 0x2e, 0x2b, 0x02, 0x7f,
+    0x3e, 0x97, 0x05, 0x2c, 0xf8, 0x87, 0x05, 0x28, 0xf0, 0x90, 0x05, 0x2b,
+    0x58, 0x91, 0x05, 0x2c, 0x78, 0x87, 0x05, 0x2f, 0x7b, 0x02, 0x7f, 0x42,
+    0x8b, 0x05, 0x29, 0x81, 0x83, 0x05, 0x2a, 0xb9, 0x91, 0x05, 0x2e, 0x3b,
+    0x02, 0x7f, 0x4a, 0x97, 0x05, 0x2d, 0x08, 0x87, 0x05, 0x29, 0x01, 0x90,
+    0x05, 0x30, 0x38, 0x91, 0x05, 0x2c, 0x88, 0x87, 0x05, 0x28, 0x60, 0x91,
+    0x05, 0x2b, 0xe8, 0x87, 0x05, 0x28, 0x68, 0x91, 0x05, 0x2b, 0xf0, 0x87,
+    0x05, 0x28, 0x70, 0x87, 0x05, 0x2f, 0xa3, 0x02, 0x7f, 0x52, 0x8b, 0x05,
+    0x29, 0xa1, 0x83, 0x05, 0x2a, 0xd9, 0x91, 0x05, 0x2e, 0x63, 0x02, 0x7f,
+    0x56, 0x97, 0x05, 0x2d, 0x28, 0x91, 0x05, 0x2b, 0xf8, 0x87, 0x05, 0x2f,
+    0xab, 0x02, 0x7f, 0x5a, 0x0a, 0xc2, 0x7f, 0x5e, 0x8b, 0x05, 0x29, 0xa9,
+    0x83, 0x05, 0x2a, 0xe1, 0x91, 0x05, 0x2e, 0x6b, 0x02, 0x7f, 0x78, 0x97,
+    0x05, 0x2d, 0x30, 0x87, 0x05, 0x28, 0xa0, 0x91, 0x05, 0x2c, 0x28, 0x87,
+    0x05, 0x28, 0x91, 0xc8, 0x48, 0x2f, 0x05, 0x30, 0x60, 0x91, 0x05, 0x2c,
+    0x18, 0x87, 0x05, 0x28, 0x98, 0x91, 0x05, 0x2c, 0x20, 0x87, 0x05, 0x2f,
+    0xd3, 0x02, 0x7f, 0x7c, 0x8b, 0x05, 0x29, 0xd1, 0x83, 0x05, 0x2b, 0x09,
+    0x91, 0x05, 0x2e, 0x93, 0x02, 0x7f, 0x80, 0x97, 0x05, 0x2d, 0x58, 0x87,
+    0x05, 0x30, 0x0b, 0x02, 0x7f, 0x8a, 0x8b, 0x05, 0x2a, 0x09, 0x83, 0x05,
+    0x2b, 0x41, 0x91, 0x05, 0x2e, 0xcb, 0x02, 0x7f, 0x8e, 0x97, 0x05, 0x2d,
+    0x90, 0x09, 0xc2, 0x7f, 0x92, 0xc2, 0x00, 0x6b, 0x05, 0x2a, 0x59, 0xc2,
+    0x00, 0x47, 0x05, 0x2d, 0xe1, 0xc2, 0x00, 0x79, 0x05, 0x2f, 0x18, 0x87,
+    0x05, 0x29, 0x10, 0x87, 0x05, 0x30, 0x53, 0x02, 0x7f, 0xac, 0x8b, 0x05,
+    0x2a, 0x41, 0x83, 0x05, 0x2b, 0x81, 0x91, 0x05, 0x2f, 0x03, 0x02, 0x7f,
+    0xb0, 0x97, 0x05, 0x2d, 0xc8, 0x91, 0x05, 0x2c, 0x98, 0x87, 0x05, 0x28,
+    0xb0, 0x87, 0x05, 0x2f, 0xe3, 0x02, 0x7f, 0xb4, 0x8b, 0x05, 0x29, 0xe1,
+    0x83, 0x05, 0x2b, 0x19, 0x91, 0x05, 0x2e, 0xa3, 0x02, 0x7f, 0xb8, 0x97,
+    0x05, 0x2d, 0x68, 0x91, 0x05, 0x2c, 0x38, 0x87, 0x05, 0x28, 0xc0, 0x87,
+    0x05, 0x2f, 0xf3, 0x02, 0x7f, 0xbc, 0x8b, 0x05, 0x29, 0xf1, 0x83, 0x05,
+    0x2b, 0x29, 0x91, 0x05, 0x2e, 0xb3, 0x02, 0x7f, 0xc0, 0x97, 0x05, 0x2d,
+    0x78, 0x91, 0x05, 0x2c, 0x48, 0x87, 0x05, 0x28, 0xd0, 0x91, 0x05, 0x2c,
+    0x58, 0x87, 0x05, 0x28, 0xd8, 0x91, 0x05, 0x2c, 0x60, 0x87, 0x05, 0x28,
+    0xe8, 0x91, 0x05, 0x2c, 0x70, 0x90, 0x05, 0x2b, 0x90, 0xc3, 0x01, 0x0a,
+    0x05, 0x30, 0xd9, 0xc2, 0x4a, 0xc3, 0x05, 0x30, 0xf0, 0xca, 0x3e, 0x00,
+    0x01, 0x1b, 0xf9, 0x47, 0x00, 0x7c, 0x42, 0x7f, 0xc4, 0xc4, 0xae, 0x76,
+    0x00, 0x04, 0x50, 0xca, 0x94, 0xae, 0x01, 0x81, 0x99, 0xca, 0x04, 0x2a,
+    0x01, 0x81, 0xa8, 0xca, 0x9f, 0xa2, 0x00, 0xe7, 0x60, 0xce, 0x22, 0x37,
+    0x70, 0x02, 0xd9, 0xcb, 0x1a, 0x38, 0x70, 0x01, 0x41, 0xcd, 0x00, 0x34,
+    0x70, 0x03, 0xd8, 0x9c, 0x70, 0x02, 0xd1, 0x9b, 0x70, 0x02, 0xc9, 0x9a,
+    0x70, 0x02, 0xc1, 0x99, 0x70, 0x02, 0xb9, 0x98, 0x70, 0x02, 0xb1, 0x97,
+    0x70, 0x02, 0xa9, 0x96, 0x70, 0x02, 0xa1, 0x95, 0x70, 0x02, 0x99, 0x94,
+    0x70, 0x02, 0x91, 0x93, 0x70, 0x02, 0x89, 0x92, 0x70, 0x02, 0x81, 0x91,
+    0x70, 0x02, 0x79, 0x90, 0x70, 0x02, 0x71, 0x8f, 0x70, 0x02, 0x69, 0x8e,
+    0x70, 0x02, 0x61, 0x8d, 0x70, 0x02, 0x59, 0x8c, 0x70, 0x02, 0x51, 0x8b,
+    0x70, 0x02, 0x49, 0x8a, 0x70, 0x02, 0x41, 0x89, 0x70, 0x02, 0x39, 0x88,
+    0x70, 0x02, 0x31, 0x87, 0x70, 0x02, 0x29, 0x86, 0x70, 0x02, 0x21, 0x85,
+    0x70, 0x02, 0x19, 0x84, 0x70, 0x02, 0x11, 0x83, 0x70, 0x02, 0x08, 0x9c,
+    0x70, 0x03, 0xd1, 0x9b, 0x70, 0x03, 0xc9, 0x9a, 0x70, 0x03, 0xc1, 0x99,
+    0x70, 0x03, 0xb9, 0x98, 0x70, 0x03, 0xb1, 0x97, 0x70, 0x03, 0xa9, 0x96,
+    0x70, 0x03, 0xa1, 0x95, 0x70, 0x03, 0x99, 0x94, 0x70, 0x03, 0x91, 0x93,
+    0x70, 0x03, 0x89, 0x92, 0x70, 0x03, 0x81, 0x91, 0x70, 0x03, 0x79, 0x90,
+    0x70, 0x03, 0x71, 0x8f, 0x70, 0x03, 0x69, 0x8e, 0x70, 0x03, 0x61, 0x8d,
+    0x70, 0x03, 0x59, 0x8c, 0x70, 0x03, 0x51, 0x8b, 0x70, 0x03, 0x49, 0x8a,
+    0x70, 0x03, 0x41, 0x89, 0x70, 0x03, 0x39, 0x88, 0x70, 0x03, 0x31, 0x87,
+    0x70, 0x03, 0x29, 0x86, 0x70, 0x03, 0x21, 0x85, 0x70, 0x03, 0x19, 0x84,
+    0x70, 0x03, 0x11, 0x83, 0x70, 0x03, 0x08, 0xc9, 0xad, 0x6c, 0x70, 0x02,
+    0x01, 0x83, 0x70, 0x01, 0x60, 0xc4, 0x17, 0xf7, 0x70, 0x01, 0xb9, 0xc2,
+    0x24, 0x36, 0x70, 0x01, 0xb0, 0xc3, 0x0c, 0xf7, 0x70, 0x01, 0xa9, 0xc3,
+    0x04, 0xa0, 0x70, 0x01, 0xa0, 0xc4, 0x03, 0xe0, 0x70, 0x01, 0x99, 0xc2,
+    0x01, 0xa2, 0x70, 0x01, 0x90, 0x25, 0xc2, 0x7f, 0xd0, 0x24, 0xc2, 0x7f,
+    0xf4, 0x23, 0xc2, 0x80, 0x1c, 0x22, 0xc2, 0x80, 0x44, 0x21, 0xc2, 0x80,
+    0x6c, 0x20, 0xc2, 0x80, 0x94, 0x1f, 0x42, 0x80, 0xbc, 0x28, 0xc2, 0x80,
+    0xe4, 0x27, 0xc2, 0x81, 0x0c, 0x26, 0xc2, 0x81, 0x34, 0x25, 0xc2, 0x81,
+    0x5c, 0x24, 0xc2, 0x81, 0x84, 0x23, 0xc2, 0x81, 0xac, 0x22, 0xc2, 0x81,
+    0xd4, 0x21, 0xc2, 0x81, 0xfc, 0x20, 0xc2, 0x82, 0x24, 0x1f, 0x42, 0x82,
+    0x4c, 0x28, 0xc2, 0x82, 0x74, 0x27, 0xc2, 0x82, 0x9c, 0x26, 0xc2, 0x82,
+    0xc4, 0x25, 0xc2, 0x82, 0xec, 0x24, 0xc2, 0x83, 0x14, 0x23, 0xc2, 0x83,
+    0x3c, 0x22, 0xc2, 0x83, 0x64, 0x21, 0xc2, 0x83, 0x8c, 0x20, 0xc2, 0x83,
+    0xb4, 0x1f, 0x42, 0x83, 0xdc, 0x28, 0xc2, 0x84, 0x04, 0x27, 0xc2, 0x84,
+    0x2c, 0x26, 0xc2, 0x84, 0x54, 0x25, 0xc2, 0x84, 0x7c, 0x24, 0xc2, 0x84,
+    0xa4, 0x23, 0xc2, 0x84, 0xcc, 0x22, 0xc2, 0x84, 0xf4, 0x21, 0xc2, 0x85,
+    0x1c, 0x20, 0xc2, 0x85, 0x44, 0x1f, 0x42, 0x85, 0x6c, 0x28, 0xc2, 0x85,
+    0x94, 0x27, 0xc2, 0x85, 0xbc, 0x26, 0xc2, 0x85, 0xe4, 0x25, 0xc2, 0x86,
+    0x0c, 0x24, 0xc2, 0x86, 0x34, 0x23, 0xc2, 0x86, 0x5c, 0x22, 0xc2, 0x86,
+    0x84, 0x21, 0xc2, 0x86, 0xac, 0x20, 0xc2, 0x86, 0xd4, 0x1f, 0x42, 0x86,
+    0xfc, 0x28, 0xc2, 0x87, 0x24, 0x27, 0xc2, 0x87, 0x4c, 0x26, 0xc2, 0x87,
+    0x74, 0x25, 0xc2, 0x87, 0x9c, 0x24, 0xc2, 0x87, 0xc4, 0x23, 0xc2, 0x87,
+    0xec, 0x22, 0xc2, 0x88, 0x14, 0x21, 0xc2, 0x88, 0x3c, 0x20, 0xc2, 0x88,
+    0x64, 0x1f, 0x42, 0x88, 0x8c, 0x28, 0xc2, 0x88, 0xb4, 0x27, 0xc2, 0x88,
+    0xdc, 0x26, 0xc2, 0x89, 0x04, 0x25, 0xc2, 0x89, 0x2c, 0x24, 0xc2, 0x89,
+    0x54, 0x23, 0xc2, 0x89, 0x7c, 0x22, 0xc2, 0x89, 0xa4, 0x21, 0xc2, 0x89,
+    0xcc, 0x20, 0xc2, 0x89, 0xf4, 0x1f, 0x42, 0x8a, 0x1c, 0x28, 0xc2, 0x8a,
+    0x44, 0x27, 0xc2, 0x8a, 0x6c, 0x26, 0xc2, 0x8a, 0x94, 0x25, 0xc2, 0x8a,
+    0xbc, 0x24, 0xc2, 0x8a, 0xe4, 0x23, 0xc2, 0x8b, 0x0c, 0x22, 0xc2, 0x8b,
+    0x34, 0x21, 0xc2, 0x8b, 0x5c, 0x20, 0xc2, 0x8b, 0x84, 0x1f, 0x42, 0x8b,
+    0xac, 0xc4, 0x17, 0xf7, 0x0b, 0x56, 0x39, 0xc2, 0x24, 0x36, 0x0b, 0x56,
+    0x30, 0xc3, 0x0c, 0xf7, 0x0b, 0x56, 0x29, 0xc3, 0x04, 0xa0, 0x0b, 0x56,
+    0x20, 0xc4, 0x03, 0xe0, 0x0b, 0x56, 0x19, 0xc2, 0x01, 0xa2, 0x0b, 0x56,
+    0x10, 0xc2, 0x00, 0xce, 0x0b, 0x55, 0xe9, 0x83, 0x0b, 0x55, 0xa8, 0xc2,
+    0x00, 0xce, 0x0b, 0x55, 0xe1, 0x83, 0x0b, 0x55, 0x88, 0x83, 0x0b, 0x55,
+    0xd9, 0xc7, 0xb2, 0x86, 0x0b, 0x54, 0x80, 0xc2, 0x00, 0xce, 0x0b, 0x55,
+    0xc9, 0xc2, 0x0d, 0x01, 0x0b, 0x55, 0xb1, 0x83, 0x0b, 0x55, 0x80, 0x16,
+    0xc2, 0x8b, 0xd0, 0x83, 0x0b, 0x55, 0x68, 0xc2, 0x00, 0xce, 0x0b, 0x55,
+    0xb9, 0x83, 0x0b, 0x55, 0x10, 0x0a, 0xc2, 0x8b, 0xda, 0x83, 0x0b, 0x55,
+    0x20, 0xc2, 0x00, 0xce, 0x0b, 0x55, 0x99, 0x83, 0x0b, 0x55, 0x61, 0xc2,
+    0x1a, 0x18, 0x0b, 0x55, 0x41, 0xc2, 0x00, 0xeb, 0x0b, 0x55, 0x18, 0x83,
+    0x0b, 0x55, 0x71, 0xc7, 0xc0, 0x2a, 0x0b, 0x54, 0x88, 0x83, 0x0b, 0x55,
+    0x59, 0x9a, 0x0b, 0x54, 0xf9, 0x93, 0x0b, 0x54, 0xf1, 0x85, 0x0b, 0x54,
+    0xe9, 0x9c, 0x0b, 0x54, 0xe0, 0xc2, 0x00, 0xce, 0x0b, 0x55, 0x49, 0x83,
+    0x0b, 0x55, 0x38, 0xc2, 0x00, 0xce, 0x0b, 0x55, 0x09, 0x83, 0x0b, 0x55,
+    0x00, 0x0b, 0xc2, 0x8b, 0xe4, 0x07, 0xc2, 0x8b, 0xf8, 0x9a, 0x0b, 0x54,
+    0x39, 0x93, 0x0b, 0x54, 0x31, 0x85, 0x0b, 0x54, 0x29, 0x9c, 0x0b, 0x54,
+    0x20, 0x19, 0xc2, 0x8c, 0x08, 0x9a, 0x0b, 0x53, 0xb9, 0x93, 0x0b, 0x53,
+    0xb1, 0x85, 0x0b, 0x53, 0xa9, 0x9c, 0x0b, 0x53, 0xa0, 0x9a, 0x0b, 0x54,
+    0x19, 0x93, 0x0b, 0x54, 0x11, 0x85, 0x0b, 0x54, 0x09, 0x9c, 0x0b, 0x54,
+    0x00, 0x9a, 0x0b, 0x53, 0xf9, 0x93, 0x0b, 0x53, 0xf1, 0x85, 0x0b, 0x53,
+    0xe9, 0x9c, 0x0b, 0x53, 0xe0, 0x9a, 0x0b, 0x53, 0xd9, 0x93, 0x0b, 0x53,
+    0xd1, 0x85, 0x0b, 0x53, 0xc9, 0x9c, 0x0b, 0x53, 0xc0, 0x9a, 0x0b, 0x53,
+    0x99, 0x93, 0x0b, 0x53, 0x91, 0x85, 0x0b, 0x53, 0x89, 0x9c, 0x0b, 0x53,
+    0x80, 0x03, 0xc2, 0x8c, 0x18, 0xc3, 0x13, 0xa6, 0x08, 0xff, 0x19, 0x0b,
+    0x42, 0x8c, 0x24, 0xc7, 0xc3, 0x80, 0x08, 0xff, 0x81, 0xc7, 0xc7, 0xe7,
+    0x08, 0xfe, 0xe1, 0xc9, 0xae, 0x8c, 0x08, 0xfe, 0xc8, 0x17, 0xc2, 0x8c,
+    0x30, 0xc4, 0xe0, 0x3c, 0x08, 0xfe, 0xe8, 0x03, 0xc2, 0x8c, 0x3c, 0xc2,
+    0x00, 0x47, 0x08, 0xfe, 0xf8, 0xc8, 0xbc, 0xe8, 0x08, 0xfe, 0xb9, 0xc7,
+    0x14, 0x03, 0x00, 0x5c, 0x10, 0x83, 0x00, 0x5c, 0x31, 0x8b, 0x00, 0x5c,
+    0x81, 0x97, 0x00, 0x5c, 0xa0, 0x8b, 0x00, 0x5c, 0x40, 0x97, 0x00, 0x5c,
+    0x50, 0x87, 0x00, 0x5c, 0x78, 0x91, 0x00, 0x5c, 0x98, 0xc2, 0x00, 0xeb,
+    0x00, 0x5c, 0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x5c, 0xf1, 0x10, 0xc2, 0x8c,
+    0x4e, 0x83, 0x00, 0x5d, 0x40, 0xc2, 0x00, 0x51, 0x00, 0x5c, 0xf9, 0x83,
+    0x00, 0x5d, 0x20, 0x83, 0x00, 0x5d, 0x81, 0xc2, 0x00, 0x3b, 0x00, 0x5d,
+    0x88, 0x83, 0x00, 0x5d, 0x91, 0x0e, 0x42, 0x8c, 0x58, 0xc2, 0x00, 0xce,
+    0x00, 0x5d, 0xb1, 0xc2, 0x0d, 0x01, 0x00, 0x5d, 0xb9, 0x83, 0x00, 0x5d,
+    0xc0, 0xc2, 0x01, 0xa2, 0x00, 0x5f, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x5f,
+    0x48, 0xc3, 0x04, 0xa0, 0x00, 0x5f, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x5f,
+    0x58, 0xc2, 0x24, 0x36, 0x00, 0x5f, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x5f,
+    0x68, 0xc6, 0xa2, 0x30, 0x08, 0xfe, 0x71, 0xc9, 0xb1, 0x02, 0x08, 0xfe,
+    0x38, 0xa1, 0x08, 0xfe, 0x91, 0xa0, 0x08, 0xfe, 0x88, 0xc4, 0x9e, 0x5d,
+    0x08, 0xfe, 0x79, 0xc7, 0xc7, 0x93, 0x08, 0xfe, 0x20, 0x8a, 0x08, 0xfe,
+    0x61, 0xc4, 0x1e, 0x1c, 0x08, 0xfe, 0x10, 0xc4, 0x1a, 0x3b, 0x08, 0xfe,
+    0x59, 0xc8, 0x1e, 0x18, 0x08, 0xfe, 0x41, 0x0a, 0x42, 0x8c, 0x62, 0x46,
+    0xd1, 0x9c, 0xc2, 0x8c, 0x6e, 0xc8, 0xb1, 0x02, 0x08, 0xfe, 0x18, 0xc2,
+    0x00, 0xce, 0x08, 0xb4, 0xb9, 0x83, 0x08, 0xb4, 0xb0, 0xc2, 0x00, 0xce,
+    0x08, 0xb4, 0xa9, 0x83, 0x08, 0xb4, 0xa0, 0xc3, 0x74, 0x8e, 0x00, 0xd5,
+    0x58, 0xc3, 0x74, 0x8e, 0x00, 0xd5, 0x48, 0xca, 0x9f, 0x8e, 0x00, 0xd3,
+    0xe1, 0x46, 0x27, 0x2b, 0x42, 0x8c, 0x76, 0xc4, 0x62, 0xe4, 0x00, 0xd2,
+    0xc0, 0x83, 0x00, 0xd2, 0xe1, 0x46, 0x2c, 0x6c, 0x42, 0x8c, 0x82, 0xc5,
+    0x2d, 0x23, 0x00, 0xd2, 0xd1, 0xca, 0xa3, 0xd0, 0x00, 0xd2, 0xb8, 0xc5,
+    0x00, 0xd2, 0x00, 0xd3, 0x99, 0xc5, 0x01, 0x24, 0x00, 0xd3, 0x60, 0x87,
+    0x00, 0xd3, 0x40, 0x87, 0x00, 0xd2, 0x98, 0xc2, 0x00, 0xce, 0x00, 0xd2,
+    0x61, 0xc2, 0x1a, 0x18, 0x00, 0xd1, 0xf9, 0x12, 0xc2, 0x8c, 0x8e, 0xc2,
+    0x04, 0x70, 0x00, 0xd1, 0xe1, 0x16, 0xc2, 0x8c, 0x98, 0xc5, 0x3b, 0xb7,
+    0x00, 0xd1, 0x81, 0x05, 0xc2, 0x8c, 0xa2, 0xc2, 0x0d, 0x01, 0x00, 0xd1,
+    0x51, 0x0d, 0x42, 0x8c, 0xac, 0x83, 0x00, 0xd2, 0x41, 0xc2, 0x0d, 0x01,
+    0x00, 0xd2, 0x39, 0xc2, 0x00, 0xce, 0x00, 0xd2, 0x30, 0xc2, 0x00, 0xce,
+    0x00, 0xd1, 0xc9, 0x83, 0x00, 0xd1, 0xc0, 0xc2, 0x00, 0xce, 0x00, 0xd1,
+    0x99, 0x83, 0x00, 0xd1, 0x90, 0xc2, 0x00, 0xce, 0x00, 0xd1, 0x41, 0x83,
+    0x00, 0xd1, 0x38, 0xc2, 0x66, 0x73, 0x00, 0xd1, 0x11, 0xc2, 0x00, 0xce,
+    0x00, 0xd1, 0x09, 0x83, 0x00, 0xd1, 0x00, 0xc2, 0x03, 0x83, 0x00, 0xd1,
+    0x89, 0xc2, 0x00, 0x51, 0x00, 0xd1, 0x68, 0x83, 0x05, 0x55, 0xc8, 0xc2,
+    0x00, 0x4a, 0x05, 0x54, 0xf9, 0x91, 0x05, 0x54, 0xe8, 0x91, 0x05, 0x54,
+    0xc9, 0xc2, 0x14, 0x10, 0x05, 0x54, 0x49, 0xc2, 0x31, 0xda, 0x05, 0x54,
+    0x88, 0xc2, 0x00, 0x4a, 0x05, 0x54, 0xb9, 0x91, 0x05, 0x54, 0xa8, 0x91,
+    0x05, 0x54, 0x59, 0xc2, 0x00, 0x4a, 0x05, 0x54, 0x68, 0x0a, 0xc2, 0x8c,
+    0xbc, 0x91, 0x05, 0x54, 0x08, 0xc2, 0x00, 0x4a, 0x05, 0x54, 0xf1, 0x91,
+    0x05, 0x54, 0xe0, 0x91, 0x05, 0x54, 0xc1, 0xc2, 0x14, 0x10, 0x05, 0x54,
+    0x41, 0xc2, 0x31, 0xda, 0x05, 0x54, 0x80, 0xc2, 0x00, 0x4a, 0x05, 0x54,
+    0xb1, 0x91, 0x05, 0x54, 0xa0, 0xc2, 0x00, 0x4a, 0x05, 0x54, 0x61, 0x91,
+    0x05, 0x54, 0x50, 0x0a, 0xc2, 0x8c, 0xc6, 0x91, 0x05, 0x54, 0x00, 0xd5,
+    0x01, 0xd4, 0x01, 0x5c, 0xd1, 0xc9, 0x01, 0xe0, 0x01, 0x3d, 0x10, 0xc7,
+    0xb2, 0x48, 0x00, 0x3c, 0x09, 0xc4, 0xe0, 0x94, 0x00, 0x3c, 0xe8, 0xc6,
+    0xb2, 0x49, 0x00, 0x3c, 0x89, 0xc4, 0xd8, 0xc4, 0x00, 0x3c, 0xf8, 0xc2,
+    0x11, 0xb2, 0x00, 0x3c, 0xd8, 0xc6, 0xb2, 0x49, 0x00, 0x3c, 0x91, 0x83,
+    0x00, 0x3c, 0xe0, 0xc5, 0xdc, 0xa6, 0x00, 0x70, 0x09, 0x42, 0x00, 0x4a,
+    0x42, 0x8c, 0xd0, 0xc6, 0xcb, 0xc0, 0x00, 0x70, 0x39, 0x43, 0xc3, 0xa8,
+    0xc2, 0x8c, 0xda, 0xc7, 0xc8, 0x03, 0x00, 0x72, 0x68, 0xc2, 0x00, 0x6b,
+    0x00, 0x70, 0x43, 0x02, 0x8c, 0xe4, 0xc3, 0x00, 0xb1, 0x00, 0x70, 0x49,
+    0xc2, 0x0b, 0x28, 0x00, 0x70, 0x60, 0x42, 0x00, 0x5e, 0xc2, 0x8c, 0xe8,
+    0x44, 0x14, 0x07, 0x42, 0x8c, 0xf2, 0x43, 0xe5, 0x9e, 0xc2, 0x8d, 0x0f,
+    0xc7, 0xca, 0x33, 0x00, 0x72, 0x70, 0xc5, 0xd4, 0x9a, 0x00, 0x70, 0x71,
+    0xc3, 0x13, 0x85, 0x00, 0x70, 0xa0, 0x42, 0x00, 0x5e, 0xc2, 0x8d, 0x1b,
+    0x0a, 0x42, 0x8d, 0x27, 0xc5, 0xdc, 0xba, 0x00, 0x70, 0xd9, 0x0a, 0xc2,
+    0x8d, 0x33, 0xc8, 0xb7, 0x70, 0x00, 0x71, 0x78, 0xc3, 0x04, 0x6f, 0x00,
+    0x70, 0xeb, 0x02, 0x8d, 0x3f, 0xc5, 0xda, 0xdf, 0x00, 0x72, 0x78, 0xc4,
+    0x40, 0xf3, 0x00, 0x71, 0x09, 0x42, 0x00, 0x9c, 0x42, 0x8d, 0x43, 0xc5,
+    0xdc, 0xe7, 0x00, 0x71, 0x19, 0x97, 0x00, 0x71, 0x20, 0x42, 0x00, 0x5e,
+    0xc2, 0x8d, 0x53, 0x97, 0x00, 0x71, 0x31, 0xca, 0x9a, 0x20, 0x00, 0x72,
+    0x28, 0xc3, 0x08, 0x3f, 0x00, 0x71, 0x59, 0xc6, 0xcd, 0xfa, 0x00, 0x71,
+    0x70, 0xc2, 0x20, 0xc5, 0x0f, 0x15, 0x61, 0x87, 0x0f, 0x15, 0x3b, 0x02,
+    0x8d, 0x5f, 0x8b, 0x0f, 0x15, 0x12, 0x02, 0x8d, 0x63, 0xc6, 0x79, 0xd0,
+    0x0e, 0x98, 0xf1, 0xc3, 0x04, 0x71, 0x0e, 0x98, 0xa9, 0xc7, 0xc1, 0x2d,
+    0x0e, 0x98, 0x58, 0xc5, 0xd6, 0x93, 0x0e, 0x99, 0x61, 0xc6, 0xcb, 0xea,
+    0x0e, 0x98, 0xd8, 0xca, 0x9f, 0xca, 0x0f, 0xab, 0xe0, 0xd1, 0x53, 0x99,
+    0x00, 0x60, 0x01, 0xce, 0x2a, 0xe9, 0x00, 0x60, 0x20, 0x83, 0x00, 0x60,
+    0x31, 0x8b, 0x00, 0x60, 0x81, 0x97, 0x00, 0x60, 0xa0, 0x8b, 0x00, 0x60,
+    0x40, 0x97, 0x00, 0x60, 0x50, 0x47, 0xaa, 0xd3, 0xc2, 0x8d, 0x67, 0x83,
+    0x00, 0x61, 0xa8, 0x87, 0x00, 0x60, 0x78, 0x91, 0x00, 0x60, 0x98, 0x83,
+    0x00, 0x60, 0xa9, 0xc2, 0x00, 0xce, 0x00, 0x60, 0xb0, 0x83, 0x00, 0x60,
+    0xb9, 0xc2, 0x00, 0xce, 0x00, 0x60, 0xc0, 0xc2, 0x00, 0xeb, 0x00, 0x60,
+    0xc9, 0xc2, 0x1a, 0x18, 0x00, 0x60, 0xf1, 0xc2, 0x03, 0x83, 0x00, 0x61,
+    0x19, 0x83, 0x00, 0x61, 0x42, 0x02, 0x8d, 0x75, 0x83, 0x00, 0x60, 0xd1,
+    0xc2, 0x00, 0xce, 0x00, 0x60, 0xd8, 0x83, 0x00, 0x60, 0xe1, 0xc2, 0x00,
+    0xce, 0x00, 0x60, 0xe8, 0x16, 0xc2, 0x8d, 0x7b, 0x83, 0x00, 0x61, 0x21,
+    0xc2, 0x00, 0xce, 0x00, 0x61, 0x29, 0xc2, 0x0d, 0x01, 0x00, 0x62, 0xc0,
+    0x06, 0xc2, 0x8d, 0x85, 0x83, 0x00, 0x61, 0x31, 0xc2, 0x00, 0xce, 0x00,
+    0x61, 0x39, 0xc2, 0x01, 0x16, 0x00, 0x62, 0xc8, 0x83, 0x00, 0x61, 0x51,
+    0xc2, 0x00, 0xce, 0x00, 0x61, 0x58, 0x83, 0x00, 0x61, 0x61, 0xc2, 0x00,
+    0xce, 0x00, 0x61, 0x68, 0x83, 0x00, 0x61, 0x81, 0x14, 0x42, 0x8d, 0x8f,
+    0x83, 0x00, 0x61, 0x91, 0x0e, 0x42, 0x8d, 0x99, 0xc2, 0x00, 0xce, 0x00,
+    0x61, 0xb1, 0xc2, 0x0d, 0x01, 0x00, 0x61, 0xb9, 0x83, 0x00, 0x61, 0xc0,
+    0x94, 0x00, 0x62, 0x20, 0x8e, 0x00, 0x63, 0x18, 0xd2, 0x18, 0xb0, 0x00,
+    0x63, 0xd1, 0xd3, 0x46, 0x6c, 0x00, 0x63, 0xe8, 0xd2, 0x18, 0xb0, 0x00,
+    0x63, 0xd9, 0xd3, 0x46, 0x6c, 0x00, 0x63, 0xf0, 0xd0, 0x02, 0xf9, 0x01,
+    0x4b, 0x91, 0xcf, 0x09, 0x5a, 0x01, 0x5a, 0x48, 0xc9, 0x18, 0x17, 0x01,
+    0x53, 0x51, 0xcb, 0x8c, 0x4c, 0x01, 0x53, 0x58, 0x8e, 0x08, 0xa5, 0xc0,
+    0x94, 0x08, 0xa5, 0xb0, 0x8e, 0x08, 0xa4, 0x4b, 0x02, 0x8d, 0xa3, 0x94,
+    0x08, 0xa4, 0x3a, 0x02, 0x8d, 0xa7, 0xc2, 0x00, 0xce, 0x08, 0xa4, 0xe1,
+    0x83, 0x08, 0xa4, 0xd8, 0xc2, 0x00, 0xce, 0x08, 0xa4, 0xd1, 0x83, 0x08,
+    0xa4, 0xc8, 0xca, 0x9f, 0x3e, 0x00, 0x7e, 0x38, 0xc9, 0xac, 0x55, 0x00,
+    0x7e, 0x31, 0xc6, 0xce, 0xfc, 0x00, 0x7e, 0x40, 0x01, 0x42, 0x8d, 0xab,
+    0x45, 0xd7, 0x06, 0xc2, 0x8d, 0xbd, 0x44, 0xe3, 0x70, 0x42, 0x8d, 0xc7,
+    0x83, 0x00, 0x7c, 0x81, 0xc2, 0x00, 0xce, 0x00, 0x7c, 0x89, 0xc3, 0x1b,
+    0xb1, 0x00, 0x7d, 0xc8, 0x83, 0x00, 0x7c, 0x91, 0xc2, 0x00, 0xce, 0x00,
+    0x7c, 0x98, 0xc2, 0x00, 0xeb, 0x00, 0x7c, 0xa1, 0xc2, 0x1a, 0x18, 0x00,
+    0x7c, 0xc9, 0xc2, 0x03, 0x83, 0x00, 0x7c, 0xf1, 0x83, 0x00, 0x7d, 0x18,
+    0x83, 0x00, 0x7c, 0xa9, 0xc2, 0x00, 0xce, 0x00, 0x7c, 0xb0, 0x16, 0xc2,
+    0x8d, 0xd1, 0x83, 0x00, 0x7c, 0xf9, 0xc2, 0x00, 0xce, 0x00, 0x7d, 0x01,
+    0x15, 0x42, 0x8d, 0xdb, 0x06, 0xc2, 0x8d, 0xe5, 0x83, 0x00, 0x7d, 0x09,
+    0xc2, 0x00, 0xce, 0x00, 0x7d, 0x11, 0x1c, 0x42, 0x8d, 0xef, 0x83, 0x00,
+    0x7d, 0x21, 0xc2, 0x00, 0xce, 0x00, 0x7d, 0x28, 0x83, 0x00, 0x7d, 0x31,
+    0xc2, 0x00, 0xce, 0x00, 0x7d, 0x38, 0xc2, 0x00, 0xce, 0x00, 0x7d, 0x71,
+    0x83, 0x00, 0x7d, 0x78, 0xc2, 0x00, 0xce, 0x00, 0x7d, 0xa1, 0xc2, 0x0d,
+    0x01, 0x00, 0x7d, 0xa9, 0x83, 0x00, 0x7d, 0xb0, 0xc2, 0x00, 0x71, 0x00,
+    0x7d, 0xd1, 0xc2, 0x1a, 0x18, 0x00, 0x7d, 0xd9, 0xc2, 0x00, 0x3b, 0x00,
+    0x7d, 0xe0, 0xcb, 0x95, 0x31, 0x00, 0x78, 0x09, 0x44, 0xe3, 0x2c, 0x42,
+    0x8d, 0xf9, 0xcb, 0x8e, 0x30, 0x00, 0x78, 0x99, 0xcc, 0x7b, 0x38, 0x00,
+    0x79, 0xb0, 0xca, 0xa3, 0xb2, 0x00, 0x78, 0x49, 0xd4, 0x3b, 0xda, 0x00,
+    0x7e, 0x80, 0xc5, 0x02, 0xe9, 0x00, 0x78, 0x80, 0x83, 0x00, 0x7a, 0x51,
+    0xc2, 0x00, 0xce, 0x00, 0x7a, 0x58, 0x83, 0x00, 0x7a, 0xc9, 0xc2, 0x00,
+    0xce, 0x00, 0x7a, 0xd0, 0x83, 0x00, 0x7a, 0x61, 0xc2, 0x00, 0xce, 0x00,
+    0x7a, 0x68, 0x83, 0x00, 0x7a, 0xd9, 0xc2, 0x00, 0xce, 0x00, 0x7a, 0xe0,
+    0x8a, 0x01, 0x69, 0x90, 0x8a, 0x01, 0x6a, 0xb2, 0x02, 0x8e, 0x05, 0x8a,
+    0x01, 0x69, 0xc1, 0x86, 0x01, 0x69, 0xca, 0x02, 0x8e, 0x09, 0x8a, 0x01,
+    0x6a, 0x2a, 0x02, 0x8e, 0x0d, 0x8a, 0x01, 0x6a, 0x18, 0x8a, 0x01, 0x6a,
+    0x51, 0x9c, 0x01, 0x6b, 0x28, 0x94, 0x01, 0x6a, 0xa8, 0x95, 0x01, 0x6a,
+    0xd1, 0x8a, 0x01, 0x6a, 0xd8, 0x8a, 0x01, 0x6a, 0xe9, 0x96, 0x01, 0x6a,
+    0xf8, 0x8a, 0x01, 0x6a, 0x30, 0x90, 0x01, 0x6a, 0x81, 0x8a, 0x01, 0x6a,
+    0xb8, 0xc4, 0x17, 0xf7, 0x05, 0x46, 0xb9, 0xc2, 0x24, 0x36, 0x05, 0x46,
+    0xb0, 0xc3, 0x0c, 0xf7, 0x05, 0x46, 0xa9, 0xc3, 0x04, 0xa0, 0x05, 0x46,
+    0xa0, 0xc4, 0x03, 0xe0, 0x05, 0x46, 0x99, 0xc2, 0x01, 0xa2, 0x05, 0x46,
+    0x90, 0x8e, 0x05, 0x45, 0xe8, 0x94, 0x05, 0x45, 0xd8, 0x94, 0x05, 0x44,
+    0x43, 0x02, 0x8e, 0x11, 0x8e, 0x05, 0x44, 0x52, 0x02, 0x8e, 0x15, 0xc2,
+    0x00, 0xce, 0x05, 0x44, 0xf9, 0x83, 0x05, 0x44, 0xf0, 0xc2, 0x00, 0xce,
+    0x05, 0x44, 0xe9, 0x83, 0x05, 0x44, 0xe0, 0xe0, 0x04, 0x09, 0x0f, 0xb3,
+    0xb0, 0x4b, 0x96, 0xff, 0xc2, 0x8e, 0x19, 0xc7, 0x1b, 0x42, 0x08, 0x8e,
+    0x40, 0xc7, 0xc8, 0xf1, 0x08, 0x8e, 0xd9, 0xd4, 0x39, 0x0a, 0x08, 0x8e,
+    0x79, 0xc5, 0x34, 0xd9, 0x08, 0x8e, 0x51, 0xcb, 0x98, 0x33, 0x08, 0x8e,
+    0x19, 0xcb, 0x92, 0xf5, 0x08, 0x8e, 0x11, 0x03, 0xc2, 0x8e, 0x21, 0x42,
+    0x06, 0xb4, 0xc2, 0x8e, 0x2d, 0xcb, 0x1f, 0xe9, 0x08, 0x8c, 0x00, 0xc4,
+    0x28, 0x74, 0x08, 0x8e, 0xc9, 0xc5, 0x0a, 0xfd, 0x08, 0x8e, 0xc1, 0x15,
+    0xc2, 0x8e, 0x39, 0x08, 0xc2, 0x8e, 0x45, 0x16, 0xc2, 0x8e, 0x51, 0xc3,
+    0x05, 0x16, 0x08, 0x8e, 0x89, 0xc4, 0x18, 0xa7, 0x08, 0x8e, 0x80, 0xcf,
+    0x60, 0x4d, 0x08, 0x8e, 0x71, 0x03, 0xc2, 0x8e, 0x5d, 0x91, 0x08, 0x8d,
+    0xf1, 0x87, 0x08, 0x8d, 0xe1, 0x48, 0xaa, 0xd2, 0xc2, 0x8e, 0x69, 0x97,
+    0x08, 0x8d, 0xb3, 0x02, 0x8e, 0x77, 0x8b, 0x08, 0x8d, 0xa2, 0x02, 0x8e,
+    0x7b, 0x83, 0x08, 0x8d, 0x89, 0xc2, 0x0d, 0x01, 0x08, 0x8d, 0x81, 0xc2,
+    0x00, 0xce, 0x08, 0x8d, 0x78, 0x83, 0x08, 0x8d, 0x71, 0x47, 0xaa, 0xd3,
+    0x42, 0x8e, 0x7f, 0xc2, 0x00, 0x89, 0x08, 0x8d, 0x69, 0x83, 0x08, 0x8d,
+    0x60, 0xc2, 0x00, 0xce, 0x08, 0x8d, 0x41, 0x83, 0x08, 0x8d, 0x38, 0xc2,
+    0x00, 0xce, 0x08, 0x8d, 0x31, 0x83, 0x08, 0x8d, 0x28, 0x83, 0x08, 0x8d,
+    0x21, 0xc2, 0x03, 0x83, 0x08, 0x8c, 0xf9, 0xc2, 0x1a, 0x18, 0x08, 0x8c,
+    0xd1, 0xc2, 0x00, 0xeb, 0x08, 0x8c, 0xa8, 0xc2, 0x00, 0xce, 0x08, 0x8d,
+    0x19, 0x83, 0x08, 0x8d, 0x11, 0x06, 0x42, 0x8e, 0x8d, 0xc2, 0x00, 0xce,
+    0x08, 0x8d, 0x09, 0x83, 0x08, 0x8d, 0x01, 0x16, 0x42, 0x8e, 0x97, 0xc2,
+    0x00, 0xce, 0x08, 0x8c, 0xc9, 0x83, 0x08, 0x8c, 0xc0, 0xc2, 0x00, 0xce,
+    0x08, 0x8c, 0xb9, 0x83, 0x08, 0x8c, 0xb0, 0xc2, 0x00, 0xce, 0x08, 0x8c,
+    0xa1, 0x83, 0x08, 0x8c, 0x98, 0xc2, 0x00, 0xce, 0x08, 0x8c, 0x91, 0x83,
+    0x08, 0x8c, 0x88, 0x97, 0x08, 0x8c, 0x81, 0x8b, 0x08, 0x8c, 0x71, 0x83,
+    0x08, 0x8c, 0x20, 0x97, 0x08, 0x8c, 0x40, 0x8b, 0x08, 0x8c, 0x30, 0xc3,
+    0x00, 0x65, 0x08, 0x22, 0xa1, 0xc2, 0x18, 0xf5, 0x08, 0x22, 0xf0, 0x96,
+    0x08, 0x23, 0x81, 0x94, 0x08, 0x23, 0xe8, 0x87, 0x08, 0x23, 0xc1, 0xc3,
+    0x5b, 0x62, 0x08, 0x23, 0xe0, 0xcd, 0x54, 0x25, 0x01, 0x57, 0x41, 0xd5,
+    0x32, 0xad, 0x01, 0x57, 0x48, 0xe0, 0x08, 0x89, 0x01, 0x5a, 0xf8, 0xd4,
+    0x3b, 0x9e, 0x01, 0x49, 0x51, 0xc9, 0x1e, 0x94, 0x01, 0x49, 0x30, 0xc9,
+    0xa9, 0x2b, 0x01, 0x0f, 0x91, 0xd9, 0x1d, 0xd5, 0x01, 0x49, 0x69, 0xd4,
+    0x3c, 0x3e, 0x01, 0x49, 0x49, 0xc9, 0x1e, 0x94, 0x01, 0x49, 0x28, 0xca,
+    0xa3, 0x9e, 0x01, 0x37, 0xb1, 0xc2, 0x01, 0x5d, 0x01, 0x1e, 0x68, 0x0e,
+    0xc2, 0x8e, 0xa1, 0x46, 0x06, 0x50, 0xc2, 0x8e, 0xad, 0xd0, 0x59, 0x82,
+    0x01, 0x2f, 0x41, 0xd8, 0x22, 0x75, 0x01, 0x2d, 0x49, 0xda, 0x1a, 0x66,
+    0x01, 0x2d, 0x31, 0xcd, 0x76, 0x57, 0x01, 0x2d, 0x29, 0xcf, 0x62, 0x87,
+    0x01, 0x2d, 0x21, 0xd1, 0x55, 0xb9, 0x01, 0x4f, 0x01, 0xce, 0x6f, 0x6e,
+    0x01, 0x58, 0x91, 0xd1, 0x51, 0x46, 0x01, 0x58, 0x98, 0xc5, 0x0a, 0x44,
+    0x01, 0x18, 0x89, 0x89, 0x01, 0x9e, 0x90, 0x44, 0x1c, 0x88, 0x42, 0x8e,
+    0xb9, 0x44, 0x1c, 0x88, 0x42, 0x8e, 0xc5, 0xc4, 0x93, 0x2e, 0x01, 0x98,
+    0x21, 0xc2, 0x00, 0x45, 0x01, 0x98, 0x28, 0x92, 0x01, 0x14, 0x99, 0x8e,
+    0x01, 0x9c, 0x40, 0xc9, 0xb2, 0x6a, 0x01, 0x9b, 0xf8, 0x01, 0x42, 0x8e,
+    0xd1, 0xd5, 0x35, 0x77, 0x01, 0x56, 0x71, 0xc5, 0xd6, 0xc5, 0x01, 0x9a,
+    0x89, 0xc2, 0x00, 0x3b, 0x01, 0x9a, 0x90, 0xc3, 0x74, 0x8a, 0x01, 0x9a,
+    0x99, 0xc5, 0xd5, 0xdf, 0x01, 0x9a, 0xa0, 0xc2, 0x14, 0x12, 0x01, 0x9a,
+    0xa9, 0xc6, 0xcb, 0xf0, 0x01, 0x9a, 0xb0, 0xc7, 0x03, 0x94, 0x01, 0x9d,
+    0x72, 0x02, 0x8e, 0xdd, 0xc3, 0x1c, 0x7a, 0x01, 0x99, 0x50, 0xc6, 0xcb,
+    0x3c, 0x01, 0x99, 0x91, 0xc4, 0xdf, 0x10, 0x01, 0x99, 0x99, 0xc3, 0x06,
+    0x5f, 0x01, 0x99, 0xa8, 0xc7, 0xc8, 0x50, 0x01, 0x99, 0xb1, 0xc4, 0xde,
+    0x40, 0x01, 0x99, 0xc8, 0x90, 0x01, 0x99, 0xf9, 0x11, 0x42, 0x8e, 0xe3,
+    0x83, 0x01, 0x9b, 0x88, 0xc3, 0x13, 0xb0, 0x01, 0x99, 0x20, 0x01, 0x42,
+    0x8e, 0xed, 0xd0, 0x5d, 0xf2, 0x01, 0x5e, 0x81, 0xc4, 0x0e, 0x17, 0x01,
+    0x99, 0xe9, 0xc3, 0x1c, 0x6d, 0x01, 0x9a, 0x00, 0x03, 0xc2, 0x8e, 0xf9,
+    0xc5, 0xd8, 0x64, 0x01, 0x9c, 0x00, 0xc7, 0xca, 0x1e, 0x01, 0x99, 0x71,
+    0x0d, 0x42, 0x8f, 0x05, 0xc2, 0x02, 0x1d, 0x01, 0x99, 0xb9, 0x10, 0xc2,
+    0x8f, 0x0f, 0xc3, 0x92, 0x67, 0x01, 0x99, 0xd8, 0x89, 0x01, 0x96, 0x69,
+    0x47, 0xc7, 0x0e, 0x42, 0x8f, 0x1b, 0xc3, 0x02, 0x52, 0x01, 0x98, 0x59,
+    0x14, 0x42, 0x8f, 0x39, 0xc6, 0xd2, 0x50, 0x01, 0x98, 0xa9, 0xc7, 0xc4,
+    0xe5, 0x01, 0x98, 0xb1, 0xc5, 0xd9, 0x6d, 0x01, 0x98, 0xb8, 0xc6, 0xd0,
+    0x34, 0x01, 0x98, 0xd1, 0xc4, 0x2c, 0x43, 0x01, 0x98, 0xd8, 0xc4, 0xde,
+    0x2c, 0x01, 0x98, 0xe9, 0xc3, 0x48, 0x11, 0x01, 0x98, 0xf0, 0x01, 0x42,
+    0x8f, 0x45, 0xc3, 0x01, 0x09, 0x01, 0x98, 0x71, 0xc3, 0x56, 0x62, 0x01,
+    0x98, 0x79, 0x8e, 0x01, 0x9f, 0xf8, 0xc2, 0x00, 0xeb, 0x01, 0x98, 0x81,
+    0xc3, 0xe5, 0xaa, 0x01, 0x98, 0x89, 0xc5, 0xdd, 0xa5, 0x01, 0x98, 0x98,
+    0xc3, 0x0e, 0x19, 0x01, 0x98, 0xc8, 0xc5, 0xda, 0xfd, 0x01, 0x98, 0xf9,
+    0xc6, 0xcb, 0xe4, 0x01, 0x99, 0x00, 0x8b, 0x01, 0x99, 0x11, 0x91, 0x01,
+    0x99, 0x18, 0xc2, 0x00, 0x10, 0x01, 0x99, 0x40, 0xc5, 0xd5, 0x85, 0x01,
+    0x99, 0x69, 0x94, 0x01, 0x9b, 0xa0, 0x0b, 0xc2, 0x8f, 0x4f, 0xc3, 0xe6,
+    0x0d, 0x01, 0x9a, 0x29, 0xc4, 0xde, 0x70, 0x01, 0x9a, 0x31, 0xc5, 0xdd,
+    0xfa, 0x01, 0x9a, 0x38, 0xc5, 0x75, 0x6a, 0x01, 0x9a, 0x41, 0xc2, 0x00,
+    0x4c, 0x01, 0x9a, 0x4b, 0x02, 0x8f, 0x5b, 0x8e, 0x01, 0x9e, 0xa8, 0xc2,
+    0x00, 0xeb, 0x01, 0x9a, 0x5b, 0x02, 0x8f, 0x61, 0xc5, 0xc4, 0xe7, 0x01,
+    0x9a, 0x68, 0x88, 0x01, 0x9c, 0x61, 0x89, 0x01, 0x9c, 0x69, 0x83, 0x01,
+    0x9c, 0x11, 0x8e, 0x01, 0x9c, 0xa9, 0x8f, 0x01, 0x9c, 0xd9, 0x95, 0x01,
+    0x9d, 0x91, 0x98, 0x01, 0x9d, 0xb1, 0x99, 0x01, 0x9d, 0xe0, 0x11, 0xc2,
+    0x8f, 0x67, 0xc7, 0x09, 0x2b, 0x01, 0x9d, 0x09, 0xc5, 0xd5, 0xbc, 0x01,
+    0x9d, 0x28, 0xc6, 0x00, 0xb4, 0x01, 0x9e, 0xa0, 0x01, 0x42, 0x8f, 0x76,
+    0xc5, 0x71, 0xbe, 0x01, 0x9d, 0xc8, 0xc5, 0x71, 0xbe, 0x01, 0x9d, 0xf8,
+    0xc2, 0x00, 0xd8, 0x01, 0x9a, 0x71, 0xc2, 0x16, 0x36, 0x01, 0x9a, 0x78,
+    0x46, 0x1a, 0x0b, 0xc2, 0x8f, 0x82, 0xc6, 0xcc, 0xb0, 0x0f, 0x8d, 0x48,
+    0xce, 0x73, 0x42, 0x0f, 0x8d, 0x29, 0x4f, 0x09, 0x39, 0x42, 0x8f, 0x8e,
+    0xcd, 0x7f, 0x06, 0x0f, 0x8d, 0x09, 0xcb, 0x94, 0xfa, 0x0f, 0x8c, 0xe0,
+    0xc2, 0x00, 0x06, 0x0f, 0x90, 0x99, 0xc2, 0x0d, 0x01, 0x0f, 0x90, 0x11,
+    0xc4, 0xe0, 0x2c, 0x0f, 0x90, 0x08, 0xd2, 0x4d, 0xb3, 0x0f, 0x8d, 0x11,
+    0xc3, 0x27, 0x24, 0x0f, 0x8c, 0xe8, 0x28, 0xc2, 0x8f, 0xf6, 0x24, 0xc2,
+    0x90, 0x02, 0x26, 0xc2, 0x90, 0x36, 0x25, 0xc2, 0x90, 0x52, 0x27, 0xc2,
+    0x90, 0x76, 0x42, 0xe6, 0x34, 0x42, 0x90, 0x88, 0x8d, 0x0f, 0x8c, 0xf1,
+    0xcf, 0x05, 0x1a, 0x01, 0x71, 0x60, 0xc9, 0x2a, 0x36, 0x01, 0x21, 0x28,
+    0xc4, 0x04, 0x9f, 0x01, 0x20, 0xa1, 0x16, 0xc2, 0x90, 0x9e, 0xc3, 0x05,
+    0x16, 0x01, 0x20, 0x88, 0xc6, 0x04, 0x3d, 0x01, 0x20, 0xc9, 0x16, 0x42,
+    0x90, 0xaa, 0xc3, 0x1b, 0xb1, 0x00, 0x43, 0x51, 0x42, 0x00, 0xb8, 0xc2,
+    0x90, 0xb9, 0xc2, 0x00, 0x3b, 0x00, 0x43, 0x39, 0xc3, 0x3a, 0xeb, 0x00,
+    0x43, 0x31, 0x10, 0xc2, 0x90, 0xc3, 0xc3, 0x22, 0xc0, 0x00, 0x43, 0x19,
+    0xc2, 0x21, 0x7d, 0x00, 0x43, 0x08, 0xc9, 0xb3, 0x03, 0x00, 0x38, 0xe0,
+    0xc5, 0xd7, 0x15, 0x00, 0x3a, 0x69, 0xc5, 0xda, 0x94, 0x00, 0x3a, 0x71,
+    0xc2, 0x15, 0x48, 0x00, 0x3a, 0x78, 0xc7, 0xc2, 0xc3, 0x00, 0x39, 0x79,
+    0xc6, 0xcb, 0xae, 0x00, 0x39, 0x71, 0xc5, 0xd5, 0xb7, 0x00, 0x39, 0x68,
+    0xc5, 0x00, 0xd2, 0x00, 0x39, 0xd1, 0xc5, 0x01, 0x24, 0x00, 0x39, 0xd8,
+    0x48, 0x84, 0x18, 0x42, 0x90, 0xd3, 0xcc, 0x84, 0x18, 0x00, 0x38, 0x40,
+    0x20, 0xc2, 0x90, 0xdf, 0xa8, 0x0e, 0xd5, 0x41, 0xa7, 0x0e, 0xd5, 0x39,
+    0xa6, 0x0e, 0xd5, 0x31, 0xa5, 0x0e, 0xd5, 0x29, 0xa4, 0x0e, 0xd5, 0x21,
+    0xa3, 0x0e, 0xd5, 0x19, 0xa2, 0x0e, 0xd5, 0x11, 0xa1, 0x0e, 0xd5, 0x08,
+    0x4b, 0x45, 0x03, 0xc2, 0x90, 0xfb, 0x4a, 0x15, 0xe9, 0x42, 0x91, 0x16,
+    0xa5, 0x0e, 0xd4, 0xf9, 0xa4, 0x0e, 0xd4, 0xf1, 0xa3, 0x0e, 0xd4, 0xe9,
+    0xa2, 0x0e, 0xd4, 0xe1, 0xa1, 0x0e, 0xd4, 0xd8, 0x15, 0xc2, 0x91, 0x2e,
+    0x46, 0x16, 0x70, 0x42, 0x91, 0x3a, 0xc8, 0x08, 0x31, 0x0e, 0xd0, 0x48,
+    0xc9, 0xb4, 0xb3, 0x0e, 0xd3, 0x71, 0xc5, 0xdb, 0x1b, 0x0e, 0xd3, 0x68,
+    0xc9, 0x64, 0xc7, 0x0e, 0xc8, 0xd1, 0x45, 0x00, 0xb6, 0x42, 0x91, 0x46,
+    0xc8, 0x3b, 0x12, 0x0e, 0xc8, 0xc1, 0xc6, 0x23, 0x4d, 0x0e, 0xc8, 0xb0,
+    0xcc, 0x87, 0xc0, 0x0e, 0xd4, 0x31, 0xc5, 0xd6, 0xde, 0x0e, 0xd4, 0x29,
+    0x42, 0x00, 0x61, 0xc2, 0x91, 0x52, 0xc5, 0xd6, 0x8e, 0x0e, 0xd4, 0x19,
+    0xc5, 0x47, 0x6b, 0x0e, 0xd4, 0x10, 0xd0, 0x5a, 0x32, 0x0e, 0xd4, 0x01,
+    0xcf, 0x68, 0xae, 0x0e, 0xd3, 0xf8, 0x47, 0xc1, 0x18, 0xc2, 0x91, 0x5e,
+    0xcb, 0x99, 0x9e, 0x0e, 0xd3, 0xb0, 0x01, 0xc2, 0x91, 0x7a, 0xd2, 0x4a,
+    0xf5, 0x0e, 0xd2, 0x98, 0xd3, 0x45, 0x03, 0x0e, 0xd3, 0xa1, 0x4a, 0x15,
+    0xe9, 0x42, 0x91, 0x86, 0x47, 0x0d, 0xdf, 0xc2, 0x91, 0x92, 0xd3, 0x46,
+    0x33, 0x0e, 0xd2, 0xf1, 0xd4, 0x38, 0xe2, 0x0e, 0xd2, 0xe9, 0x44, 0x05,
+    0x9c, 0xc2, 0x91, 0x9e, 0xcc, 0x85, 0xd4, 0x0e, 0xd2, 0xd1, 0xd0, 0x59,
+    0xa2, 0x0e, 0xd2, 0xc8, 0xc7, 0x02, 0x6a, 0x0e, 0xc8, 0x39, 0xc8, 0x3b,
+    0x12, 0x0e, 0xc8, 0x31, 0xc6, 0x23, 0x4d, 0x0e, 0xc8, 0x28, 0x01, 0x42,
+    0x91, 0xaa, 0xc3, 0x00, 0x29, 0x0e, 0xd1, 0x79, 0xc6, 0x01, 0x33, 0x0e,
+    0xd1, 0x71, 0xc4, 0x08, 0xad, 0x0e, 0xd1, 0x68, 0xc7, 0xc0, 0xaf, 0x0e,
+    0xcc, 0x39, 0x49, 0xb1, 0x0b, 0x42, 0x91, 0xbc, 0x4b, 0x96, 0x18, 0xc2,
+    0x91, 0xc8, 0xc7, 0xc0, 0xaf, 0x0e, 0xca, 0x89, 0x49, 0xb1, 0x0b, 0x42,
+    0x91, 0xda, 0x4a, 0x15, 0xe9, 0xc2, 0x91, 0xe6, 0x4b, 0x45, 0x03, 0x42,
+    0x91, 0xf3, 0xca, 0x42, 0x0c, 0x0e, 0xd1, 0x01, 0xc4, 0x05, 0x45, 0x0e,
+    0xd0, 0xf9, 0xc2, 0x00, 0x6f, 0x0e, 0xd0, 0xf0, 0xc4, 0x97, 0xba, 0x0e,
+    0xd0, 0xe9, 0x46, 0xd2, 0x5c, 0x42, 0x92, 0x02, 0x44, 0xd3, 0xb4, 0xc2,
+    0x92, 0x0e, 0x45, 0x04, 0x30, 0xc2, 0x92, 0x1a, 0xc6, 0x0c, 0x03, 0x0e,
+    0xd0, 0xb1, 0xc8, 0xb7, 0x68, 0x0e, 0xd0, 0xa9, 0xc4, 0x00, 0x77, 0x0e,
+    0xd0, 0xa0, 0xc4, 0x05, 0x45, 0x0e, 0xd0, 0x61, 0xc7, 0x81, 0xb9, 0x0e,
+    0xd0, 0x59, 0xc2, 0x00, 0x6f, 0x0e, 0xd0, 0x50, 0x08, 0xc2, 0x92, 0x26,
+    0xc5, 0x00, 0xc4, 0x0e, 0xc4, 0x2b, 0x02, 0x92, 0x38, 0x0a, 0xc2, 0x92,
+    0x3c, 0x05, 0xc2, 0x92, 0x4e, 0xc4, 0x3d, 0x4b, 0x0e, 0xc3, 0xba, 0x02,
+    0x92, 0x64, 0x48, 0x54, 0xd4, 0xc2, 0x92, 0x68, 0xc3, 0x16, 0x42, 0x0e,
+    0xd0, 0x00, 0xc6, 0xcb, 0x12, 0x0e, 0xd1, 0xa1, 0xc7, 0xaf, 0x89, 0x0e,
+    0xd1, 0x98, 0xc3, 0xe5, 0x65, 0x0e, 0xd3, 0x49, 0x48, 0x19, 0x13, 0xc2,
+    0x92, 0x72, 0x19, 0xc2, 0x92, 0x7e, 0x58, 0x21, 0x85, 0xc2, 0x92, 0x8a,
+    0x15, 0xc2, 0x92, 0x9c, 0x45, 0xdb, 0x7f, 0xc2, 0x92, 0xa8, 0x45, 0xdd,
+    0xc8, 0xc2, 0x92, 0xb4, 0x05, 0xc2, 0x92, 0xc0, 0x46, 0xd1, 0xa8, 0xc2,
+    0x92, 0xd8, 0x47, 0x30, 0xde, 0xc2, 0x92, 0xea, 0x04, 0xc2, 0x92, 0xfc,
+    0x47, 0x2f, 0xe2, 0xc2, 0x93, 0x08, 0x47, 0x03, 0x7a, 0x42, 0x93, 0x1a,
+    0xc3, 0xe5, 0x65, 0x0e, 0xd3, 0x41, 0x48, 0x19, 0x13, 0xc2, 0x93, 0x2f,
+    0x19, 0xc2, 0x93, 0x3b, 0x4b, 0x21, 0x85, 0xc2, 0x93, 0x47, 0x45, 0xdb,
+    0x7f, 0xc2, 0x93, 0x53, 0x45, 0xdd, 0xc8, 0xc2, 0x93, 0x6e, 0x05, 0xc2,
+    0x93, 0x86, 0x15, 0xc2, 0x93, 0x9e, 0x46, 0xd1, 0xa8, 0xc2, 0x93, 0xaa,
+    0x47, 0x30, 0xde, 0xc2, 0x93, 0xbc, 0x04, 0xc2, 0x93, 0xce, 0x47, 0x2f,
+    0xe2, 0xc2, 0x93, 0xda, 0x47, 0x03, 0x7a, 0x42, 0x93, 0xef, 0x48, 0x02,
+    0x6a, 0xc2, 0x94, 0x04, 0x48, 0xb7, 0x48, 0xc2, 0x94, 0x10, 0x45, 0xd5,
+    0x53, 0x42, 0x94, 0x25, 0xd5, 0x32, 0x44, 0x0e, 0xc9, 0x39, 0x43, 0x10,
+    0xf4, 0xc2, 0x94, 0x3a, 0xcf, 0x64, 0xc1, 0x0e, 0xc9, 0x20, 0xc6, 0x00,
+    0xd8, 0x0e, 0xd2, 0xc1, 0xc6, 0x23, 0x4d, 0x0e, 0xd2, 0xb8, 0xc6, 0x13,
+    0x4d, 0x0e, 0xd2, 0xb1, 0x46, 0x19, 0x24, 0x42, 0x94, 0x46, 0x01, 0x42,
+    0x94, 0x58, 0x01, 0x42, 0x94, 0x64, 0xc9, 0x43, 0x2e, 0x0e, 0xd2, 0x53,
+    0x02, 0x94, 0x70, 0xc4, 0x3d, 0x4b, 0x0e, 0xd2, 0x3b, 0x02, 0x94, 0x74,
+    0xc8, 0xb5, 0xb8, 0x0e, 0xd2, 0x31, 0xc7, 0x28, 0x10, 0x0e, 0xd2, 0x29,
+    0xc6, 0x00, 0x7c, 0x0e, 0xd2, 0x20, 0x01, 0x42, 0x94, 0x78, 0x01, 0x42,
+    0x94, 0x84, 0xc2, 0x00, 0x6f, 0x0e, 0xd0, 0x81, 0xc4, 0x05, 0x45, 0x0e,
+    0xd0, 0x68, 0xcb, 0x8d, 0xa1, 0x0e, 0xcf, 0xdb, 0x02, 0x94, 0x90, 0xc3,
+    0x00, 0x29, 0x0e, 0xcf, 0xc0, 0xc5, 0x16, 0x70, 0x0e, 0xcf, 0xb1, 0xc5,
+    0x00, 0xb5, 0x0e, 0xcf, 0xa8, 0x97, 0x08, 0xae, 0xe8, 0x8b, 0x08, 0xae,
+    0xd0, 0xd6, 0x2b, 0x6a, 0x08, 0xae, 0xc1, 0x83, 0x08, 0xac, 0xf0, 0xc2,
+    0x00, 0xce, 0x08, 0xac, 0xc9, 0x83, 0x08, 0xac, 0xc0, 0x8e, 0x08, 0xac,
+    0x43, 0x02, 0x94, 0x96, 0x94, 0x08, 0xac, 0x32, 0x02, 0x94, 0x9a, 0xc2,
+    0x00, 0xce, 0x08, 0xac, 0xd9, 0x83, 0x08, 0xac, 0xd0, 0x45, 0x00, 0x92,
+    0xc2, 0x94, 0x9e, 0xcb, 0x99, 0x46, 0x08, 0xae, 0x7a, 0x02, 0x94, 0xc2,
+    0xc3, 0x02, 0xca, 0x08, 0xae, 0x29, 0xc3, 0x01, 0xa5, 0x08, 0xae, 0x20,
+    0xc4, 0x1f, 0xf7, 0x08, 0xad, 0xf9, 0xc5, 0x40, 0xb0, 0x08, 0xad, 0xf0,
+    0xe0, 0x01, 0x49, 0x01, 0x01, 0xc8, 0xc8, 0x53, 0xd0, 0x08, 0x8f, 0xa1,
+    0xc7, 0x0c, 0xe7, 0x08, 0x8f, 0x98, 0xc6, 0x17, 0xf7, 0x08, 0x8f, 0x81,
+    0xc4, 0xcb, 0x72, 0x08, 0x8f, 0x78, 0xc4, 0x43, 0x1f, 0x08, 0x8f, 0x71,
+    0xc4, 0x4b, 0x50, 0x08, 0x8f, 0x68, 0xc5, 0x0c, 0xf0, 0x08, 0x8f, 0x61,
+    0xc5, 0x26, 0x6c, 0x08, 0x8f, 0x59, 0xc2, 0x00, 0x79, 0x08, 0x8f, 0x50,
+    0xc4, 0x17, 0xf7, 0x08, 0x8f, 0x39, 0xc2, 0x24, 0x36, 0x08, 0x8f, 0x30,
+    0xc3, 0x0c, 0xf7, 0x08, 0x8f, 0x29, 0xc3, 0x04, 0xa0, 0x08, 0x8f, 0x20,
+    0xc4, 0x03, 0xe0, 0x08, 0x8f, 0x19, 0xc2, 0x01, 0xa2, 0x08, 0x8f, 0x10,
+    0xc5, 0x69, 0x97, 0x00, 0x6c, 0x29, 0xc6, 0x8d, 0x9b, 0x00, 0x6c, 0x31,
+    0x07, 0xc2, 0x94, 0xc8, 0xc6, 0xcb, 0x66, 0x00, 0x6c, 0x99, 0xc6, 0xd0,
+    0x3a, 0x00, 0x6c, 0xb1, 0x4a, 0xa4, 0xac, 0xc2, 0x94, 0xd4, 0xcb, 0x8d,
+    0x96, 0x00, 0x6d, 0xc8, 0xc5, 0x69, 0x97, 0x00, 0x6c, 0x49, 0xc6, 0xcb,
+    0x66, 0x00, 0x6c, 0x51, 0x42, 0x16, 0x36, 0xc2, 0x95, 0x00, 0x42, 0x11,
+    0xb2, 0x42, 0x95, 0x0c, 0xc5, 0x69, 0x97, 0x00, 0x6c, 0x59, 0xc6, 0xd0,
+    0x3a, 0x00, 0x6c, 0x60, 0xc5, 0x69, 0x97, 0x00, 0x6c, 0x89, 0xc6, 0xd2,
+    0xb6, 0x00, 0x6c, 0x90, 0xc5, 0x69, 0x97, 0x00, 0x6c, 0xa1, 0xc6, 0x69,
+    0x96, 0x00, 0x6c, 0xa8, 0x03, 0xc2, 0x95, 0x18, 0x49, 0xae, 0x56, 0x42,
+    0x95, 0x24, 0xc7, 0xc3, 0xcd, 0x00, 0x6c, 0xf9, 0xc7, 0xc9, 0x1b, 0x00,
+    0x6d, 0x31, 0x06, 0x42, 0x95, 0x36, 0xca, 0x48, 0xcf, 0x00, 0x6d, 0x21,
+    0x42, 0x0d, 0x01, 0x42, 0x95, 0x42, 0xc7, 0xc4, 0x52, 0x00, 0x6d, 0x89,
+    0xc7, 0xc8, 0xc7, 0x00, 0x6d, 0xe9, 0xc7, 0xc4, 0x60, 0x00, 0x6e, 0x18,
+    0xc2, 0x01, 0xa2, 0x00, 0x6f, 0x41, 0xc4, 0x03, 0xe0, 0x00, 0x6f, 0x48,
+    0xc3, 0x04, 0xa0, 0x00, 0x6f, 0x51, 0xc3, 0x0c, 0xf7, 0x00, 0x6f, 0x58,
+    0xc2, 0x24, 0x36, 0x00, 0x6f, 0x61, 0xc4, 0x17, 0xf7, 0x00, 0x6f, 0x68,
+    0xca, 0xa3, 0x4e, 0x00, 0x6e, 0x81, 0xc8, 0xb5, 0x28, 0x00, 0x6e, 0x91,
+    0xc9, 0xac, 0x5e, 0x00, 0x6e, 0xa0, 0xc2, 0x02, 0x63, 0x00, 0x6e, 0xcb,
+    0x02, 0x95, 0x4e, 0xc5, 0xd8, 0x4b, 0x00, 0x6e, 0xd8, 0xca, 0xa7, 0xa4,
+    0x00, 0x6f, 0x91, 0xc9, 0x8f, 0xf5, 0x00, 0x6f, 0x98, 0xd1, 0x55, 0xa8,
+    0x01, 0x14, 0x59, 0xcb, 0x24, 0x62, 0x01, 0x14, 0x3b, 0x02, 0x95, 0x54,
+    0x46, 0x00, 0xd2, 0x42, 0x95, 0x5a, 0xc4, 0x0e, 0x6c, 0x01, 0x56, 0xa1,
+    0xc6, 0x2f, 0xa0, 0x01, 0x56, 0xb0, 0x90, 0x01, 0x03, 0xf9, 0x8b, 0x01,
+    0x03, 0x88, 0x8f, 0x00, 0xdd, 0xf9, 0x8d, 0x00, 0xdd, 0xf0, 0x09, 0xc2,
+    0x95, 0x72, 0xc5, 0xd6, 0xf7, 0x00, 0xdc, 0x00, 0xcf, 0x33, 0x31, 0x01,
+    0x56, 0x18, 0xcb, 0x0f, 0xaf, 0x01, 0x56, 0x29, 0xce, 0x34, 0xe4, 0x01,
+    0x56, 0x39, 0xcf, 0x66, 0x0b, 0x01, 0x56, 0x49, 0xcc, 0x23, 0x59, 0x01,
+    0x56, 0x58, 0x45, 0x00, 0x6a, 0x42, 0x95, 0x7e, 0xc3, 0x40, 0xf6, 0x0f,
+    0xb0, 0x39, 0xc4, 0x7e, 0xf5, 0x0f, 0xb0, 0x41, 0xd0, 0x55, 0xed, 0x0f,
+    0xb0, 0x68, 0xcb, 0x1a, 0xf7, 0x0f, 0xb0, 0x53, 0x02, 0x95, 0x90, 0xc9,
+    0xad, 0x09, 0x0f, 0xb0, 0x70, 0x45, 0x00, 0x92, 0xc2, 0x95, 0x96, 0xc9,
+    0xae, 0x32, 0x01, 0x10, 0x68, 0x83, 0x07, 0xf2, 0x81, 0xc9, 0xad, 0x6c,
+    0x07, 0xf3, 0x58, 0x46, 0x00, 0x91, 0x42, 0x95, 0xa2, 0xc3, 0x05, 0x16,
+    0x01, 0x0b, 0x83, 0x02, 0x95, 0xae, 0x08, 0xc2, 0x95, 0xb2, 0x16, 0xc2,
+    0x95, 0xbc, 0x07, 0xc2, 0x95, 0xcc, 0xc4, 0x28, 0x74, 0x01, 0x0b, 0xc1,
+    0x15, 0x42, 0x95, 0xd8, 0xcb, 0x1a, 0x38, 0x07, 0xf2, 0xd1, 0xd6, 0x06,
+    0xea, 0x07, 0xf2, 0xf1, 0xcd, 0x00, 0x34, 0x07, 0xf2, 0xe0, 0xcb, 0x1a,
+    0x38, 0x07, 0xf2, 0xc9, 0xcd, 0x00, 0x34, 0x07, 0xf2, 0xd9, 0xd6, 0x06,
+    0xea, 0x07, 0xf2, 0xe8, 0x0a, 0xc2, 0x95, 0xe4, 0x44, 0x31, 0x7d, 0xc2,
+    0x95, 0xee, 0x4d, 0x07, 0x3c, 0xc2, 0x95, 0xfa, 0x45, 0x1b, 0xb8, 0xc2,
+    0x96, 0x06, 0x46, 0x56, 0xeb, 0xc2, 0x96, 0x1c, 0x45, 0x30, 0x3f, 0xc2,
+    0x96, 0x28, 0xce, 0x6e, 0xc6, 0x07, 0xe4, 0x89, 0xcf, 0x6b, 0x15, 0x07,
+    0xe4, 0x91, 0xcf, 0x69, 0xbc, 0x07, 0xe4, 0xa0, 0x0a, 0xc2, 0x96, 0x32,
+    0x03, 0xc2, 0x96, 0x3e, 0x49, 0xb4, 0x50, 0xc2, 0x96, 0x48, 0xd4, 0x3a,
+    0xea, 0x07, 0xef, 0xf0, 0x0e, 0xc2, 0x96, 0x70, 0x48, 0x93, 0x24, 0xc2,
+    0x96, 0x82, 0xd2, 0x49, 0x9f, 0x07, 0xef, 0x99, 0xcb, 0x98, 0x1d, 0x07,
+    0xef, 0xf8, 0x46, 0x31, 0x7e, 0xc2, 0x96, 0x9a, 0x03, 0x42, 0x96, 0xa0,
+    0x0a, 0xc2, 0x96, 0xb5, 0x03, 0xc2, 0x96, 0xc1, 0x48, 0xac, 0x71, 0x42,
+    0x96, 0xcd, 0x48, 0xac, 0x71, 0xc2, 0x97, 0x01, 0x48, 0x1b, 0xc3, 0x42,
+    0x97, 0x1f, 0x44, 0x31, 0x7d, 0xc2, 0x97, 0x37, 0x4d, 0x07, 0x3c, 0xc2,
+    0x97, 0x43, 0x45, 0x1b, 0xb8, 0xc2, 0x97, 0x4f, 0x46, 0x56, 0xeb, 0xc2,
+    0x97, 0x65, 0x0a, 0xc2, 0x97, 0x71, 0x45, 0x30, 0x3f, 0xc2, 0x97, 0x7d,
+    0xce, 0x6e, 0xc6, 0x07, 0xe4, 0x51, 0xcf, 0x6b, 0x15, 0x07, 0xe4, 0x59,
+    0xcf, 0x69, 0xbc, 0x07, 0xe4, 0x68, 0x49, 0x1b, 0xb9, 0xc2, 0x97, 0x87,
+    0xd5, 0x31, 0xdb, 0x07, 0xef, 0xa0, 0x44, 0x31, 0x7d, 0xc2, 0x97, 0xab,
+    0x45, 0x02, 0x17, 0xc2, 0x97, 0xb7, 0x45, 0x1b, 0xb8, 0xc2, 0x97, 0xcf,
+    0x45, 0x56, 0xeb, 0xc2, 0x97, 0xe5, 0x0a, 0xc2, 0x97, 0xef, 0x45, 0x30,
+    0x3f, 0x42, 0x97, 0xfb, 0x48, 0x0f, 0xbb, 0xc2, 0x98, 0x05, 0x49, 0x1b,
+    0xc2, 0x42, 0x98, 0x2f, 0x03, 0xc2, 0x98, 0x4d, 0xcd, 0x7c, 0x62, 0x07,
+    0xea, 0x58, 0x44, 0x31, 0x7d, 0xc2, 0x98, 0x59, 0x4d, 0x07, 0x3c, 0xc2,
+    0x98, 0x65, 0x45, 0x1b, 0xb8, 0xc2, 0x98, 0x71, 0x45, 0x56, 0xeb, 0xc2,
+    0x98, 0x7b, 0x45, 0x56, 0x30, 0xc2, 0x98, 0x85, 0x46, 0x30, 0x3f, 0x42,
+    0x98, 0x91, 0x45, 0x1b, 0xb8, 0xc2, 0x98, 0x9d, 0x46, 0x30, 0x3f, 0xc2,
+    0x98, 0xa7, 0x44, 0x31, 0x7d, 0xc2, 0x98, 0xb3, 0x4d, 0x07, 0x3c, 0x42,
+    0x98, 0xbf, 0x0b, 0xc2, 0x98, 0xcb, 0xcb, 0x64, 0x20, 0x07, 0xe9, 0xd8,
+    0x46, 0x54, 0xfe, 0xc2, 0x98, 0xd7, 0x45, 0x56, 0xeb, 0xc2, 0x98, 0xe3,
+    0x44, 0x1b, 0xc2, 0xc2, 0x98, 0xed, 0x46, 0x30, 0x3f, 0xc2, 0x98, 0xf7,
+    0x44, 0x6e, 0xc6, 0xc2, 0x99, 0x03, 0x4d, 0x07, 0x3c, 0xc2, 0x99, 0x0f,
+    0x44, 0x31, 0x7d, 0x42, 0x99, 0x1b, 0x49, 0x1b, 0xb9, 0xc2, 0x99, 0x27,
+    0xce, 0x73, 0x0a, 0x07, 0xef, 0xd8, 0x48, 0xac, 0x71, 0xc2, 0x99, 0x3f,
+    0xdc, 0x12, 0xe3, 0x07, 0xef, 0xe8, 0x60, 0x07, 0x29, 0x42, 0x99, 0x73,
+    0xc5, 0x01, 0x24, 0x00, 0x47, 0xc9, 0xc5, 0x00, 0xd2, 0x00, 0x47, 0xb8,
+    0x08, 0xc2, 0x99, 0x7d, 0x09, 0xc2, 0x99, 0x8f, 0x0e, 0xc2, 0x99, 0xb0,
+    0x42, 0x19, 0x48, 0xc2, 0x99, 0xbf, 0x03, 0xc2, 0x99, 0xcf, 0x0d, 0xc2,
+    0x99, 0xeb, 0x16, 0xc2, 0x9a, 0x07, 0xc3, 0x62, 0x85, 0x00, 0x33, 0xf3,
+    0x02, 0x9a, 0x2f, 0x1b, 0xc2, 0x9a, 0x3c, 0x14, 0xc2, 0x9a, 0x4c, 0x42,
+    0x01, 0x24, 0xc2, 0x9a, 0x6d, 0x97, 0x00, 0x36, 0x3b, 0x02, 0x9a, 0x7d,
+    0xc3, 0x0f, 0xba, 0x00, 0x32, 0x13, 0x02, 0x9a, 0x87, 0x87, 0x00, 0x36,
+    0x83, 0x02, 0x9a, 0x8b, 0x42, 0x01, 0x16, 0xc2, 0x9a, 0x8f, 0x15, 0xc2,
+    0x9a, 0x9f, 0x06, 0xc2, 0x9a, 0xcc, 0xc2, 0x00, 0x98, 0x00, 0x36, 0x5b,
+    0x02, 0x9a, 0xee, 0xc3, 0x76, 0xe6, 0x00, 0x32, 0x43, 0x02, 0x9a, 0xf9,
+    0x0f, 0xc2, 0x9a, 0xfd, 0xc2, 0x0b, 0x28, 0x00, 0x36, 0x33, 0x02, 0x9b,
+    0x0c, 0x10, 0xc2, 0x9b, 0x10, 0x0a, 0x42, 0x9b, 0x29, 0xd3, 0x44, 0xf0,
+    0x00, 0x46, 0x91, 0xc5, 0x01, 0x24, 0x00, 0x46, 0x79, 0xc5, 0x00, 0xd2,
+    0x00, 0x46, 0x70, 0x11, 0xc2, 0x9b, 0x3f, 0x03, 0x42, 0x9b, 0x4b, 0xda,
+    0x1b, 0xb8, 0x0f, 0x77, 0x81, 0xcc, 0x89, 0xf4, 0x0f, 0x77, 0x88, 0xc3,
+    0x00, 0x2f, 0x0f, 0x70, 0x01, 0xc2, 0x00, 0xaf, 0x0f, 0x70, 0x78, 0xc2,
+    0x00, 0xaf, 0x0f, 0x70, 0x31, 0x8a, 0x0f, 0x70, 0xd0, 0x03, 0xc2, 0x9b,
+    0x53, 0xc2, 0x07, 0x28, 0x0f, 0x70, 0xa9, 0x0a, 0x42, 0x9b, 0x5d, 0xc2,
+    0x0f, 0xbb, 0x0f, 0x70, 0x51, 0xc3, 0x14, 0x15, 0x0f, 0x70, 0xb8, 0xc2,
+    0x03, 0x84, 0x0f, 0x70, 0x59, 0x46, 0xd1, 0x24, 0x42, 0x9b, 0x69, 0xc3,
+    0x02, 0x6e, 0x0f, 0x70, 0x71, 0xc4, 0xe1, 0x20, 0x0f, 0x70, 0xa1, 0x49,
+    0xa7, 0x5e, 0xc2, 0x9b, 0xcd, 0xc2, 0x01, 0xe7, 0x0f, 0x70, 0x88, 0xc3,
+    0x88, 0x5c, 0x0f, 0x71, 0x09, 0xc4, 0x30, 0x3f, 0x0f, 0x71, 0x11, 0x0a,
+    0xc2, 0x9c, 0x1d, 0xc3, 0x2d, 0x8d, 0x0f, 0x71, 0x49, 0x0d, 0xc2, 0x9c,
+    0x29, 0xc3, 0x0e, 0xf0, 0x0f, 0x71, 0x59, 0xc4, 0x1b, 0xb8, 0x0f, 0x71,
+    0x61, 0xc4, 0x3f, 0x67, 0x0f, 0x71, 0x69, 0x15, 0xc2, 0x9c, 0x35, 0xc3,
+    0x00, 0xae, 0x0f, 0x71, 0x79, 0xc3, 0xb3, 0x1e, 0x0f, 0x71, 0x81, 0xc3,
+    0x0f, 0xba, 0x0f, 0x71, 0x91, 0x16, 0xc2, 0x9c, 0x47, 0xc3, 0x6f, 0xce,
+    0x0f, 0x71, 0xc9, 0xc5, 0x93, 0x21, 0x0f, 0x71, 0xd8, 0x01, 0xc2, 0x9c,
+    0x53, 0xc3, 0x0c, 0x85, 0x00, 0x32, 0x62, 0x02, 0x9c, 0x65, 0xc9, 0x33,
+    0x31, 0x00, 0x47, 0xe0, 0xc9, 0x33, 0x31, 0x00, 0x47, 0xe8, 0x45, 0x00,
+    0x92, 0xc2, 0x9c, 0x6b, 0xcd, 0x02, 0x1c, 0x07, 0xf3, 0xb1, 0xcb, 0x64,
+    0x20, 0x07, 0xf3, 0xb8, 0xce, 0x02, 0x1b, 0x07, 0xf3, 0x80, 0x19, 0xc2,
+    0x9c, 0x7d, 0x15, 0xc2, 0x9c, 0x89, 0x08, 0xc2, 0x9c, 0x9b, 0xc4, 0x3f,
+    0x67, 0x00, 0x37, 0x43, 0x02, 0x9c, 0xa7, 0xc3, 0x0f, 0xba, 0x00, 0x46,
+    0xb9, 0xc3, 0x00, 0xae, 0x00, 0x46, 0xb1, 0x42, 0x01, 0x16, 0xc2, 0x9c,
+    0xad, 0xc3, 0x2d, 0x8d, 0x00, 0x37, 0x3b, 0x02, 0x9c, 0xb7, 0x0f, 0xc2,
+    0x9c, 0xbd, 0xd4, 0x39, 0xbe, 0x00, 0x37, 0x09, 0xd8, 0x23, 0x1d, 0x00,
+    0x37, 0x01, 0xcc, 0x84, 0x30, 0x00, 0x36, 0xf9, 0x16, 0xc2, 0x9c, 0xc9,
+    0xc4, 0x30, 0x3f, 0x00, 0x36, 0xd1, 0x0e, 0x42, 0x9c, 0xd5, 0xcf, 0x69,
+    0xcb, 0x00, 0x46, 0xc9, 0x19, 0xc2, 0x9c, 0xe1, 0xc4, 0x1b, 0xb8, 0x00,
+    0x37, 0x69, 0xc4, 0xde, 0x34, 0x00, 0x37, 0x18, 0xc7, 0xbd, 0xf1, 0x00,
+    0x46, 0x49, 0xc3, 0x00, 0xcd, 0x00, 0x30, 0xc0, 0x01, 0x42, 0x9c, 0xed,
+    0xc5, 0x01, 0x24, 0x07, 0xde, 0x09, 0xc5, 0x00, 0xd2, 0x07, 0xde, 0x00,
+    0x48, 0x03, 0x09, 0xc2, 0x9c, 0xff, 0x4a, 0x0f, 0x8d, 0x42, 0x9d, 0x11,
+    0xd7, 0x27, 0x48, 0x07, 0xdd, 0xe1, 0x42, 0x00, 0x32, 0x42, 0x9d, 0x23,
+    0xc5, 0x01, 0x24, 0x07, 0xdd, 0xd9, 0xc5, 0x00, 0xd2, 0x07, 0xdd, 0xd0,
+    0x46, 0xcc, 0xda, 0xc2, 0x9d, 0x2f, 0x03, 0x42, 0x9d, 0x3b, 0xcf, 0x61,
+    0x97, 0x00, 0x30, 0x99, 0xd0, 0x5e, 0x82, 0x00, 0x30, 0x90, 0xcd, 0x02,
+    0x1c, 0x07, 0xf3, 0xe1, 0xcb, 0x64, 0x20, 0x07, 0xf3, 0xe8, 0xc5, 0x01,
+    0x24, 0x00, 0x47, 0x79, 0xc5, 0x00, 0xd2, 0x00, 0x47, 0x60, 0xc5, 0x01,
+    0x24, 0x00, 0x47, 0x71, 0xc5, 0x00, 0xd2, 0x00, 0x47, 0x58, 0xc5, 0x01,
+    0x24, 0x00, 0x47, 0x69, 0xc5, 0x00, 0xd2, 0x00, 0x47, 0x50, 0x46, 0x00,
+    0x91, 0x42, 0x9d, 0x53, 0xc3, 0x0c, 0x85, 0x00, 0x47, 0x48, 0xc3, 0x0c,
+    0x85, 0x00, 0x47, 0x40, 0xc3, 0x0c, 0x85, 0x00, 0x47, 0x38, 0x83, 0x00,
+    0x2b, 0xc9, 0xc2, 0x07, 0x28, 0x00, 0x2b, 0x98, 0x83, 0x00, 0x2a, 0x49,
+    0xc2, 0x07, 0x28, 0x00, 0x2a, 0x18, 0xa1, 0x0f, 0xbb, 0x31, 0xa2, 0x0f,
+    0xbb, 0x39, 0xa3, 0x0f, 0xbb, 0x41, 0xa4, 0x0f, 0xbb, 0x48, 0xc2, 0xe4,
+    0xe8, 0x0f, 0xb9, 0x20, 0xa3, 0x0f, 0xb9, 0xa9, 0xa1, 0x0f, 0xb9, 0x99,
+    0xa2, 0x0f, 0xb9, 0xa0, 0xc8, 0x83, 0x14, 0x0f, 0xb9, 0x83, 0x02, 0x9d,
+    0x65, 0xc4, 0x19, 0x6b, 0x0f, 0xb8, 0xf8, 0xa1, 0x0f, 0xb8, 0x59, 0xa2,
+    0x0f, 0xb8, 0x60, 0x48, 0xb8, 0x48, 0xc2, 0x9d, 0x6b, 0xc8, 0x83, 0x14,
+    0x0f, 0xb9, 0x61, 0xc6, 0x48, 0xeb, 0x0f, 0xb9, 0x10, 0xc8, 0x83, 0x14,
+    0x0f, 0xb9, 0x69, 0xd2, 0x48, 0xeb, 0x0f, 0xb9, 0x30, 0xc2, 0xe4, 0xe8,
+    0x0f, 0xb8, 0x48, 0xc2, 0xe4, 0xe8, 0x0f, 0xb8, 0x38, 0x84, 0x0a, 0x21,
+    0xa1, 0x83, 0x0a, 0x21, 0x98, 0x83, 0x0a, 0x21, 0x88, 0x83, 0x0a, 0x21,
+    0x60, 0x83, 0x0a, 0x21, 0x48, 0x83, 0x0a, 0x20, 0xd8, 0x83, 0x0a, 0x20,
+    0x50, 0x83, 0x0a, 0x22, 0x49, 0x84, 0x0a, 0x22, 0x51, 0x85, 0x0a, 0x22,
+    0x58, 0x83, 0x0a, 0x23, 0x58, 0x83, 0x0a, 0x23, 0x68, 0x83, 0x0a, 0x23,
+    0x80, 0x83, 0x0a, 0x23, 0x90, 0x83, 0x0a, 0x23, 0xa0, 0x83, 0x0a, 0x23,
+    0xb9, 0x84, 0x0a, 0x23, 0xc1, 0x85, 0x0a, 0x23, 0xc8, 0x83, 0x0a, 0x23,
+    0xd9, 0x84, 0x0a, 0x23, 0xe0, 0x83, 0x0a, 0x23, 0xf9, 0x84, 0x0a, 0x24,
+    0x01, 0x85, 0x0a, 0x24, 0x08, 0x83, 0x0a, 0x24, 0x29, 0x84, 0x0a, 0x24,
+    0x30, 0x83, 0x0a, 0x24, 0x60, 0x83, 0x0a, 0x24, 0xb8, 0x83, 0x0a, 0x25,
+    0x10, 0x83, 0x0a, 0x27, 0x31, 0x84, 0x0a, 0x27, 0x38, 0x83, 0x0a, 0x27,
+    0x68, 0x83, 0x0a, 0x27, 0x80, 0x83, 0x0a, 0x27, 0xb8, 0x83, 0x0a, 0x27,
+    0xc8, 0x83, 0x0a, 0x28, 0x28, 0x83, 0x0a, 0x29, 0x70, 0x83, 0x0a, 0x2a,
+    0x28, 0x83, 0x0a, 0x2a, 0x58, 0x83, 0x0a, 0x2a, 0x88, 0x83, 0x0a, 0x2a,
+    0xe0, 0x83, 0x0a, 0x2b, 0x88, 0x83, 0x0a, 0x2b, 0xa1, 0x84, 0x0a, 0x2b,
+    0xa9, 0x85, 0x0a, 0x2b, 0xb0, 0x83, 0x0a, 0x2b, 0xd9, 0x84, 0x0a, 0x2b,
+    0xe1, 0x85, 0x0a, 0x2b, 0xe8, 0x83, 0x0a, 0x2c, 0xa8, 0x83, 0x0a, 0x2c,
+    0xd8, 0x83, 0x0a, 0x2d, 0x00, 0x83, 0x0a, 0x2d, 0x20, 0x83, 0x0a, 0x2d,
+    0x78, 0xc9, 0xb1, 0x5c, 0x0a, 0x2d, 0x89, 0x83, 0x0a, 0x2d, 0x90, 0x83,
+    0x0a, 0x2d, 0xb0, 0xd4, 0x3c, 0xa2, 0x0a, 0x2e, 0x71, 0xd3, 0x41, 0xd2,
+    0x0a, 0x2e, 0x78, 0x83, 0x0a, 0x2f, 0xc0, 0x83, 0x0a, 0x30, 0x00, 0xc4,
+    0x0d, 0xc8, 0x01, 0x1b, 0x01, 0xc5, 0x00, 0x7d, 0x01, 0x19, 0xe0, 0x43,
+    0x04, 0x67, 0xc2, 0x9d, 0x77, 0xc2, 0x01, 0x25, 0x01, 0x1a, 0xa3, 0x02,
+    0x9d, 0x83, 0x0b, 0x42, 0x9d, 0x89, 0xc6, 0xcc, 0x02, 0x01, 0x1a, 0x99,
+    0xcb, 0x02, 0xfe, 0x01, 0x1a, 0x80, 0xcd, 0x09, 0x5c, 0x01, 0x1a, 0x39,
+    0xc7, 0x00, 0xca, 0x01, 0x1a, 0x18, 0xc3, 0xb9, 0xb5, 0x01, 0x1a, 0x71,
+    0xc8, 0x50, 0x50, 0x01, 0x1a, 0x50, 0xd0, 0x5c, 0x92, 0x01, 0x12, 0x90,
+    0x01, 0x42, 0x9d, 0x95, 0xc9, 0x53, 0xcf, 0x08, 0x09, 0x68, 0xc9, 0x53,
+    0xcf, 0x08, 0x09, 0x60, 0x01, 0x42, 0x9d, 0xa1, 0x01, 0x42, 0x9d, 0xad,
+    0xc9, 0x53, 0xcf, 0x08, 0x09, 0x78, 0x01, 0x42, 0x9d, 0xb9, 0xc9, 0x53,
+    0xcf, 0x08, 0x09, 0x70, 0xc7, 0x0c, 0xe7, 0x08, 0x08, 0xf1, 0xc8, 0x53,
+    0xd0, 0x08, 0x09, 0x38, 0xc9, 0x53, 0xcf, 0x08, 0x09, 0x80, 0xc7, 0x0c,
+    0xe7, 0x08, 0x08, 0xf9, 0xc8, 0x53, 0xd0, 0x08, 0x09, 0x40, 0xc9, 0x53,
+    0xcf, 0x08, 0x09, 0x88, 0xd5, 0x38, 0x41, 0x0f, 0xdd, 0x78, 0x48, 0x1f,
+    0xd0, 0xc2, 0x9d, 0xc5, 0x11, 0x42, 0x9d, 0xdd, 0x45, 0x00, 0x6a, 0x42,
+    0x9d, 0xec, 0xd0, 0x57, 0xf2, 0x01, 0x2b, 0xe0, 0x47, 0x54, 0x76, 0xc2,
+    0x9d, 0xfc, 0x49, 0x40, 0xb5, 0x42, 0x9e, 0x08, 0x45, 0x00, 0x6a, 0x42,
+    0x9e, 0x14, 0xc8, 0x03, 0xc1, 0x01, 0x28, 0x51, 0xca, 0x00, 0x4a, 0x01,
+    0x28, 0x40, 0xc8, 0x03, 0xc1, 0x01, 0x28, 0x31, 0xca, 0x00, 0x4a, 0x01,
+    0x28, 0x20, 0xce, 0x6d, 0x84, 0x01, 0x2a, 0x51, 0xc8, 0x11, 0xc7, 0x01,
+    0x29, 0xd1, 0xca, 0x10, 0xdf, 0x01, 0x29, 0x90, 0xce, 0x6d, 0x5a, 0x01,
+    0x29, 0xe9, 0xc8, 0x10, 0xf4, 0x01, 0x29, 0xa9, 0xca, 0x11, 0xda, 0x01,
+    0x29, 0x68, 0x0e, 0xc2, 0x9e, 0x26, 0xca, 0x00, 0x4a, 0x01, 0x29, 0xd9,
+    0xc5, 0x00, 0x64, 0x01, 0x28, 0xb8, 0x45, 0x00, 0x6a, 0x42, 0x9e, 0x32,
+    0xc8, 0x03, 0xc1, 0x01, 0x2a, 0x79, 0xca, 0x00, 0x4a, 0x01, 0x2a, 0x68,
+    0xca, 0x00, 0x4a, 0x01, 0x2a, 0x59, 0xc4, 0x00, 0x2f, 0x01, 0x29, 0x59,
+    0xc5, 0x00, 0x64, 0x01, 0x29, 0x18, 0x45, 0x00, 0x6a, 0x42, 0x9e, 0x44,
+    0xca, 0x00, 0x4a, 0x01, 0x2b, 0x49, 0xc4, 0x00, 0x2f, 0x01, 0x2a, 0xe9,
+    0xc5, 0x00, 0x64, 0x01, 0x2a, 0xd0, 0xca, 0x00, 0x4a, 0x01, 0x2b, 0x31,
+    0xc4, 0x00, 0x2f, 0x01, 0x2a, 0xb9, 0xc5, 0x00, 0x64, 0x01, 0x2a, 0xa0,
+    0xd1, 0x50, 0x7a, 0x01, 0x2b, 0x29, 0xcb, 0x91, 0xe2, 0x01, 0x2a, 0xb1,
+    0xcc, 0x85, 0x98, 0x01, 0x2a, 0x98, 0xd1, 0x50, 0xf1, 0x01, 0x2b, 0x21,
+    0xcb, 0x8e, 0xeb, 0x01, 0x2a, 0xa9, 0xcc, 0x83, 0xdc, 0x01, 0x2a, 0x90,
+    0xd3, 0x42, 0x31, 0x01, 0x2a, 0x39, 0xd0, 0x38, 0x31, 0x01, 0x29, 0x79,
+    0x45, 0x00, 0x2f, 0xc2, 0x9e, 0x56, 0x46, 0x01, 0x78, 0x42, 0x9e, 0x62,
+    0xd3, 0x42, 0x6a, 0x01, 0x2a, 0x09, 0xd0, 0x34, 0x80, 0x01, 0x29, 0x81,
+    0x45, 0x00, 0x2f, 0xc2, 0x9e, 0x6e, 0x46, 0x01, 0x78, 0x42, 0x9e, 0x7a,
+    0xca, 0x10, 0xdf, 0x01, 0x29, 0x51, 0xc5, 0x10, 0xe4, 0x01, 0x28, 0xc8,
+    0xca, 0x10, 0xdf, 0x01, 0x29, 0x11, 0xc5, 0x10, 0xe4, 0x01, 0x28, 0xa8,
+    0xca, 0x11, 0xda, 0x01, 0x29, 0x31, 0xc5, 0x0a, 0x8d, 0x01, 0x28, 0xd0,
+    0xca, 0x11, 0xda, 0x01, 0x28, 0xf1, 0xc5, 0x0a, 0x8d, 0x01, 0x28, 0xb0,
+    0xa5, 0x0f, 0xd9, 0xb0, 0xa4, 0x0f, 0xd8, 0xab, 0x02, 0x9e, 0x86, 0xa3,
+    0x0f, 0xd8, 0x73, 0x02, 0x9e, 0x8a, 0xa5, 0x0f, 0xd9, 0x28, 0xa5, 0x0f,
+    0xd9, 0x80, 0xa5, 0x0f, 0xd9, 0x41, 0xa4, 0x0f, 0xd8, 0xca, 0x02, 0x9e,
+    0x92, 0xa5, 0x0f, 0xd9, 0x51, 0xa4, 0x0f, 0xd8, 0xda, 0x02, 0x9e, 0x96,
+    0xa5, 0x0f, 0xd9, 0xc8, 0xa5, 0x0f, 0xd9, 0x59, 0xa4, 0x0f, 0xd8, 0xe2,
+    0x02, 0x9e, 0x9a, 0xa5, 0x0f, 0xd9, 0x98, 0xa5, 0x0f, 0xd9, 0xb8, 0xca,
+    0xa6, 0x50, 0x0f, 0xd2, 0x4b, 0x02, 0x9e, 0x9e, 0x0d, 0xc2, 0x9e, 0xa4,
+    0xc4, 0xe3, 0x24, 0x01, 0x32, 0xfb, 0x02, 0x9e, 0xb6, 0xc6, 0xd1, 0xd8,
+    0x01, 0x32, 0xeb, 0x02, 0x9e, 0xbc, 0xc4, 0xde, 0xd0, 0x01, 0x32, 0xe3,
+    0x02, 0x9e, 0xc2, 0xc5, 0xb0, 0x06, 0x01, 0x32, 0xdb, 0x02, 0x9e, 0xc8,
+    0x47, 0x46, 0x0d, 0x42, 0x9e, 0xce, 0x4e, 0x6c, 0xf8, 0xc2, 0x9e, 0xea,
+    0x4e, 0x0e, 0x34, 0xc2, 0x9e, 0xf6, 0x4c, 0x12, 0x57, 0xc2, 0x9f, 0x02,
+    0x4f, 0x62, 0x4b, 0x42, 0x9f, 0x0e, 0x01, 0x42, 0x9f, 0x1a, 0xc6, 0x09,
+    0x2b, 0x0f, 0xbc, 0x69, 0xc6, 0x00, 0x7c, 0x0f, 0xbc, 0x20, 0xca, 0x85,
+    0xfa, 0x01, 0x31, 0xd9, 0x44, 0x00, 0xb7, 0x42, 0x9f, 0x26, 0x01, 0x42,
+    0x9f, 0x36, 0xc6, 0x09, 0x2b, 0x0f, 0xbc, 0x61, 0xc7, 0x3f, 0x57, 0x0f,
+    0xbc, 0xb9, 0xc7, 0x0a, 0x42, 0x0f, 0xbc, 0xe8, 0x4a, 0x01, 0x4b, 0xc2,
+    0x9f, 0x48, 0xd8, 0x24, 0x9d, 0x0f, 0xad, 0x19, 0xdb, 0x01, 0xce, 0x01,
+    0x5c, 0xf8, 0x01, 0x42, 0x9f, 0x60, 0x47, 0xb8, 0xf1, 0xc2, 0x9f, 0x7e,
+    0xc5, 0xd3, 0xe1, 0x0f, 0x99, 0x10, 0x4a, 0x01, 0x4b, 0xc2, 0x9f, 0x8a,
+    0x46, 0x00, 0x71, 0xc2, 0x9f, 0xac, 0x4a, 0x09, 0x9f, 0x42, 0x9f, 0xc1,
+    0x4a, 0x01, 0x4b, 0xc2, 0x9f, 0xcd, 0x01, 0xc2, 0x9f, 0xee, 0x46, 0x00,
+    0x71, 0x42, 0x9f, 0xfa, 0x44, 0x00, 0x2b, 0xc2, 0xa0, 0x06, 0xc5, 0x0a,
+    0x44, 0x01, 0x4f, 0x58, 0xc6, 0x09, 0x2b, 0x01, 0x58, 0xd9, 0xc6, 0x00,
+    0x7c, 0x01, 0x59, 0x20, 0xc6, 0x07, 0x23, 0x01, 0x39, 0xf9, 0xc2, 0x00,
+    0xea, 0x01, 0x34, 0x88, 0xcf, 0x66, 0x83, 0x01, 0x39, 0x31, 0xc4, 0x15,
+    0xf7, 0x0f, 0xad, 0xf8, 0x15, 0xc2, 0xa0, 0x12, 0x06, 0xc2, 0xa0, 0x1e,
+    0xd4, 0x3d, 0xa6, 0x01, 0x1f, 0xb3, 0x02, 0xa0, 0x2d, 0xd7, 0x2a, 0xf7,
+    0x01, 0x1f, 0xab, 0x02, 0xa0, 0x33, 0x0e, 0x42, 0xa0, 0x39, 0x44, 0x06,
+    0x52, 0xc2, 0xa0, 0x48, 0x4a, 0x01, 0x4b, 0xc2, 0xa0, 0x54, 0xd8, 0x24,
+    0x9d, 0x0f, 0xad, 0x11, 0xdb, 0x01, 0xce, 0x01, 0x5c, 0xe8, 0xc3, 0x06,
+    0x7d, 0x0f, 0xad, 0x23, 0x02, 0xa0, 0x6c, 0xc5, 0xc0, 0x17, 0x01, 0x59,
+    0x10, 0xc7, 0xc6, 0xdd, 0x01, 0x4e, 0xb9, 0xd0, 0x57, 0xa2, 0x01, 0x59,
+    0x60, 0xc4, 0x2c, 0x09, 0x0f, 0x9f, 0x91, 0xc5, 0xb5, 0x8b, 0x01, 0x58,
+    0xf8, 0xc9, 0x43, 0x2e, 0x01, 0x2d, 0x71, 0xc7, 0x57, 0xab, 0x01, 0x59,
+    0x70, 0xc6, 0x09, 0x2b, 0x01, 0x58, 0xe9, 0xc7, 0x3f, 0x57, 0x0f, 0xbc,
+    0xc1, 0xc7, 0x0a, 0x42, 0x0f, 0xbc, 0xf0, 0x9a, 0x01, 0x30, 0x83, 0x02,
+    0xa0, 0x72, 0xcb, 0x8d, 0x5f, 0x0f, 0xaf, 0xb0, 0xc8, 0xba, 0x48, 0x00,
+    0xdb, 0xf0, 0xc3, 0x00, 0xb1, 0x00, 0xdb, 0xe1, 0xc3, 0x38, 0x9c, 0x00,
+    0xdb, 0xc9, 0xc3, 0x00, 0xc4, 0x00, 0xdb, 0xc0, 0xc2, 0x14, 0x13, 0x00,
+    0xdb, 0xd9, 0xc2, 0x07, 0x42, 0x00, 0xdb, 0xd0, 0xc2, 0x07, 0x42, 0x00,
+    0xdb, 0xb9, 0xc2, 0x14, 0x13, 0x00, 0xdb, 0xb0, 0xc2, 0x00, 0xea, 0x00,
+    0xdb, 0xa9, 0xc2, 0x05, 0xa9, 0x00, 0xdb, 0xa0, 0xc2, 0x00, 0xdf, 0x00,
+    0xdb, 0x73, 0x02, 0xa0, 0x78, 0xc2, 0x04, 0x51, 0x00, 0xdb, 0x6a, 0x02,
+    0xa0, 0x7e, 0xc2, 0x00, 0xb2, 0x00, 0xdb, 0x23, 0x02, 0xa0, 0x84, 0xc3,
+    0x00, 0xb1, 0x00, 0xdb, 0x49, 0xc3, 0x0a, 0x45, 0x00, 0xdb, 0x38, 0xc3,
+    0x38, 0x9c, 0x00, 0xdb, 0x41, 0xc2, 0x00, 0xb2, 0x00, 0xdb, 0x10, 0xc7,
+    0xc5, 0x5c, 0x00, 0xd8, 0x30, 0x01, 0x42, 0xa0, 0x88, 0xc7, 0xc3, 0x64,
+    0x00, 0xda, 0x29, 0xca, 0x66, 0x1f, 0x00, 0xd8, 0xa0, 0xc2, 0x04, 0xf2,
+    0x00, 0xd9, 0x89, 0xc2, 0x00, 0xeb, 0x00, 0xd9, 0x80, 0xc7, 0xc5, 0x5c,
+    0x00, 0xd8, 0x70, 0xc7, 0xc5, 0x5c, 0x00, 0xd8, 0x60, 0xc7, 0xc3, 0x87,
+    0x00, 0xd9, 0x08, 0xc3, 0x63, 0x6c, 0x00, 0xd9, 0x29, 0x45, 0x66, 0x1b,
+    0x42, 0xa0, 0x9a, 0x01, 0x42, 0xa0, 0xa6, 0x0d, 0xc2, 0xa0, 0xb5, 0x97,
+    0x0b, 0x50, 0x21, 0xc4, 0xde, 0x44, 0x0b, 0x51, 0xc1, 0x15, 0xc2, 0xa0,
+    0xd1, 0x16, 0xc2, 0xa0, 0xeb, 0x8f, 0x0b, 0x50, 0x8b, 0x02, 0xa0, 0xf5,
+    0x14, 0xc2, 0xa1, 0x07, 0x0e, 0xc2, 0xa1, 0x13, 0x19, 0xc2, 0xa1, 0x21,
+    0xc3, 0xe5, 0xc8, 0x0b, 0x51, 0x59, 0x12, 0xc2, 0xa1, 0x2b, 0x10, 0xc2,
+    0xa1, 0x35, 0x1b, 0xc2, 0xa1, 0x60, 0xc2, 0x00, 0xc8, 0x0b, 0x50, 0x30,
+    0x09, 0xc2, 0xa1, 0x6a, 0x19, 0xc2, 0xa1, 0x74, 0x0d, 0xc2, 0xa1, 0x7e,
+    0x10, 0xc2, 0xa1, 0x94, 0x16, 0xc2, 0xa1, 0xc1, 0x12, 0xc2, 0xa1, 0xd1,
+    0x14, 0xc2, 0xa1, 0xee, 0x15, 0xc2, 0xa1, 0xfe, 0x0e, 0xc2, 0xa2, 0x18,
+    0x18, 0xc2, 0xa2, 0x2a, 0x0f, 0xc2, 0xa2, 0x34, 0x08, 0xc2, 0xa2, 0x6c,
+    0x1b, 0xc2, 0xa2, 0x83, 0x8b, 0x0b, 0x4e, 0xc1, 0x91, 0x0b, 0x4e, 0xb9,
+    0x83, 0x0b, 0x4e, 0xa8, 0x10, 0xc2, 0xa2, 0x9d, 0x0e, 0xc2, 0xa2, 0xbd,
+    0x8f, 0x0b, 0x4a, 0x8b, 0x02, 0xa2, 0xd3, 0x16, 0xc2, 0xa2, 0xf9, 0x0d,
+    0xc2, 0xa3, 0x14, 0x15, 0xc2, 0xa3, 0x2b, 0x08, 0xc2, 0xa3, 0x43, 0x1b,
+    0xc2, 0xa3, 0x4f, 0x14, 0xc2, 0xa3, 0x5f, 0x12, 0xc2, 0xa3, 0x71, 0x42,
+    0x00, 0x09, 0xc2, 0xa3, 0x85, 0x19, 0x42, 0xa3, 0x91, 0x0d, 0xc2, 0xa3,
+    0x9d, 0x15, 0xc2, 0xa3, 0xb1, 0x16, 0xc2, 0xa3, 0xbf, 0x12, 0xc2, 0xa3,
+    0xcf, 0x0e, 0xc2, 0xa3, 0xd9, 0x10, 0xc2, 0xa3, 0xe7, 0x0f, 0xc2, 0xa4,
+    0x09, 0x1b, 0xc2, 0xa4, 0x23, 0x19, 0xc2, 0xa4, 0x33, 0xc2, 0x16, 0x36,
+    0x0b, 0x46, 0x19, 0x43, 0x27, 0xfe, 0xc2, 0xa4, 0x3f, 0xc4, 0xe0, 0x68,
+    0x0b, 0x46, 0x01, 0xc3, 0xe5, 0xcb, 0x0b, 0x45, 0xe1, 0x09, 0x42, 0xa4,
+    0x49, 0x10, 0xc2, 0xa4, 0x55, 0x0f, 0xc2, 0xa4, 0x6d, 0x12, 0xc2, 0xa4,
+    0x88, 0x47, 0xc3, 0x33, 0xc2, 0xa4, 0xa0, 0x0d, 0xc2, 0xa4, 0xaa, 0x0e,
+    0xc2, 0xa4, 0xba, 0x42, 0x15, 0x48, 0xc2, 0xa4, 0xca, 0x15, 0xc2, 0xa4,
+    0xd4, 0x16, 0xc2, 0xa4, 0xf2, 0xc5, 0xdb, 0x2f, 0x0b, 0x43, 0xb1, 0xc4,
+    0xde, 0x90, 0x0b, 0x43, 0x99, 0x1b, 0x42, 0xa4, 0xfe, 0xc3, 0x14, 0xf4,
+    0x0b, 0x42, 0x91, 0x15, 0xc2, 0xa5, 0x0a, 0x16, 0xc2, 0xa5, 0x24, 0x0d,
+    0xc2, 0xa5, 0x34, 0x0f, 0xc2, 0xa5, 0x48, 0x10, 0xc2, 0xa5, 0x68, 0x0e,
+    0xc2, 0xa5, 0x9e, 0x12, 0xc2, 0xa5, 0xb7, 0x17, 0xc2, 0xa5, 0xcd, 0xc3,
+    0x08, 0x3b, 0x0b, 0x41, 0xd1, 0xc4, 0xe1, 0x34, 0x0b, 0x41, 0xc9, 0x09,
+    0x42, 0xa5, 0xd9, 0xc7, 0xc6, 0xf9, 0x00, 0xdf, 0xf9, 0xc9, 0xac, 0xee,
+    0x00, 0xdf, 0xe8, 0x49, 0xb0, 0x69, 0x42, 0xa5, 0xe5, 0xc2, 0x00, 0x89,
+    0x00, 0xde, 0xf9, 0xc2, 0x1a, 0x18, 0x00, 0xde, 0xe1, 0xc2, 0x0d, 0x01,
+    0x00, 0xde, 0xc9, 0xc2, 0x00, 0xb6, 0x00, 0xde, 0xa9, 0xc2, 0x00, 0x3b,
+    0x00, 0xde, 0x99, 0xc2, 0x00, 0xeb, 0x00, 0xde, 0x79, 0xc2, 0x00, 0x71,
+    0x00, 0xde, 0x61, 0xc2, 0x04, 0xf2, 0x00, 0xde, 0x41, 0xc2, 0x00, 0xce,
+    0x00, 0xde, 0x19, 0x83, 0x00, 0xde, 0x08, 0xc7, 0x14, 0x03, 0x00, 0x4c,
+    0x11, 0xc7, 0x7e, 0x15, 0x00, 0x4d, 0xe8, 0xc5, 0x40, 0xb0, 0x00, 0x4c,
+    0x19, 0xc4, 0x1f, 0xf7, 0x00, 0x4e, 0x68, 0x94, 0x00, 0x4c, 0x5b, 0x02,
+    0xa5, 0xf7, 0x8e, 0x00, 0x4c, 0x62, 0x02, 0xa5, 0xfb, 0xc6, 0xca, 0xee,
+    0x00, 0x4e, 0x70, 0x83, 0x00, 0x4c, 0xf9, 0xc2, 0x00, 0xce, 0x00, 0x4d,
+    0x00, 0x83, 0x00, 0x4d, 0x09, 0xc2, 0x00, 0xce, 0x00, 0x4d, 0x10, 0x46,
+    0x00, 0x91, 0x42, 0xa5, 0xff, 0x94, 0x00, 0x4e, 0x20, 0x8e, 0x00, 0x4f,
+    0x18, 0xda, 0x1d, 0x0a, 0x00, 0x4f, 0xc0, 0xc2, 0x01, 0xa2, 0x00, 0x4f,
+    0xa9, 0xc4, 0x03, 0xe0, 0x00, 0x4f, 0xb0, 0xc2, 0x03, 0xc6, 0x00, 0xd0,
+    0x79, 0x83, 0x00, 0xd0, 0x70, 0xc2, 0x02, 0x4d, 0x00, 0xd0, 0x19, 0x83,
+    0x00, 0xd0, 0x10, 0xa6, 0x01, 0x43, 0x03, 0x02, 0xa6, 0x0b, 0xa7, 0x01,
+    0x45, 0x00, 0xa1, 0x01, 0x40, 0x1b, 0x02, 0xa6, 0x0f, 0xa2, 0x01, 0x40,
+    0x2b, 0x02, 0xa6, 0x36, 0xa3, 0x01, 0x40, 0x4b, 0x02, 0xa6, 0x56, 0xa4,
+    0x01, 0x40, 0x8b, 0x02, 0xa6, 0x6f, 0xa7, 0x01, 0x44, 0x09, 0xa5, 0x01,
+    0x41, 0x0b, 0x02, 0xa6, 0x81, 0xa6, 0x01, 0x42, 0x0a, 0x02, 0xa6, 0x8c,
+    0xa2, 0x01, 0x40, 0x33, 0x02, 0xa6, 0x90, 0xa3, 0x01, 0x40, 0x53, 0x02,
+    0xa6, 0xb0, 0xa4, 0x01, 0x40, 0x93, 0x02, 0xa6, 0xc9, 0xa7, 0x01, 0x44,
+    0x11, 0xa5, 0x01, 0x41, 0x13, 0x02, 0xa6, 0xdb, 0xa6, 0x01, 0x42, 0x12,
+    0x02, 0xa6, 0xe6, 0xa3, 0x01, 0x40, 0x63, 0x02, 0xa6, 0xea, 0xa4, 0x01,
+    0x40, 0xa3, 0x02, 0xa7, 0x03, 0xa7, 0x01, 0x44, 0x21, 0xa5, 0x01, 0x41,
+    0x23, 0x02, 0xa7, 0x15, 0xa6, 0x01, 0x42, 0x22, 0x02, 0xa7, 0x20, 0xa4,
+    0x01, 0x40, 0xc3, 0x02, 0xa7, 0x24, 0xa7, 0x01, 0x44, 0x41, 0xa5, 0x01,
+    0x41, 0x43, 0x02, 0xa7, 0x36, 0xa6, 0x01, 0x42, 0x42, 0x02, 0xa7, 0x41,
+    0xa7, 0x01, 0x44, 0x81, 0xa5, 0x01, 0x41, 0x83, 0x02, 0xa7, 0x45, 0xa6,
+    0x01, 0x42, 0x82, 0x02, 0xa7, 0x50, 0xa7, 0x01, 0x46, 0x00, 0xc8, 0x53,
+    0xd0, 0x08, 0x83, 0x29, 0xc7, 0x0c, 0xe7, 0x08, 0x83, 0x20, 0xc2, 0x0c,
+    0xf3, 0x08, 0x83, 0x08, 0xc2, 0x0c, 0xf3, 0x08, 0x83, 0x00, 0xc3, 0x43,
+    0x20, 0x08, 0x82, 0xf9, 0xc2, 0x00, 0x98, 0x08, 0x82, 0xb0, 0xc3, 0x0c,
+    0xf2, 0x08, 0x82, 0xf1, 0xc2, 0x00, 0x35, 0x08, 0x82, 0xa8, 0xc4, 0x0c,
+    0xf1, 0x08, 0x82, 0xe9, 0xc3, 0x03, 0xe1, 0x08, 0x82, 0xa0, 0xc4, 0x17,
+    0xf9, 0x08, 0x82, 0xe1, 0x91, 0x08, 0x82, 0x98, 0x42, 0x00, 0xb8, 0xc2,
+    0xa7, 0x54, 0x46, 0x2c, 0x9e, 0xc2, 0xa7, 0x5e, 0xc4, 0xdd, 0xbd, 0x08,
+    0x81, 0xb9, 0xc3, 0x7c, 0x6b, 0x08, 0x81, 0xb0, 0xc2, 0x00, 0xce, 0x08,
+    0x81, 0x01, 0x83, 0x08, 0x80, 0xf8, 0xc2, 0x00, 0xce, 0x08, 0x80, 0xf1,
+    0x83, 0x08, 0x80, 0xe8, 0x8e, 0x08, 0x80, 0x6b, 0x02, 0xa7, 0x66, 0x94,
+    0x08, 0x80, 0x5a, 0x02, 0xa7, 0x6a, 0x4f, 0x6b, 0x51, 0x42, 0xa7, 0x6e,
+    0x97, 0x08, 0x82, 0x29, 0x8b, 0x08, 0x82, 0x19, 0x83, 0x08, 0x81, 0xc0,
+    0x8e, 0x08, 0x82, 0x03, 0x02, 0xa7, 0x76, 0x94, 0x08, 0x81, 0xf2, 0x02,
+    0xa7, 0x7a, 0x97, 0x08, 0x81, 0xe8, 0x8b, 0x08, 0x81, 0xd8, 0xc4, 0x17,
+    0xf7, 0x08, 0x83, 0x69, 0xc2, 0x24, 0x36, 0x08, 0x83, 0x60, 0xc3, 0x0c,
+    0xf7, 0x08, 0x83, 0x59, 0xc3, 0x04, 0xa0, 0x08, 0x83, 0x50, 0xc4, 0x03,
+    0xe0, 0x08, 0x83, 0x49, 0xc2, 0x01, 0xa2, 0x08, 0x83, 0x40, 0x44, 0xe4,
+    0x5c, 0xc2, 0xa7, 0x7e, 0x4e, 0x6a, 0xe9, 0xc2, 0xa7, 0x8a, 0xc8, 0x9d,
+    0xec, 0x0e, 0x80, 0xb0, 0xc4, 0x90, 0x5b, 0x0e, 0x87, 0x99, 0xc4, 0xe4,
+    0x38, 0x0e, 0x87, 0x89, 0xc3, 0x21, 0xe3, 0x0e, 0x82, 0x78, 0x44, 0xe4,
+    0x5c, 0xc2, 0xa7, 0x96, 0xc8, 0x9d, 0xec, 0x0e, 0x80, 0xe0, 0x01, 0xc2,
+    0xa7, 0xa8, 0xc2, 0x00, 0x51, 0x0e, 0x81, 0x90, 0xc8, 0xbb, 0x48, 0x0e,
+    0x82, 0xa1, 0xc8, 0xb0, 0xb2, 0x0e, 0x82, 0x60, 0x42, 0x02, 0x31, 0xc2,
+    0xa7, 0xb2, 0x95, 0x0e, 0x80, 0x8a, 0x02, 0xa7, 0xbe, 0xc3, 0x55, 0xc8,
+    0x0e, 0x84, 0x21, 0xc8, 0x9d, 0xec, 0x0e, 0x81, 0x10, 0x16, 0xc2, 0xa7,
+    0xc2, 0xc7, 0xc4, 0x9f, 0x0e, 0x87, 0x18, 0x16, 0xc2, 0xa7, 0xce, 0xc7,
+    0xc4, 0x9f, 0x0e, 0x86, 0xf8, 0xc3, 0x55, 0xc8, 0x0e, 0x83, 0x29, 0xcc,
+    0x81, 0x6c, 0x0e, 0x81, 0x59, 0xc8, 0x9d, 0xec, 0x0e, 0x81, 0x50, 0x4f,
+    0x6a, 0xe8, 0x42, 0xa7, 0xda, 0xc7, 0xc4, 0xfa, 0x0e, 0x86, 0xe9, 0xc5,
+    0xcc, 0x99, 0x0e, 0x86, 0xe1, 0x46, 0xcd, 0x88, 0x42, 0xa7, 0xe6, 0x42,
+    0x00, 0x4c, 0xc2, 0xa7, 0xf2, 0xcc, 0x2f, 0x94, 0x0e, 0x86, 0x78, 0xd5,
+    0x33, 0x40, 0x0e, 0x86, 0xb9, 0xc8, 0x2f, 0x98, 0x0e, 0x86, 0x68, 0xc6,
+    0xcc, 0x98, 0x0e, 0x80, 0x58, 0xc6, 0xd1, 0x6c, 0x0e, 0x86, 0x31, 0xc5,
+    0x19, 0x77, 0x0e, 0x86, 0x28, 0x42, 0x02, 0x31, 0xc2, 0xa7, 0xfe, 0xc3,
+    0x0d, 0xc2, 0x0e, 0x85, 0xd8, 0xc2, 0x00, 0x47, 0x0e, 0x85, 0xc1, 0x83,
+    0x0e, 0x81, 0xa8, 0xce, 0x6b, 0x7e, 0x0e, 0x85, 0x99, 0xc5, 0x6b, 0x87,
+    0x0e, 0x85, 0x58, 0xcb, 0x95, 0xaa, 0x0e, 0x85, 0x91, 0xc7, 0x6b, 0x85,
+    0x0e, 0x85, 0x10, 0xcd, 0x7e, 0x1c, 0x0e, 0x85, 0x49, 0xc5, 0x6b, 0x87,
+    0x0e, 0x85, 0x40, 0xc6, 0x90, 0x50, 0x0e, 0x85, 0x39, 0xc9, 0x6b, 0x83,
+    0x0e, 0x85, 0x30, 0xca, 0x90, 0x36, 0x0e, 0x83, 0x71, 0xc8, 0xba, 0xd8,
+    0x0e, 0x83, 0x58, 0xc3, 0x55, 0xc8, 0x0e, 0x83, 0x19, 0x03, 0x42, 0xa8,
+    0x0a, 0xc7, 0xc2, 0x84, 0x0e, 0x83, 0xc1, 0x48, 0xb9, 0x28, 0x42, 0xa8,
+    0x16, 0xcf, 0x60, 0x02, 0x0e, 0x84, 0x69, 0xcc, 0x8c, 0x04, 0x0e, 0x84,
+    0x60, 0xc4, 0x7c, 0x10, 0x0e, 0x82, 0xd0, 0xc3, 0x55, 0xc8, 0x0e, 0x82,
+    0xf9, 0xc8, 0x9d, 0xec, 0x0e, 0x81, 0xe8, 0x01, 0x42, 0xa8, 0x22, 0xc9,
+    0xb0, 0xb1, 0x0e, 0x82, 0x59, 0x8b, 0x0e, 0x82, 0x48, 0x5b, 0x18, 0x71,
+    0xc2, 0xa8, 0x2e, 0x46, 0x06, 0x50, 0x42, 0xa8, 0x3a, 0xc6, 0x09, 0x2b,
+    0x01, 0x3a, 0x89, 0xc6, 0x00, 0x7c, 0x0f, 0xa9, 0xf0, 0xc6, 0x07, 0x83,
+    0x0f, 0xda, 0x09, 0xc5, 0x00, 0x64, 0x0f, 0xda, 0x10, 0x55, 0x17, 0x18,
+    0xc2, 0xa8, 0x4c, 0x48, 0x07, 0x75, 0xc2, 0xa8, 0x5e, 0x4a, 0x12, 0xcd,
+    0x42, 0xa8, 0x6a, 0xc7, 0x18, 0x19, 0x01, 0x52, 0x91, 0x45, 0x03, 0x7c,
+    0x42, 0xa8, 0x76, 0xc7, 0x78, 0xa6, 0x01, 0x52, 0xf1, 0xc8, 0x50, 0x50,
+    0x01, 0x53, 0x00, 0x46, 0x01, 0x78, 0xc2, 0xa8, 0x82, 0x46, 0x00, 0x29,
+    0xc2, 0xa8, 0x8c, 0x46, 0x06, 0x50, 0x42, 0xa8, 0x98, 0xca, 0x08, 0x56,
+    0x01, 0x80, 0x43, 0x02, 0xa8, 0xa4, 0xc9, 0xab, 0xe9, 0x0f, 0xaf, 0x70,
+    0xcc, 0x11, 0xf5, 0x01, 0x59, 0x81, 0xcc, 0x8c, 0x28, 0x01, 0x59, 0x90,
+    0xe0, 0x0b, 0x89, 0x0f, 0xdc, 0xa0, 0x46, 0x00, 0x91, 0x42, 0xa8, 0xaa,
+    0x44, 0x06, 0x66, 0xc2, 0xa8, 0xba, 0xc3, 0x04, 0x5c, 0x01, 0x2c, 0x60,
+    0x01, 0x42, 0xa8, 0xc6, 0x46, 0x00, 0x91, 0x42, 0xa8, 0xd2, 0xc9, 0xa8,
+    0xda, 0x01, 0x0d, 0x69, 0xca, 0x03, 0x3f, 0x01, 0x58, 0x20, 0xcc, 0x8b,
+    0xd4, 0x01, 0x1d, 0x19, 0xc9, 0x54, 0x6d, 0x01, 0x1d, 0x11, 0xcc, 0x8b,
+    0x98, 0x01, 0x1d, 0x09, 0x45, 0x00, 0x92, 0x42, 0xa8, 0xde, 0xca, 0xa4,
+    0xa2, 0x01, 0x1d, 0x49, 0xcc, 0x80, 0x58, 0x01, 0x1d, 0x41, 0xca, 0xa3,
+    0x3a, 0x01, 0x1d, 0x38, 0xcd, 0x46, 0x5f, 0x01, 0x2c, 0x69, 0xce, 0x06,
+    0x7b, 0x01, 0x2c, 0x50, 0xd6, 0x2d, 0xbc, 0x01, 0x4e, 0x79, 0xd6, 0x15,
+    0xd3, 0x0f, 0xdb, 0x60, 0xcc, 0x00, 0x35, 0x01, 0x4c, 0x19, 0xcd, 0x69,
+    0xfa, 0x01, 0x80, 0x70, 0xcc, 0x81, 0x54, 0x01, 0x4a, 0x81, 0xca, 0x9b,
+    0x24, 0x01, 0x4a, 0x58, 0xca, 0x9b, 0x24, 0x01, 0x4a, 0x71, 0xcc, 0x81,
+    0x54, 0x01, 0x4a, 0x50, 0xca, 0x01, 0xdf, 0x0f, 0xc4, 0x81, 0x48, 0x02,
+    0xbc, 0x42, 0xa8, 0xfc, 0xc5, 0x00, 0x83, 0x01, 0x0e, 0xd1, 0xca, 0x50,
+    0xd6, 0x01, 0x48, 0x70, 0x46, 0x01, 0x7e, 0xc2, 0xa9, 0x11, 0xd1, 0x50,
+    0xcf, 0x01, 0x59, 0xb8, 0xd9, 0x20, 0x91, 0x0f, 0xc0, 0x21, 0x15, 0xc2,
+    0xa9, 0x1d, 0x42, 0x00, 0xd8, 0xc2, 0xa9, 0x29, 0xcf, 0x2c, 0xa4, 0x01,
+    0x0f, 0xb9, 0x0e, 0xc2, 0xa9, 0x35, 0xc4, 0x06, 0x45, 0x01, 0x0d, 0x49,
+    0x16, 0xc2, 0xa9, 0x41, 0xca, 0x9c, 0x96, 0x01, 0x4a, 0x31, 0xd5, 0x01,
+    0xd4, 0x0f, 0xc0, 0xa1, 0xcc, 0x84, 0x9c, 0x0f, 0xc4, 0xc0, 0x43, 0x10,
+    0x66, 0xc2, 0xa9, 0x50, 0x47, 0x21, 0xa5, 0x42, 0xa9, 0x5f, 0xd1, 0x4f,
+    0x37, 0x01, 0x48, 0xf8, 0x45, 0x00, 0xd3, 0xc2, 0xa9, 0x6f, 0x43, 0x00,
+    0x6c, 0x42, 0xa9, 0x87, 0x01, 0xc2, 0xa9, 0x8d, 0xc5, 0x14, 0xc3, 0x01,
+    0x48, 0xd8, 0xd7, 0x29, 0x9e, 0x01, 0x0e, 0x59, 0x4a, 0x05, 0x3b, 0x42,
+    0xa9, 0x99, 0xc6, 0x0e, 0xc4, 0x01, 0x53, 0xf9, 0xc5, 0x00, 0xd2, 0x01,
+    0x54, 0x0a, 0x02, 0xa9, 0xa5, 0xc8, 0x24, 0x62, 0x01, 0x54, 0x69, 0xd2,
+    0x06, 0x97, 0x01, 0x54, 0x78, 0xe0, 0x06, 0x09, 0x01, 0x54, 0x98, 0xe0,
+    0x06, 0xe9, 0x01, 0x3b, 0x98, 0xcf, 0x17, 0x39, 0x0f, 0xbd, 0x79, 0xd2,
+    0x23, 0xcb, 0x0f, 0xbe, 0x48, 0xc4, 0x0d, 0xf4, 0x0f, 0xbe, 0x21, 0xc4,
+    0x10, 0x84, 0x01, 0x5e, 0x60, 0xc2, 0x00, 0x45, 0x05, 0x27, 0xc1, 0xc3,
+    0xe4, 0xa2, 0x05, 0x27, 0xd1, 0xc2, 0x00, 0xd3, 0x05, 0x27, 0xd9, 0xc2,
+    0x03, 0x83, 0x05, 0x27, 0xe1, 0xc3, 0xe5, 0x68, 0x05, 0x27, 0xe8, 0xdd,
+    0x12, 0x01, 0x01, 0x50, 0x99, 0xdc, 0x13, 0x8b, 0x01, 0x50, 0x90, 0xa6,
+    0x08, 0x3b, 0x39, 0xa5, 0x08, 0x3b, 0x31, 0xa4, 0x08, 0x3b, 0x29, 0xa3,
+    0x08, 0x3b, 0x21, 0xa2, 0x08, 0x3b, 0x19, 0xa1, 0x08, 0x3b, 0x11, 0xa0,
+    0x08, 0x3b, 0x09, 0x9f, 0x08, 0x3b, 0x00, 0xc5, 0xd7, 0xb5, 0x08, 0x3a,
+    0xa9, 0xc7, 0xc2, 0x92, 0x08, 0x3a, 0xa1, 0x20, 0xc2, 0xa9, 0xab, 0x1f,
+    0x42, 0xa9, 0xd5, 0x24, 0xc2, 0xaa, 0x09, 0x23, 0xc2, 0xaa, 0x2d, 0x22,
+    0xc2, 0xaa, 0x4d, 0x20, 0xc2, 0xaa, 0x59, 0x21, 0xc2, 0xaa, 0x81, 0x25,
+    0xc2, 0xaa, 0xa5, 0x1f, 0x42, 0xaa, 0xb9, 0x1f, 0xc2, 0xaa, 0xd9, 0x20,
+    0x42, 0xaa, 0xfd, 0xc6, 0xcf, 0x56, 0x08, 0x32, 0x39, 0xc3, 0xe4, 0xf9,
+    0x08, 0x32, 0x79, 0xc3, 0xe4, 0xdb, 0x08, 0x32, 0x50, 0x1f, 0xc2, 0xab,
+    0x23, 0x20, 0xc2, 0xab, 0x47, 0x21, 0xc2, 0xab, 0x6f, 0x22, 0xc2, 0xab,
+    0x97, 0x23, 0xc2, 0xab, 0xbf, 0x24, 0xc2, 0xab, 0xe7, 0x25, 0xc2, 0xac,
+    0x0f, 0x26, 0x42, 0xac, 0x37, 0x1f, 0xc2, 0xac, 0x3f, 0x20, 0x42, 0xac,
+    0x7b, 0x1f, 0xc2, 0xac, 0xb1, 0x20, 0xc2, 0xac, 0xd1, 0x21, 0xc2, 0xac,
+    0xe9, 0x22, 0xc2, 0xad, 0x0d, 0x23, 0xc2, 0xad, 0x31, 0x24, 0xc2, 0xad,
+    0x4d, 0x25, 0xc2, 0xad, 0x71, 0x26, 0xc2, 0xad, 0x89, 0x27, 0xc2, 0xad,
+    0xb1, 0x28, 0x42, 0xad, 0xd9, 0x49, 0xaa, 0x81, 0xc2, 0xad, 0xf1, 0x47,
+    0xc4, 0xad, 0x42, 0xae, 0x19, 0x04, 0xc2, 0xae, 0x41, 0x48, 0xb8, 0xf8,
+    0x42, 0xae, 0x49, 0x20, 0xc2, 0xae, 0x59, 0xc9, 0xa7, 0xde, 0x08, 0x06,
+    0x90, 0x83, 0x00, 0xc9, 0xa1, 0xc2, 0x00, 0xeb, 0x00, 0xc9, 0x88, 0x91,
+    0x00, 0xc9, 0x28, 0x87, 0x00, 0xc9, 0x18, 0x97, 0x00, 0xc9, 0x31, 0x8b,
+    0x00, 0xc9, 0x20, 0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x59, 0xc6, 0x00, 0x7c,
+    0x0f, 0xbf, 0x20, 0xc7, 0x3f, 0x57, 0x0f, 0xa9, 0xb9, 0xc6, 0x00, 0x7c,
+    0x0f, 0xa9, 0xa9, 0xc6, 0x09, 0x2b, 0x0f, 0xbf, 0x30, 0xdf, 0x0d, 0x5f,
+    0x08, 0x59, 0xf9, 0xdd, 0x10, 0x31, 0x08, 0x59, 0xe8, 0xc7, 0x3f, 0x57,
+    0x0f, 0xa9, 0xb1, 0xc6, 0x00, 0x7c, 0x0f, 0xbf, 0x01, 0xc6, 0x09, 0x2b,
+    0x0f, 0xbf, 0x38, 0xdf, 0x0c, 0x48, 0x08, 0x59, 0xf1, 0xdd, 0x05, 0x0c,
+    0x08, 0x59, 0xe0, 0x95, 0x00, 0x03, 0x9b, 0x02, 0xae, 0x67, 0x85, 0x00,
+    0x03, 0x1b, 0x02, 0xae, 0x8b, 0x96, 0x00, 0x03, 0xa3, 0x02, 0xae, 0xaf,
+    0x91, 0x00, 0x03, 0x7b, 0x02, 0xae, 0xe9, 0x8b, 0x00, 0x03, 0x4b, 0x02,
+    0xaf, 0x0d, 0x86, 0x00, 0x03, 0x23, 0x02, 0xaf, 0x21, 0x87, 0x00, 0x03,
+    0x2b, 0x02, 0xaf, 0x42, 0x94, 0x00, 0x03, 0x93, 0x02, 0xaf, 0x70, 0x8e,
+    0x00, 0x03, 0x63, 0x02, 0xaf, 0x89, 0x88, 0x00, 0x03, 0x33, 0x02, 0xaf,
+    0xb8, 0x9b, 0x00, 0x03, 0xcb, 0x02, 0xaf, 0xc7, 0x8f, 0x00, 0x03, 0x6b,
+    0x02, 0xaf, 0xd3, 0x97, 0x00, 0x03, 0xab, 0x02, 0xaf, 0xe5, 0x83, 0x00,
+    0x03, 0x0b, 0x02, 0xb0, 0x02, 0x99, 0x00, 0x03, 0xbb, 0x02, 0xb0, 0x33,
+    0x8a, 0x00, 0x03, 0x43, 0x02, 0xb0, 0x39, 0x9c, 0x00, 0x03, 0xd3, 0x02,
+    0xb0, 0x52, 0x9a, 0x00, 0x03, 0xc3, 0x02, 0xb0, 0x58, 0x98, 0x00, 0x03,
+    0xb3, 0x02, 0xb0, 0x5e, 0x92, 0x00, 0x03, 0x83, 0x02, 0xb0, 0x7a, 0x90,
+    0x00, 0x03, 0x73, 0x02, 0xb0, 0x86, 0x8d, 0x00, 0x03, 0x5b, 0x02, 0xb0,
+    0x94, 0x89, 0x00, 0x03, 0x3b, 0x02, 0xb0, 0xa0, 0x84, 0x00, 0x03, 0x13,
+    0x02, 0xb0, 0xb8, 0x8c, 0x00, 0x03, 0x53, 0x02, 0xb0, 0xda, 0x93, 0x00,
+    0x03, 0x8a, 0x02, 0xb0, 0xe0, 0xc2, 0x00, 0x15, 0x07, 0xd8, 0x31, 0xc8,
+    0xbb, 0x08, 0x07, 0xd8, 0x29, 0x08, 0xc2, 0xb0, 0xec, 0xc2, 0x00, 0x0b,
+    0x00, 0x09, 0x99, 0xc2, 0x0b, 0x28, 0x00, 0x0a, 0x98, 0x46, 0x46, 0x0e,
+    0x42, 0xb0, 0xfb, 0x46, 0x00, 0x91, 0x42, 0xb1, 0x0f, 0xc2, 0x25, 0x73,
+    0x00, 0xe9, 0x19, 0xc2, 0x00, 0x60, 0x00, 0xe8, 0x30, 0x48, 0x10, 0xac,
+    0xc2, 0xb1, 0x1b, 0xcf, 0x68, 0x09, 0x05, 0x5a, 0x31, 0xc2, 0x04, 0x41,
+    0x05, 0x3b, 0xb0, 0x97, 0x00, 0xe8, 0xa9, 0xc5, 0xd4, 0x68, 0x00, 0xe8,
+    0x81, 0x87, 0x00, 0x13, 0xb0, 0xc7, 0xc9, 0xae, 0x00, 0xe8, 0x18, 0x87,
+    0x00, 0xe8, 0x08, 0xca, 0x1e, 0x93, 0x00, 0x14, 0xd8, 0xc9, 0xb2, 0x07,
+    0x00, 0x14, 0x08, 0x46, 0x00, 0x91, 0xc2, 0xb1, 0x23, 0xc3, 0xe5, 0xb0,
+    0x00, 0x10, 0xe0, 0x45, 0x01, 0x34, 0xc2, 0xb1, 0x5a, 0x46, 0x00, 0x91,
+    0x42, 0xb1, 0x66, 0x01, 0xc2, 0xb1, 0x78, 0xc6, 0x11, 0xba, 0x00, 0x0d,
+    0x88, 0x46, 0x00, 0x91, 0xc2, 0xb1, 0x84, 0x91, 0x05, 0x3a, 0x71, 0xc4,
+    0x71, 0xbf, 0x05, 0x3d, 0xb1, 0xcb, 0x8d, 0x54, 0x05, 0x3e, 0x01, 0x44,
+    0x00, 0x78, 0xc2, 0xb1, 0xcf, 0x8b, 0x00, 0x0d, 0x11, 0x97, 0x00, 0x11,
+    0x10, 0x46, 0x00, 0x91, 0xc2, 0xb1, 0xd7, 0x95, 0x05, 0x3b, 0x61, 0x47,
+    0x67, 0x98, 0xc2, 0xb2, 0x18, 0xc3, 0x01, 0x5d, 0x00, 0x0c, 0xb0, 0x46,
+    0x00, 0x91, 0xc2, 0xb2, 0x30, 0x4e, 0x6c, 0x7a, 0xc2, 0xb2, 0x74, 0x96,
+    0x05, 0x3b, 0x53, 0x02, 0xb2, 0x80, 0xc2, 0x00, 0xb2, 0x00, 0x0a, 0x51,
+    0xc2, 0x00, 0xa7, 0x00, 0x0d, 0x49, 0xc2, 0x25, 0x73, 0x00, 0x0d, 0xba,
+    0x02, 0xb2, 0x84, 0x46, 0x00, 0x91, 0xc2, 0xb2, 0x88, 0x87, 0x00, 0x06,
+    0x33, 0x02, 0xb2, 0xcf, 0x83, 0x05, 0x39, 0x91, 0x91, 0x05, 0x39, 0xa1,
+    0x97, 0x05, 0x39, 0xb1, 0x98, 0x05, 0x39, 0xc3, 0x02, 0xb2, 0xd5, 0x9b,
+    0x05, 0x39, 0xe1, 0xca, 0xa1, 0x96, 0x05, 0x3e, 0x11, 0xc4, 0xd9, 0x19,
+    0x01, 0x63, 0x69, 0xc8, 0xbe, 0xf0, 0x00, 0x0c, 0x48, 0xc6, 0xa4, 0x53,
+    0x00, 0xf4, 0xf1, 0x46, 0x00, 0x91, 0xc2, 0xb2, 0xdb, 0x45, 0x00, 0xb6,
+    0xc2, 0xb2, 0xfe, 0xc7, 0xc9, 0xf4, 0x05, 0x3c, 0x59, 0x05, 0xc2, 0xb3,
+    0x0a, 0xc8, 0xbc, 0x98, 0x05, 0x3e, 0xc0, 0x46, 0x00, 0x91, 0x42, 0xb3,
+    0x16, 0x47, 0x03, 0x74, 0x42, 0xb3, 0x3a, 0x46, 0x00, 0x91, 0xc2, 0xb3,
+    0x46, 0xc3, 0x99, 0xd0, 0x00, 0x0f, 0xb8, 0x46, 0x00, 0x91, 0xc2, 0xb3,
+    0x62, 0x9b, 0x05, 0x3b, 0x01, 0xcb, 0x93, 0x00, 0x05, 0x3b, 0x11, 0xc3,
+    0x01, 0x44, 0x05, 0x3b, 0x41, 0x47, 0xc3, 0xf7, 0x42, 0xb3, 0x72, 0x46,
+    0x00, 0x91, 0xc2, 0xb3, 0x84, 0x46, 0x46, 0x0e, 0xc2, 0xb3, 0xa4, 0x9c,
+    0x05, 0x39, 0x41, 0xc7, 0xc6, 0x2e, 0x05, 0x39, 0x51, 0xc4, 0x27, 0x7b,
+    0x00, 0x06, 0xf3, 0x02, 0xb3, 0xc9, 0x44, 0x05, 0x16, 0x42, 0xb3, 0xd2,
+    0x01, 0xc2, 0xb3, 0xe4, 0x48, 0x10, 0xac, 0xc2, 0xb3, 0xf0, 0xca, 0x9a,
+    0x5c, 0x05, 0x3a, 0xe0, 0x46, 0x00, 0x91, 0x42, 0xb4, 0x06, 0x46, 0x00,
+    0x91, 0xc2, 0xb4, 0x22, 0x8c, 0x00, 0x0e, 0x50, 0x46, 0x00, 0x91, 0xc2,
+    0xb4, 0x4c, 0x8c, 0x00, 0x0e, 0x38, 0x46, 0x00, 0x91, 0x42, 0xb4, 0x76,
+    0x46, 0x00, 0x91, 0xc2, 0xb4, 0x9f, 0xc4, 0xde, 0x5c, 0x00, 0x0f, 0xb1,
+    0xc3, 0x0a, 0x45, 0x05, 0x39, 0x31, 0xc5, 0xd2, 0x27, 0x01, 0x63, 0xa8,
+    0x46, 0x00, 0x91, 0xc2, 0xb4, 0xb9, 0x47, 0x22, 0xbe, 0xc2, 0xb4, 0xe7,
+    0xc4, 0x31, 0xdd, 0x00, 0x0c, 0xa1, 0xc2, 0x00, 0xce, 0x00, 0x0d, 0x10,
+    0x46, 0x00, 0x91, 0x42, 0xb4, 0xf9, 0x46, 0x00, 0x91, 0xc2, 0xb5, 0x0b,
+    0x9c, 0x00, 0x0f, 0x8a, 0x02, 0xb5, 0x2b, 0x46, 0x00, 0x91, 0xc2, 0xb5,
+    0x31, 0xc2, 0x00, 0x0a, 0x05, 0x3d, 0x99, 0xc8, 0xbd, 0xf8, 0x05, 0x39,
+    0x63, 0x02, 0xb5, 0x59, 0xc2, 0x00, 0x47, 0x05, 0x3b, 0x71, 0xcf, 0x67,
+    0x91, 0x05, 0x3e, 0x80, 0x46, 0x00, 0x91, 0xc2, 0xb5, 0x5f, 0xc3, 0x07,
+    0x09, 0x05, 0x3d, 0xa1, 0xc7, 0xc2, 0x61, 0x05, 0x3a, 0x30, 0x46, 0x00,
+    0x91, 0x42, 0xb5, 0x83, 0x46, 0x00, 0x91, 0x42, 0xb5, 0x8d, 0xc4, 0xde,
+    0x94, 0x00, 0x74, 0x11, 0xc3, 0x31, 0x33, 0x00, 0x74, 0x20, 0xc2, 0x14,
+    0x10, 0x00, 0x76, 0xf1, 0xc3, 0x4c, 0x6f, 0x00, 0x76, 0xf8, 0xc2, 0x1a,
+    0x18, 0x00, 0x74, 0x71, 0xc2, 0x03, 0x83, 0x00, 0x74, 0x98, 0x83, 0x00,
+    0x74, 0x79, 0xc2, 0x00, 0xce, 0x00, 0x74, 0x80, 0x06, 0xc2, 0xb5, 0x99,
+    0xc2, 0x00, 0xce, 0x00, 0x74, 0xc0, 0xc5, 0x00, 0x64, 0x0f, 0xda, 0xa9,
+    0xc6, 0x07, 0x83, 0x0f, 0xda, 0xa1, 0xcc, 0x0a, 0x4d, 0x0f, 0xdb, 0x38,
+    0x46, 0x00, 0x29, 0xc2, 0xb5, 0xa3, 0xd2, 0x4d, 0x11, 0x0f, 0xdb, 0x18,
+    0xd2, 0x4d, 0x11, 0x0f, 0xdb, 0x11, 0x46, 0x00, 0x29, 0x42, 0xb5, 0xaf,
+    0xc6, 0x07, 0x83, 0x0f, 0xda, 0xc9, 0xc5, 0x00, 0x64, 0x0f, 0xda, 0xd1,
+    0xcc, 0x0a, 0x4d, 0x0f, 0xda, 0xe0, 0x46, 0x06, 0x50, 0xc2, 0xb5, 0xbb,
+    0xd2, 0x4b, 0x07, 0x0f, 0xda, 0xf0, 0xd2, 0x4b, 0x07, 0x0f, 0xda, 0xe9,
+    0x46, 0x06, 0x50, 0x42, 0xb5, 0xc7, 0x46, 0x00, 0x91, 0x42, 0xb5, 0xd3,
+    0xd4, 0x3a, 0xfe, 0x01, 0x5d, 0xc0, 0xc5, 0x00, 0x83, 0x01, 0x5b, 0x0b,
+    0x02, 0xb5, 0xdf, 0xcc, 0x84, 0xcc, 0x01, 0x5b, 0x59, 0xcd, 0x79, 0x7d,
+    0x01, 0x5c, 0x28, 0xd5, 0x01, 0xd4, 0x0f, 0xc0, 0xa9, 0xd8, 0x22, 0x15,
+    0x0f, 0xc0, 0x49, 0xd9, 0x20, 0x91, 0x0f, 0xc0, 0x29, 0x46, 0x00, 0xb5,
+    0xc2, 0xb5, 0xe3, 0xcd, 0x7b, 0xe0, 0x01, 0x0e, 0xf1, 0x44, 0x05, 0x9c,
+    0xc2, 0xb5, 0xef, 0xd1, 0x00, 0x4a, 0x01, 0x48, 0x49, 0xcc, 0x84, 0x9c,
+    0x0f, 0xc4, 0xc8, 0x47, 0x14, 0x87, 0xc2, 0xb5, 0xfb, 0xc8, 0xb2, 0xfb,
+    0x01, 0x4b, 0x01, 0xc6, 0x10, 0x65, 0x01, 0x4a, 0xc0, 0xc8, 0xb2, 0xfb,
+    0x01, 0x4a, 0xe1, 0xc6, 0x10, 0x65, 0x01, 0x4a, 0xa0, 0xe0, 0x09, 0x69,
+    0x01, 0x3a, 0x58, 0xd6, 0x2d, 0x4e, 0x01, 0x39, 0xc1, 0xca, 0x23, 0xd3,
+    0x0f, 0xbe, 0x79, 0xcd, 0x0e, 0x9f, 0x0f, 0xbe, 0x88, 0xc3, 0x95, 0xf5,
+    0x0f, 0xb3, 0x29, 0xc9, 0xab, 0x1a, 0x0f, 0xb2, 0xe8, 0xc5, 0x00, 0x83,
+    0x01, 0x3c, 0xc1, 0x49, 0x01, 0x4c, 0x42, 0xb6, 0x05, 0xdd, 0x04, 0x0c,
+    0x01, 0x3a, 0xe1, 0x44, 0x05, 0x80, 0x42, 0xb6, 0x11, 0xcf, 0x17, 0x39,
+    0x0f, 0xbd, 0xc1, 0xd2, 0x23, 0xcb, 0x0f, 0xbe, 0x60, 0xc3, 0x95, 0xf5,
+    0x0f, 0xb3, 0x31, 0xc9, 0xab, 0x1a, 0x0f, 0xb2, 0xf0, 0xe0, 0x09, 0x09,
+    0x01, 0x3d, 0x68, 0x44, 0x00, 0xd8, 0xc2, 0xb6, 0x17, 0x44, 0x07, 0x8b,
+    0x42, 0xb6, 0x1d, 0xd0, 0x06, 0xf9, 0x01, 0x3b, 0x81, 0xd7, 0x04, 0x12,
+    0x01, 0x3b, 0x70, 0xd5, 0x01, 0xd4, 0x0f, 0xc0, 0xc1, 0xdb, 0x16, 0x70,
+    0x0f, 0xc0, 0xe0, 0xd1, 0x56, 0x85, 0x01, 0x3a, 0x19, 0xc8, 0x09, 0x81,
+    0x01, 0x39, 0xe8, 0xd0, 0x1d, 0xde, 0x01, 0x3d, 0xc9, 0xd0, 0x02, 0xf9,
+    0x01, 0x3d, 0xc1, 0xd0, 0x3c, 0x1a, 0x01, 0x3d, 0xb8, 0x47, 0x3b, 0x8a,
+    0xc2, 0xb6, 0x23, 0xc5, 0x19, 0xbe, 0x01, 0x3b, 0x20, 0xd9, 0x1f, 0x01,
+    0x01, 0x37, 0x19, 0xcd, 0x7a, 0x8e, 0x01, 0x5a, 0xb8, 0xdd, 0x04, 0x0c,
+    0x01, 0x3a, 0xf1, 0x44, 0x05, 0x80, 0x42, 0xb6, 0x2f, 0xd5, 0x01, 0xd4,
+    0x0f, 0xc0, 0xd9, 0xdb, 0x16, 0x70, 0x0f, 0xc0, 0xf8, 0x46, 0x00, 0x91,
+    0x42, 0xb6, 0x35, 0xd0, 0x06, 0xf9, 0x01, 0x3b, 0x89, 0xd7, 0x04, 0x12,
+    0x01, 0x3b, 0x78, 0x01, 0x42, 0xb6, 0x41, 0xc3, 0x4e, 0x09, 0x00, 0x2f,
+    0x91, 0xc3, 0x03, 0x4e, 0x00, 0x2f, 0x80, 0xc4, 0xe2, 0xd8, 0x07, 0xda,
+    0x71, 0xc6, 0x62, 0x96, 0x07, 0xda, 0x20, 0xc4, 0xe2, 0xd8, 0x07, 0xda,
+    0x69, 0xc6, 0x62, 0x96, 0x07, 0xd9, 0xd8, 0xc4, 0xe2, 0xd8, 0x07, 0xda,
+    0x61, 0xc6, 0x62, 0x96, 0x07, 0xd9, 0x88, 0xc5, 0xdd, 0x7d, 0x07, 0xda,
+    0x59, 0xc6, 0x62, 0x96, 0x07, 0xd9, 0xa8, 0xcc, 0x80, 0xe8, 0x07, 0xda,
+    0x50, 0xcc, 0x80, 0xe8, 0x07, 0xda, 0x30, 0xcc, 0x80, 0xe8, 0x07, 0xd9,
+    0xc0, 0x46, 0x00, 0x91, 0x42, 0xb6, 0x4d, 0xcc, 0x80, 0xe8, 0x07, 0xda,
+    0x08, 0xcc, 0x80, 0xe8, 0x07, 0xda, 0x18, 0xcc, 0x80, 0xe8, 0x07, 0xd9,
+    0xd0, 0xc6, 0x62, 0x96, 0x07, 0xd9, 0xc9, 0xc5, 0xdd, 0x91, 0x07, 0xd8,
+    0xe8, 0xc2, 0x00, 0x07, 0x00, 0x2e, 0x83, 0x02, 0xb6, 0x5a, 0x4a, 0x9b,
+    0x92, 0x42, 0xb6, 0x60, 0xc6, 0xca, 0x4c, 0x00, 0x2e, 0x38, 0xc6, 0x42,
+    0xb0, 0x00, 0x2e, 0x09, 0xc3, 0x41, 0x85, 0x00, 0x2d, 0x80, 0xce, 0x70,
+    0x16, 0x00, 0x2d, 0xd0, 0xc6, 0xcc, 0x68, 0x00, 0x2d, 0x99, 0xc5, 0x7a,
+    0x6f, 0x00, 0x2d, 0x91, 0xc5, 0xdb, 0xa7, 0x00, 0x2d, 0x88, 0xc5, 0xdd,
+    0x46, 0x00, 0x2c, 0xa9, 0xc5, 0xca, 0x4d, 0x00, 0x2c, 0xa0, 0xc6, 0xcc,
+    0x44, 0x00, 0x2d, 0x49, 0xc6, 0xca, 0xca, 0x00, 0x2d, 0x00, 0xc2, 0x48,
+    0x24, 0x02, 0x6e, 0x31, 0xce, 0x6c, 0xc0, 0x02, 0x6f, 0x90, 0x11, 0xc2,
+    0xb6, 0x6c, 0xcc, 0x7c, 0xe5, 0x02, 0x6e, 0xd8, 0x01, 0x42, 0xb6, 0x78,
+    0xc2, 0x1a, 0x18, 0x08, 0x68, 0xc9, 0xc2, 0x00, 0x71, 0x08, 0x68, 0xb8,
+    0x1e, 0x42, 0xb6, 0x84, 0x44, 0x5f, 0x39, 0xc2, 0xb6, 0xb0, 0xc3, 0x3e,
+    0xb1, 0x00, 0x88, 0x4a, 0x02, 0xb6, 0xf0, 0xc5, 0xd7, 0x8d, 0x05, 0x4b,
+    0xd8, 0xc6, 0xb4, 0xea, 0x00, 0x88, 0x8b, 0x02, 0xb6, 0xf4, 0xc4, 0x80,
+    0x06, 0x00, 0x88, 0x3b, 0x02, 0xb6, 0xf8, 0xc6, 0xc9, 0x70, 0x00, 0x8a,
+    0x00, 0x1e, 0x42, 0xb6, 0xfc, 0x1e, 0x42, 0xb7, 0x26, 0xc5, 0xc0, 0x64,
+    0x00, 0x88, 0x1b, 0x02, 0xb7, 0x3e, 0xc6, 0xc0, 0x9b, 0x00, 0x88, 0x80,
+    0xc5, 0x91, 0x22, 0x00, 0x88, 0x03, 0x02, 0xb7, 0x42, 0xc6, 0xb7, 0xd2,
+    0x00, 0x88, 0x79, 0x47, 0x7f, 0xfe, 0x42, 0xb7, 0x48, 0x1e, 0x42, 0xb7,
+    0x5e, 0xc4, 0xbf, 0x92, 0x00, 0x88, 0x63, 0x02, 0xb7, 0x82, 0x42, 0x00,
+    0x0a, 0xc2, 0xb7, 0x88, 0x4a, 0xa6, 0xdc, 0x42, 0xb7, 0x97, 0xc6, 0xbe,
+    0x8a, 0x00, 0x8a, 0x61, 0xc9, 0x98, 0x2a, 0x00, 0x8a, 0xc8, 0xc6, 0x22,
+    0x0f, 0x00, 0x8b, 0x01, 0x83, 0x00, 0x8b, 0x0b, 0x02, 0xb7, 0x9f, 0x1b,
+    0xc2, 0xb7, 0xb0, 0x87, 0x00, 0x8b, 0x33, 0x02, 0xb7, 0xd3, 0x91, 0x00,
+    0x8b, 0x4b, 0x02, 0xb7, 0xe1, 0x19, 0xc2, 0xb7, 0xe9, 0x97, 0x00, 0x8b,
+    0x73, 0x02, 0xb7, 0xfb, 0x8b, 0x00, 0x8b, 0xab, 0x02, 0xb7, 0xff, 0xca,
+    0x9b, 0x10, 0x00, 0x8d, 0x10, 0x0d, 0xc2, 0xb8, 0x03, 0x15, 0xc2, 0xb8,
+    0x18, 0xc5, 0xda, 0xcb, 0x00, 0x8d, 0x5b, 0x02, 0xb8, 0x27, 0x16, 0xc2,
+    0xb8, 0x2b, 0xc5, 0xd4, 0x7c, 0x00, 0x8d, 0x7b, 0x02, 0xb8, 0x3a, 0xc5,
+    0xdb, 0x5c, 0x00, 0x8d, 0xbb, 0x02, 0xb8, 0x3e, 0x12, 0xc2, 0xb8, 0x42,
+    0xc5, 0xbe, 0x8b, 0x00, 0x8d, 0xe3, 0x02, 0xb8, 0x5d, 0x05, 0xc2, 0xb8,
+    0x61, 0xc5, 0x98, 0x2e, 0x00, 0x8e, 0x13, 0x02, 0xb8, 0x70, 0x42, 0x0d,
+    0x1e, 0x42, 0xb8, 0x74, 0xc5, 0x91, 0x22, 0x01, 0x89, 0x8b, 0x02, 0xb8,
+    0x83, 0xc6, 0xb7, 0xd2, 0x01, 0x8a, 0x59, 0x47, 0x7f, 0xfe, 0x42, 0xb8,
+    0x89, 0x44, 0x5f, 0x39, 0xc2, 0xb8, 0x99, 0xc3, 0x3e, 0xb1, 0x01, 0x8a,
+    0x2a, 0x02, 0xb8, 0xc9, 0x1e, 0x42, 0xb8, 0xcd, 0xc5, 0xc0, 0x64, 0x01,
+    0x89, 0xb9, 0xc6, 0xc0, 0x9b, 0x01, 0x8a, 0x60, 0x1e, 0x42, 0xb8, 0xeb,
+    0x1e, 0x42, 0xb9, 0x14, 0xc4, 0x80, 0x06, 0x01, 0x8a, 0x13, 0x02, 0xb9,
+    0x1e, 0xc6, 0xb4, 0xea, 0x01, 0x8a, 0x69, 0xc6, 0xc9, 0x70, 0x01, 0x8b,
+    0xf8, 0xc4, 0xbe, 0x8c, 0x01, 0x8a, 0x38, 0xc4, 0xbf, 0x92, 0x01, 0x8a,
+    0x41, 0xc6, 0xbf, 0x91, 0x01, 0x8a, 0x50, 0x87, 0x01, 0x8a, 0x81, 0xc4,
+    0x9b, 0x16, 0x01, 0x8c, 0x6a, 0x02, 0xb9, 0x22, 0x83, 0x01, 0x8a, 0x8b,
+    0x02, 0xb9, 0x26, 0x87, 0x01, 0x8a, 0xb3, 0x02, 0xb9, 0x2a, 0x91, 0x01,
+    0x8a, 0xdb, 0x02, 0xb9, 0x3a, 0x97, 0x01, 0x8b, 0x03, 0x02, 0xb9, 0x3e,
+    0x8b, 0x01, 0x8b, 0x10, 0x91, 0x01, 0x8a, 0x99, 0x97, 0x01, 0x8b, 0x08,
+    0x87, 0x01, 0x8a, 0xd0, 0x83, 0x01, 0x8a, 0xc3, 0x02, 0xb9, 0x42, 0x87,
+    0x01, 0x8a, 0xf3, 0x02, 0xb9, 0x46, 0x8b, 0x01, 0x8a, 0xf8, 0x91, 0x01,
+    0x81, 0x11, 0xc4, 0x17, 0xf9, 0x01, 0x81, 0xc8, 0xc3, 0x03, 0xe1, 0x01,
+    0x81, 0x19, 0xc4, 0x0c, 0xf1, 0x01, 0x81, 0xd0, 0xc3, 0x17, 0x62, 0x08,
+    0x47, 0x89, 0xc4, 0xd9, 0x0f, 0x08, 0x47, 0x70, 0x91, 0x07, 0xfb, 0x31,
+    0x83, 0x07, 0xfc, 0xe0, 0x45, 0x00, 0xb6, 0xc2, 0xb9, 0x4a, 0x83, 0x07,
+    0xfb, 0xd9, 0x97, 0x07, 0xfb, 0xe9, 0x87, 0x07, 0xfb, 0xf1, 0x91, 0x07,
+    0xfb, 0xf9, 0x8b, 0x07, 0xfb, 0xe0, 0x83, 0x07, 0xfb, 0xb1, 0x8b, 0x07,
+    0xfb, 0xb9, 0x87, 0x07, 0xfb, 0xc9, 0x91, 0x07, 0xfb, 0xd1, 0x97, 0x07,
+    0xfb, 0xc0, 0x83, 0x07, 0xfc, 0x01, 0x8b, 0x07, 0xfc, 0x09, 0x97, 0x07,
+    0xfc, 0x11, 0x87, 0x07, 0xfc, 0x19, 0x91, 0x07, 0xfc, 0x20, 0x87, 0x07,
+    0xfc, 0x41, 0x91, 0x07, 0xfc, 0x49, 0x83, 0x07, 0xfc, 0x29, 0x8b, 0x07,
+    0xfc, 0x31, 0x97, 0x07, 0xfc, 0x38, 0x8b, 0x07, 0xfc, 0x59, 0x97, 0x07,
+    0xfc, 0x61, 0x87, 0x07, 0xfc, 0x69, 0x83, 0x07, 0xfc, 0x51, 0x91, 0x07,
+    0xfc, 0x70, 0x8b, 0x07, 0xfc, 0x81, 0x91, 0x07, 0xfc, 0x99, 0x83, 0x07,
+    0xfc, 0x79, 0x97, 0x07, 0xfc, 0x89, 0x87, 0x07, 0xfc, 0x90, 0x83, 0x07,
+    0xfc, 0xa1, 0x97, 0x07, 0xfc, 0xa9, 0x91, 0x07, 0xfc, 0xb0, 0x97, 0x07,
+    0xfc, 0xc9, 0x87, 0x07, 0xfc, 0xd1, 0x91, 0x07, 0xfc, 0xd9, 0x83, 0x07,
+    0xfc, 0xb9, 0x8b, 0x07, 0xfc, 0xc0, 0xc5, 0xd7, 0x8d, 0x07, 0xfd, 0x18,
+    0xc6, 0x91, 0x21, 0x07, 0xfd, 0x11, 0xc5, 0x80, 0x05, 0x07, 0xfd, 0x99,
+    0xc4, 0xad, 0x95, 0x07, 0xfd, 0xb1, 0xc5, 0xd5, 0x21, 0x07, 0xfd, 0xc9,
+    0xc6, 0xc0, 0x63, 0x07, 0xfd, 0x40, 0xc6, 0x91, 0x21, 0x07, 0xfd, 0x51,
+    0xc5, 0xdb, 0x5c, 0x07, 0xfd, 0x59, 0x12, 0xc2, 0xb9, 0x68, 0xc4, 0xad,
+    0x95, 0x07, 0xfd, 0x69, 0xc7, 0xc0, 0x9a, 0x07, 0xfd, 0x71, 0xc5, 0x98,
+    0x2e, 0x07, 0xfd, 0x80, 0xc5, 0xd7, 0x8d, 0x07, 0xfd, 0xa0, 0x87, 0x07,
+    0xfe, 0x28, 0x91, 0x07, 0xfe, 0x50, 0x87, 0x07, 0xfe, 0x70, 0x91, 0x07,
+    0xfe, 0xa0, 0xc5, 0xd5, 0x21, 0x07, 0xfd, 0x29, 0xc5, 0x98, 0x2e, 0x07,
+    0xfd, 0x30, 0x91, 0x0d, 0x8a, 0x91, 0x87, 0x0d, 0x8a, 0x89, 0x8b, 0x0d,
+    0x8a, 0x81, 0x83, 0x01, 0x84, 0x70, 0x83, 0x01, 0x84, 0x19, 0x97, 0x01,
+    0x84, 0x29, 0x91, 0x01, 0x84, 0x38, 0x83, 0x01, 0x84, 0xa9, 0x87, 0x01,
+    0x84, 0xb0, 0xd2, 0x4a, 0x9b, 0x01, 0x72, 0x30, 0xc3, 0x01, 0xa5, 0x01,
+    0x52, 0x01, 0xc7, 0x78, 0xa6, 0x01, 0x52, 0x19, 0xcb, 0x29, 0x7c, 0x01,
+    0x52, 0x20, 0xc5, 0x14, 0x9e, 0x01, 0x52, 0x39, 0xcf, 0x63, 0xfe, 0x01,
+    0x52, 0x48, 0xe0, 0x07, 0xc9, 0x01, 0x52, 0x58, 0xc6, 0x50, 0x52, 0x01,
+    0x50, 0xe1, 0xc3, 0x00, 0x46, 0x01, 0x50, 0xd0, 0x01, 0x42, 0xb9, 0x74,
+    0x19, 0xc2, 0xb9, 0x80, 0xc2, 0x00, 0x79, 0x08, 0x5b, 0xe1, 0xc4, 0x03,
+    0xe0, 0x08, 0x5b, 0xd0, 0xc2, 0x2f, 0x05, 0x08, 0x5b, 0x91, 0xc3, 0x0a,
+    0xc8, 0x08, 0x5b, 0x40, 0xc3, 0x11, 0x9a, 0x08, 0x5b, 0x89, 0x03, 0x42,
+    0xb9, 0x8a, 0xc2, 0x00, 0x60, 0x08, 0x5b, 0x38, 0x01, 0x42, 0xb9, 0x96,
+    0x19, 0xc2, 0xb9, 0xa2, 0xc2, 0x00, 0x79, 0x08, 0x5a, 0xe1, 0xc4, 0x03,
+    0xe0, 0x08, 0x5a, 0xd0, 0xc2, 0x2f, 0x05, 0x08, 0x5a, 0xa9, 0xc3, 0x0a,
+    0xc8, 0x08, 0x5a, 0x40, 0xc3, 0x11, 0x9a, 0x08, 0x5a, 0xa1, 0x03, 0x42,
+    0xb9, 0xac, 0xc2, 0x00, 0x60, 0x08, 0x5a, 0x38, 0xc4, 0x35, 0x13, 0x08,
+    0x5a, 0x01, 0xc3, 0x16, 0xc8, 0x08, 0x5a, 0x78, 0xc4, 0x03, 0xe0, 0x00,
+    0x00, 0xe9, 0xc2, 0x01, 0xa2, 0x00, 0x00, 0xf0, 0xc4, 0x04, 0x30, 0x0f,
+    0x65, 0x71, 0xc7, 0x06, 0x7b, 0x0f, 0x65, 0x68, 0xc4, 0x28, 0x74, 0x0f,
+    0x65, 0x59, 0xc5, 0x0a, 0xfd, 0x0f, 0x65, 0x51, 0x15, 0xc2, 0xb9, 0xb8,
+    0x08, 0xc2, 0xb9, 0xc4, 0x16, 0xc2, 0xb9, 0xd0, 0xc3, 0x05, 0x16, 0x0f,
+    0x65, 0x18, 0xc2, 0x00, 0x6b, 0x0f, 0x65, 0x10, 0xc2, 0x00, 0x6b, 0x0f,
+    0x64, 0xf8, 0xc2, 0x0c, 0xf3, 0x0f, 0x64, 0x13, 0x02, 0xb9, 0xdc, 0x01,
+    0x42, 0xb9, 0xe2, 0x9b, 0x0f, 0x64, 0x0b, 0x02, 0xb9, 0xee, 0x01, 0x42,
+    0xb9, 0xf4, 0xc4, 0x17, 0xf7, 0x0f, 0x63, 0xbb, 0x02, 0xba, 0x00, 0xc2,
+    0x24, 0x36, 0x0f, 0x63, 0xb2, 0x02, 0xba, 0x0d, 0x0b, 0xc2, 0xba, 0x1a,
+    0x11, 0x42, 0xba, 0x2c, 0x0a, 0xc2, 0xba, 0x3e, 0x19, 0xc2, 0xba, 0x50,
+    0xc2, 0x00, 0x79, 0x0f, 0x63, 0xd2, 0x02, 0xba, 0x60, 0x01, 0x42, 0xba,
+    0x66, 0xc3, 0x05, 0x16, 0x0f, 0x65, 0x89, 0x16, 0x42, 0xba, 0x72, 0xc6,
+    0xce, 0x36, 0x01, 0x96, 0x01, 0x17, 0x42, 0xba, 0x7e, 0xc3, 0x76, 0xda,
+    0x01, 0x96, 0x11, 0x9b, 0x01, 0x96, 0x20, 0xc4, 0xe2, 0xbc, 0x01, 0x96,
+    0x19, 0xc5, 0xd5, 0x62, 0x01, 0x96, 0x38, 0xc7, 0xc2, 0xca, 0x01, 0x96,
+    0x59, 0x43, 0x1c, 0xa9, 0x42, 0xba, 0x8a, 0xc4, 0x18, 0xa7, 0x01, 0x9a,
+    0xc1, 0xc3, 0x05, 0x16, 0x01, 0x9a, 0xc9, 0x16, 0xc2, 0xba, 0xa9, 0x08,
+    0xc2, 0xba, 0xb7, 0x15, 0xc2, 0xba, 0xc4, 0x07, 0xc2, 0xba, 0xd6, 0xc4,
+    0x28, 0x74, 0x01, 0x9b, 0x0a, 0x02, 0xba, 0xe5, 0xc3, 0x00, 0x30, 0x01,
+    0x7f, 0xb9, 0xc9, 0x00, 0x2a, 0x01, 0x7f, 0xd0, 0xc4, 0x00, 0x2f, 0x01,
+    0x7f, 0xc1, 0xc5, 0x00, 0x64, 0x01, 0x7f, 0xc8, 0xc9, 0x53, 0xcf, 0x08,
+    0x42, 0xf8, 0xc4, 0x17, 0xf9, 0x08, 0x42, 0xe1, 0x91, 0x08, 0x42, 0xc8,
+    0xc8, 0x53, 0xd0, 0x08, 0x42, 0xf1, 0xc7, 0x0c, 0xe7, 0x08, 0x42, 0xe8,
+    0xc3, 0x17, 0x62, 0x08, 0x42, 0x89, 0xc4, 0xd9, 0x0f, 0x08, 0x42, 0x70,
+    0x97, 0x05, 0x5d, 0x09, 0x91, 0x05, 0x5d, 0x01, 0x8b, 0x05, 0x5c, 0xf9,
+    0x87, 0x05, 0x5c, 0xf1, 0x83, 0x05, 0x5c, 0xe1, 0x98, 0x05, 0x5d, 0x10,
+    0x98, 0x05, 0x5c, 0xd9, 0x97, 0x05, 0x5c, 0xd1, 0x91, 0x05, 0x5c, 0xc9,
+    0x8b, 0x05, 0x5c, 0xc1, 0x87, 0x05, 0x5c, 0xb9, 0x83, 0x05, 0x5c, 0xb0,
+    0x98, 0x05, 0x5c, 0xa9, 0x97, 0x05, 0x5c, 0xa1, 0x91, 0x05, 0x5c, 0x99,
+    0x8b, 0x05, 0x5c, 0x91, 0x83, 0x05, 0x5c, 0x73, 0x02, 0xba, 0xeb, 0x87,
+    0x05, 0x5c, 0x88, 0x97, 0x00, 0x9f, 0xd9, 0x91, 0x00, 0x9f, 0xd1, 0x8b,
+    0x00, 0x9f, 0xc9, 0x87, 0x00, 0x9f, 0xc1, 0x98, 0x00, 0x9f, 0xe1, 0x83,
+    0x05, 0x5d, 0xf8, 0x98, 0x00, 0x9f, 0xe9, 0x83, 0x05, 0x5c, 0x49, 0x87,
+    0x05, 0x5c, 0x51, 0x8b, 0x05, 0x5c, 0x59, 0x91, 0x05, 0x5c, 0x61, 0x97,
+    0x05, 0x5c, 0x68, 0x83, 0x05, 0x5b, 0xb1, 0x87, 0x05, 0x5b, 0xc1, 0x8b,
+    0x05, 0x5b, 0xc9, 0x91, 0x05, 0x5b, 0xd1, 0x97, 0x05, 0x5b, 0xd9, 0x98,
+    0x05, 0x5b, 0xe0, 0x83, 0x05, 0x5b, 0xe9, 0x87, 0x05, 0x5b, 0xf1, 0x8b,
+    0x05, 0x5b, 0xf9, 0x91, 0x05, 0x5c, 0x01, 0x97, 0x05, 0x5c, 0x09, 0x98,
+    0x05, 0x5c, 0x11, 0xc2, 0x03, 0x83, 0x05, 0x5c, 0x78, 0x83, 0x05, 0x5c,
+    0x19, 0x87, 0x05, 0x5c, 0x21, 0x8b, 0x05, 0x5c, 0x29, 0x91, 0x05, 0x5c,
+    0x31, 0x97, 0x05, 0x5c, 0x39, 0x98, 0x05, 0x5c, 0x40, 0x83, 0x05, 0x5d,
+    0x19, 0x87, 0x05, 0x5d, 0x29, 0x8b, 0x05, 0x5d, 0x39, 0x91, 0x05, 0x5d,
+    0x49, 0x97, 0x05, 0x5d, 0x51, 0x98, 0x05, 0x5d, 0x59, 0xc2, 0x00, 0x89,
+    0x05, 0x5d, 0x60, 0x83, 0x05, 0x5d, 0x21, 0x8b, 0x05, 0x5d, 0x41, 0x0e,
+    0xc2, 0xba, 0xef, 0x15, 0xc2, 0xbb, 0x07, 0x87, 0x05, 0x5d, 0x30, 0x83,
+    0x05, 0x5d, 0xc9, 0x87, 0x05, 0x5d, 0xd1, 0x8b, 0x05, 0x5d, 0xd9, 0x91,
+    0x05, 0x5d, 0xe1, 0x97, 0x05, 0x5d, 0xe9, 0x98, 0x05, 0x5d, 0xf0, 0x98,
+    0x00, 0x9f, 0xa9, 0x83, 0x00, 0x9d, 0xc9, 0x87, 0x00, 0x9d, 0xd1, 0x8b,
+    0x00, 0x9d, 0xd9, 0x91, 0x00, 0x9d, 0xe1, 0x97, 0x00, 0x9d, 0xe8, 0x98,
+    0x00, 0x9f, 0xa1, 0x97, 0x00, 0x9f, 0x99, 0x91, 0x00, 0x9f, 0x91, 0x8b,
+    0x00, 0x9f, 0x89, 0x87, 0x00, 0x9f, 0x81, 0x83, 0x00, 0x9f, 0x78, 0x98,
+    0x00, 0x9f, 0x71, 0x97, 0x00, 0x9f, 0x69, 0x91, 0x00, 0x9f, 0x61, 0x83,
+    0x00, 0x9f, 0x49, 0x87, 0x00, 0x9f, 0x51, 0x8b, 0x00, 0x9f, 0x58, 0x0e,
+    0xc2, 0xbb, 0x1f, 0x15, 0xc2, 0xbb, 0x37, 0x83, 0x00, 0x9e, 0xa1, 0x87,
+    0x00, 0x9e, 0xb1, 0x8b, 0x00, 0x9e, 0xc0, 0x83, 0x00, 0x9d, 0x31, 0x87,
+    0x00, 0x9d, 0x41, 0x8b, 0x00, 0x9d, 0x49, 0x91, 0x00, 0x9d, 0x51, 0x97,
+    0x00, 0x9d, 0x59, 0x98, 0x00, 0x9d, 0x60, 0x83, 0x00, 0x9d, 0x69, 0x87,
+    0x00, 0x9d, 0x71, 0x8b, 0x00, 0x9d, 0x79, 0x91, 0x00, 0x9d, 0x81, 0x97,
+    0x00, 0x9d, 0x89, 0x98, 0x00, 0x9d, 0x91, 0xc2, 0x03, 0x83, 0x00, 0x9d,
+    0xf8, 0x83, 0x00, 0x9d, 0x99, 0x87, 0x00, 0x9d, 0xa1, 0x8b, 0x00, 0x9d,
+    0xa9, 0x91, 0x00, 0x9d, 0xb1, 0x97, 0x00, 0x9d, 0xb9, 0x98, 0x00, 0x9d,
+    0xc0, 0x83, 0x00, 0x9d, 0xf3, 0x02, 0xbb, 0x4f, 0x87, 0x00, 0x9e, 0x09,
+    0x8b, 0x00, 0x9e, 0x11, 0x91, 0x00, 0x9e, 0x19, 0x97, 0x00, 0x9e, 0x21,
+    0x98, 0x00, 0x9e, 0x28, 0x83, 0x00, 0x9e, 0x31, 0x87, 0x00, 0x9e, 0x39,
+    0x8b, 0x00, 0x9e, 0x41, 0x91, 0x00, 0x9e, 0x49, 0x97, 0x00, 0x9e, 0x51,
+    0x98, 0x00, 0x9e, 0x58, 0x83, 0x00, 0x9e, 0x61, 0x87, 0x00, 0x9e, 0x71,
+    0x8b, 0x00, 0x9e, 0x79, 0x91, 0x00, 0x9e, 0x81, 0x97, 0x00, 0x9e, 0x89,
+    0x98, 0x00, 0x9e, 0x90, 0x83, 0x00, 0x9e, 0x99, 0x87, 0x00, 0x9e, 0xa9,
+    0x8b, 0x00, 0x9e, 0xb9, 0x91, 0x00, 0x9e, 0xc9, 0x97, 0x00, 0x9e, 0xd1,
+    0x98, 0x00, 0x9e, 0xd9, 0xc2, 0x00, 0x89, 0x00, 0x9e, 0xe0, 0xc3, 0x0a,
+    0xc7, 0x00, 0x04, 0x41, 0xd2, 0x49, 0x7b, 0x00, 0x04, 0x48, 0xc3, 0x3a,
+    0xec, 0x08, 0x88, 0xa1, 0xc2, 0x12, 0x99, 0x08, 0x88, 0x98, 0xc3, 0x3a,
+    0xec, 0x08, 0x88, 0x91, 0xc2, 0x12, 0x99, 0x08, 0x88, 0x88, 0x8b, 0x08,
+    0x8a, 0x30, 0x83, 0x08, 0x8a, 0x29, 0x97, 0x08, 0x89, 0x79, 0x8b, 0x08,
+    0x89, 0x68, 0x8b, 0x08, 0x89, 0x80, 0x97, 0x08, 0x89, 0x58, 0x8b, 0x08,
+    0x89, 0x48, 0xc4, 0x17, 0xf7, 0x08, 0x89, 0xe9, 0xc2, 0x24, 0x36, 0x08,
+    0x89, 0xe0, 0xc3, 0x0c, 0xf7, 0x08, 0x89, 0xd9, 0xc3, 0x04, 0xa0, 0x08,
+    0x89, 0xd0, 0xc4, 0x03, 0xe0, 0x08, 0x89, 0xc9, 0xc2, 0x01, 0xa2, 0x08,
+    0x89, 0xc0, 0xc2, 0x0e, 0x21, 0x05, 0x50, 0x51, 0x83, 0x05, 0x50, 0x58,
+    0xc2, 0x21, 0x7d, 0x05, 0x50, 0x91, 0x83, 0x05, 0x50, 0x89, 0xc2, 0x0e,
+    0x21, 0x05, 0x50, 0x80, 0x89, 0x05, 0x52, 0x10, 0xc4, 0x17, 0xf9, 0x08,
+    0x7e, 0x51, 0x91, 0x08, 0x7e, 0x30, 0xd7, 0x28, 0xcf, 0x0f, 0xaa, 0x08,
+    0xce, 0x74, 0xf4, 0x01, 0x72, 0x81, 0xcd, 0x7b, 0x10, 0x01, 0x72, 0x88,
+    0x44, 0xe0, 0x28, 0x42, 0xbb, 0x53, 0x8b, 0x00, 0xa7, 0x70, 0x91, 0x00,
+    0xa8, 0xeb, 0x02, 0xbb, 0x71, 0x83, 0x00, 0xa9, 0x0b, 0x02, 0xbb, 0x79,
+    0x8b, 0x00, 0xa8, 0xcb, 0x02, 0xbb, 0x7d, 0x87, 0x00, 0xa8, 0xb8, 0x9b,
+    0x00, 0xc6, 0x09, 0x83, 0x00, 0xa8, 0xb0, 0x9b, 0x00, 0xc6, 0x01, 0x91,
+    0x00, 0xa8, 0xa0, 0x8b, 0x00, 0xa8, 0x90, 0xc2, 0x07, 0x28, 0x00, 0xa4,
+    0x29, 0xc2, 0x12, 0x9d, 0x00, 0xa4, 0x31, 0xc2, 0x31, 0xdb, 0x00, 0xa4,
+    0x39, 0xc2, 0x01, 0x9a, 0x00, 0xa4, 0x40, 0x83, 0x00, 0xa8, 0x10, 0x91,
+    0x00, 0xa7, 0xf0, 0x8b, 0x00, 0xa7, 0xd0, 0x43, 0x44, 0x7c, 0xc2, 0xbb,
+    0x81, 0x0a, 0x42, 0xbb, 0x96, 0xc4, 0xe3, 0x54, 0x00, 0xa9, 0xe9, 0x15,
+    0xc2, 0xbb, 0xab, 0x19, 0xc2, 0xbb, 0xd2, 0xc4, 0xde, 0x98, 0x00, 0xa3,
+    0x29, 0xc4, 0xdf, 0xbc, 0x00, 0xa4, 0x11, 0xc4, 0xe0, 0xa4, 0x00, 0xa5,
+    0x01, 0xc4, 0xe3, 0x5c, 0x00, 0xa5, 0xd1, 0xc4, 0xe2, 0x68, 0x00, 0xa6,
+    0x78, 0x8b, 0x00, 0xa6, 0x08, 0x91, 0x00, 0xc6, 0x60, 0x8b, 0x00, 0xc6,
+    0x40, 0x83, 0x00, 0xa6, 0x68, 0x83, 0x00, 0xb3, 0xb0, 0x91, 0x00, 0xb3,
+    0xa0, 0x8b, 0x00, 0xb3, 0x90, 0x8b, 0x00, 0xb3, 0x81, 0x83, 0x00, 0xac,
+    0xa2, 0x02, 0xbb, 0xde, 0x91, 0x00, 0xac, 0x90, 0x8b, 0x00, 0xac, 0x80,
+    0x83, 0x00, 0xab, 0xcb, 0x02, 0xbb, 0xe2, 0x91, 0x00, 0xab, 0xbb, 0x02,
+    0xbb, 0xe6, 0x8b, 0x00, 0xab, 0xab, 0x02, 0xbb, 0xea, 0x87, 0x00, 0xab,
+    0xa0, 0x8b, 0x00, 0xab, 0x18, 0x06, 0xc2, 0xbb, 0xee, 0x0c, 0xc2, 0xbb,
+    0xfe, 0x09, 0xc2, 0xbc, 0x1f, 0x16, 0xc2, 0xbc, 0x41, 0x42, 0x11, 0x99,
+    0xc2, 0xbc, 0x51, 0x15, 0xc2, 0xbc, 0x68, 0x8b, 0x00, 0xa0, 0x4b, 0x02,
+    0xbc, 0x86, 0x9c, 0x00, 0xb2, 0x33, 0x02, 0xbc, 0x8c, 0x0e, 0xc2, 0xbc,
+    0xa3, 0x0d, 0xc2, 0xbc, 0xbe, 0x92, 0x00, 0xaf, 0x73, 0x02, 0xbc, 0xc9,
+    0x8a, 0x00, 0xa2, 0x5b, 0x02, 0xbc, 0xe0, 0x19, 0xc2, 0xbc, 0xee, 0x14,
+    0xc2, 0xbd, 0x05, 0xc2, 0x00, 0xc8, 0x00, 0xa0, 0x41, 0x10, 0xc2, 0xbd,
+    0x1c, 0x0f, 0xc2, 0xbd, 0x37, 0x1b, 0x42, 0xbd, 0x4e, 0x8b, 0x00, 0xa4,
+    0x50, 0x8b, 0x00, 0xa4, 0xb0, 0x91, 0x00, 0xa4, 0xd0, 0x83, 0x00, 0xa4,
+    0xf0, 0x83, 0x00, 0xad, 0xb9, 0x91, 0x00, 0xad, 0xb1, 0x8b, 0x00, 0xad,
+    0xa9, 0x87, 0x00, 0xad, 0xa0, 0x83, 0x00, 0xad, 0xf9, 0x91, 0x00, 0xad,
+    0xf1, 0x8b, 0x00, 0xad, 0xe9, 0x87, 0x00, 0xad, 0xe0, 0x83, 0x00, 0xad,
+    0xd9, 0x91, 0x00, 0xad, 0xd1, 0x8b, 0x00, 0xad, 0xc9, 0x87, 0x00, 0xad,
+    0xc0, 0x91, 0x00, 0xc7, 0x48, 0x83, 0x00, 0xab, 0x73, 0x02, 0xbd, 0x65,
+    0x91, 0x00, 0xab, 0x6b, 0x02, 0xbd, 0x69, 0xc2, 0x00, 0x2b, 0x00, 0xc7,
+    0x29, 0x8b, 0x00, 0xab, 0x61, 0x87, 0x00, 0xab, 0x58, 0x83, 0x00, 0xc7,
+    0x23, 0x02, 0xbd, 0x6d, 0x87, 0x00, 0xc7, 0x18, 0x83, 0x00, 0xad, 0x63,
+    0x02, 0xbd, 0x71, 0x91, 0x00, 0xad, 0x53, 0x02, 0xbd, 0x75, 0x8b, 0x00,
+    0xad, 0x43, 0x02, 0xbd, 0x79, 0x87, 0x00, 0xad, 0x38, 0x83, 0x00, 0xab,
+    0x38, 0x91, 0x00, 0xab, 0x28, 0x8b, 0x00, 0xab, 0x10, 0x8b, 0x00, 0xa2,
+    0x68, 0x91, 0x00, 0xa2, 0xf8, 0x8b, 0x00, 0xa2, 0xd8, 0x83, 0x00, 0xa3,
+    0x18, 0x46, 0x8c, 0xdf, 0xc2, 0xbd, 0x7d, 0xc5, 0xbc, 0xf3, 0x00, 0xc6,
+    0xe8, 0x48, 0xb5, 0xf8, 0x42, 0xbd, 0xc4, 0x83, 0x00, 0xaa, 0x70, 0x91,
+    0x00, 0xc6, 0x90, 0x8b, 0x00, 0xc6, 0x80, 0x8b, 0x00, 0xaa, 0x28, 0x14,
+    0xc2, 0xbd, 0xd3, 0x15, 0xc2, 0xbd, 0xdd, 0x42, 0x00, 0xd8, 0xc2, 0xbd,
+    0xe9, 0xc4, 0x23, 0xdf, 0x00, 0xa1, 0x49, 0xca, 0x3e, 0x00, 0x00, 0xa1,
+    0x39, 0xcd, 0x7f, 0xd6, 0x00, 0xa1, 0x11, 0xd0, 0x5e, 0x02, 0x00, 0xa1,
+    0x09, 0xc5, 0x20, 0x53, 0x00, 0xa1, 0x01, 0xc5, 0x34, 0xf9, 0x00, 0xa0,
+    0xf8, 0x8b, 0x00, 0xaa, 0xa0, 0x8a, 0x00, 0xc6, 0xd8, 0x19, 0x42, 0xbd,
+    0xf5, 0x8b, 0x00, 0xa9, 0x38, 0x83, 0x00, 0xa9, 0xd8, 0x91, 0x00, 0xa9,
+    0xb8, 0x8b, 0x00, 0xa9, 0x98, 0xc3, 0x12, 0x98, 0x00, 0xa2, 0x41, 0xc2,
+    0x05, 0x37, 0x00, 0xa1, 0xa8, 0x8b, 0x00, 0xa6, 0xa0, 0x83, 0x00, 0xad,
+    0x28, 0x91, 0x00, 0xad, 0x18, 0x8b, 0x00, 0xad, 0x08, 0x83, 0x00, 0xa7,
+    0x40, 0x91, 0x00, 0xa7, 0x20, 0x8b, 0x00, 0xa7, 0x00, 0x8b, 0x00, 0xa5,
+    0x20, 0x94, 0x00, 0xaa, 0x91, 0x8e, 0x00, 0xa7, 0x60, 0xca, 0x9e, 0xd0,
+    0x00, 0xa8, 0x48, 0x8b, 0x00, 0xa5, 0x80, 0x91, 0x00, 0xa5, 0xa0, 0x83,
+    0x00, 0xa5, 0xc0, 0x9b, 0x00, 0xc5, 0xc9, 0x83, 0x00, 0xa4, 0x00, 0x8b,
+    0x00, 0xa3, 0xc0, 0x91, 0x00, 0xa3, 0xe0, 0x8b, 0x00, 0xa3, 0x60, 0x9b,
+    0x00, 0xc5, 0xb1, 0x91, 0x00, 0xa2, 0x10, 0x83, 0x00, 0xa2, 0x30, 0x8b,
+    0x00, 0xa1, 0xf0, 0x8b, 0x00, 0xa1, 0x80, 0x8b, 0x00, 0xab, 0xf0, 0x97,
+    0x08, 0x15, 0xd9, 0xa1, 0x08, 0x16, 0x41, 0xa2, 0x08, 0x16, 0x80, 0xc3,
+    0x48, 0xd5, 0x08, 0x2a, 0x79, 0xc2, 0x0d, 0x1d, 0x08, 0x2a, 0xa8, 0xc2,
+    0x01, 0xd7, 0x08, 0x29, 0xb9, 0x83, 0x08, 0x29, 0xd8, 0x83, 0x08, 0x29,
+    0xcb, 0x02, 0xbe, 0x03, 0xc2, 0x69, 0x96, 0x08, 0x2a, 0x49, 0x8b, 0x08,
+    0x2a, 0x50, 0x94, 0x08, 0x2a, 0x11, 0xc2, 0x14, 0xdf, 0x08, 0x2b, 0x00,
+    0x9b, 0x08, 0x2a, 0x59, 0x99, 0x08, 0x2a, 0xf8, 0x83, 0x08, 0x29, 0xeb,
+    0x02, 0xbe, 0x07, 0xc2, 0x69, 0x96, 0x08, 0x2a, 0xe8, 0xc3, 0x02, 0x66,
+    0x0f, 0x01, 0x51, 0xc4, 0xab, 0x80, 0x0f, 0x00, 0xb8, 0x47, 0x19, 0xb0,
+    0xc2, 0xbe, 0x0b, 0xcb, 0x8c, 0x78, 0x0f, 0x00, 0x51, 0xc3, 0x7e, 0xca,
+    0x0f, 0x00, 0x48, 0xc6, 0xc4, 0xc3, 0x0f, 0x01, 0x41, 0xc3, 0xe5, 0x47,
+    0x0f, 0x00, 0x08, 0x91, 0x0f, 0x01, 0x31, 0x97, 0x0f, 0x01, 0x19, 0xc3,
+    0x01, 0x17, 0x0f, 0x01, 0x09, 0x07, 0x42, 0xbe, 0x17, 0xc8, 0xaf, 0x2f,
+    0x0f, 0x01, 0x21, 0x0a, 0xc2, 0xbe, 0x21, 0xc4, 0xe4, 0x68, 0x0f, 0x00,
+    0xa0, 0xc2, 0x00, 0x8d, 0x0f, 0x00, 0xe1, 0xc5, 0xd8, 0x7d, 0x0f, 0x00,
+    0xa8, 0xc5, 0xda, 0x5d, 0x0f, 0x00, 0x61, 0xc4, 0xe2, 0x58, 0x0f, 0x00,
+    0x20, 0xc5, 0xd5, 0xf8, 0x0f, 0x00, 0x41, 0xc6, 0xd1, 0x72, 0x0f, 0x00,
+    0x30, 0x48, 0x22, 0xe0, 0xc2, 0xbe, 0x2b, 0xcb, 0x95, 0xd6, 0x00, 0x1a,
+    0x11, 0xc7, 0xc8, 0x6c, 0x00, 0x1a, 0x19, 0xcf, 0x62, 0x5a, 0x00, 0x1a,
+    0x21, 0xcd, 0x48, 0x3c, 0x00, 0x1a, 0x28, 0x45, 0xdc, 0xec, 0xc2, 0xbe,
+    0x35, 0x42, 0x00, 0x98, 0xc2, 0xbe, 0x41, 0xcc, 0x85, 0x08, 0x00, 0x1a,
+    0x78, 0xcc, 0x80, 0x7c, 0x01, 0x06, 0xd1, 0xcb, 0x01, 0x7e, 0x01, 0x06,
+    0xa0, 0xcb, 0x92, 0xbe, 0x00, 0xee, 0x49, 0xc6, 0x69, 0x7a, 0x00, 0xee,
+    0x38, 0xc6, 0x0a, 0x23, 0x00, 0x18, 0x0b, 0x02, 0xbe, 0x49, 0xc9, 0x2a,
+    0xc0, 0x00, 0x1a, 0x08, 0x01, 0xc2, 0xbe, 0x4f, 0x19, 0x42, 0xbe, 0x67,
+    0xc7, 0x1d, 0x6a, 0x01, 0x06, 0xc1, 0xc5, 0x00, 0xd2, 0x00, 0x18, 0x51,
+    0xc5, 0x01, 0x24, 0x00, 0x19, 0x28, 0xd0, 0x2e, 0x72, 0x01, 0x07, 0x29,
+