[clang] c92056d - [Clang][C++23] P2071 Named universal character escapes

Corentin Jabot via cfe-commits cfe-commits at lists.llvm.org
Sat Jun 25 10:03:44 PDT 2022


Author: Corentin Jabot
Date: 2022-06-25T19:03:33+02:00
New Revision: c92056d038812c23800131892bee48abb2de7ca0

URL: https://github.com/llvm/llvm-project/commit/c92056d038812c23800131892bee48abb2de7ca0
DIFF: https://github.com/llvm/llvm-project/commit/c92056d038812c23800131892bee48abb2de7ca0.diff

LOG: [Clang][C++23] P2071 Named universal character escapes

Implements [[ https://wg21.link/p2071r1  | P2071 Named Universal Character Escapes ]] - as an extension in all language mode, the patch  not warn in c++23 mode will be done later once this paper is plenary approved (in July).

We add

 * A code generator that transforms `UnicodeData.txt` and `NameAliases.txt` to a space efficient data structure that can be queried in `O(NameLength)`
 * A set of functions in `Unicode.h` to query that data, including

   * A function to find an exact match of a given Unicode character name
   * A function to perform a loose (ignoring case, space, underscore, medial hyphen) matching
   * A function returning the best matching codepoint for a given string per edit distance

 * Support of `\N{}` escape sequences in String and character Literals, with loose and typos diagnostics/fixits
 * Support of `\N{}` as UCN with loose matching diagnostics/fixits.

Loose matching is considered an error to match closely the semantics of P2071.

The generated data contributes to 280kB of data to the binaries.

`UnicodeData.txt` and `NameAliases.txt`  are not committed to the repository in this patch, and regenerating the data is a manual process.

Reviewed By: tahonermann

Differential Revision: https://reviews.llvm.org/D123064

Added: 
    clang/test/FixIt/fixit-unicode-named-escape-sequences.c
    llvm/lib/Support/UnicodeNameToCodepoint.cpp
    llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
    llvm/utils/UnicodeData/CMakeLists.txt
    llvm/utils/UnicodeData/UnicodeNameMappingGenerator.cpp

Modified: 
    clang/include/clang/Basic/DiagnosticLexKinds.td
    clang/include/clang/Lex/Lexer.h
    clang/lib/Lex/Lexer.cpp
    clang/lib/Lex/LiteralSupport.cpp
    clang/test/Lexer/char-escapes-delimited.c
    clang/test/Lexer/unicode.c
    clang/test/Parser/cxx11-user-defined-literals.cpp
    clang/test/Preprocessor/ucn-pp-identifier.c
    clang/test/Sema/ucn-identifiers.c
    llvm/CMakeLists.txt
    llvm/include/llvm/Support/Unicode.h
    llvm/lib/Support/CMakeLists.txt
    llvm/unittests/Support/UnicodeTest.cpp

Removed: 
    


################################################################################
diff  --git a/clang/include/clang/Basic/DiagnosticLexKinds.td b/clang/include/clang/Basic/DiagnosticLexKinds.td
index 398fb15352fe6..ac86076140c58 100644
--- a/clang/include/clang/Basic/DiagnosticLexKinds.td
+++ b/clang/include/clang/Basic/DiagnosticLexKinds.td
@@ -128,7 +128,7 @@ def warn_utf8_symbol_zero_width : Warning<
   "some environments">, InGroup<DiagGroup<"unicode-zero-width">>;
 
 def ext_delimited_escape_sequence : Extension<
-  "delimited escape sequences are a Clang extension">,
+  "%select{delimited|named}0 escape sequences are a Clang extension">,
   InGroup<DiagGroup<"delimited-escape-sequence-extension">>;
 def err_delimited_escape_empty : Error<
   "delimited escape sequence cannot be empty">;
@@ -138,6 +138,13 @@ def err_delimited_escape_invalid : Error<
   "invalid digit '%0' in escape sequence">;
 def err_hex_escape_no_digits : Error<
   "\\%0 used with no following hex digits">;
+def err_invalid_ucn_name : Error<
+  "'%0' is not a valid Unicode character name">;
+def note_invalid_ucn_name_loose_matching : Note<
+  "characters names in Unicode escape sequences are sensitive to case and whitespaces">;
+def note_invalid_ucn_name_candidate : Note<
+  "did you mean %0 ('%2' U+%1)?">;
+
 def warn_ucn_escape_no_digits : Warning<
   "\\%0 used with no following hex digits; "
   "treating as '\\' followed by identifier">, InGroup<Unicode>;
@@ -145,10 +152,10 @@ def err_ucn_escape_incomplete : Error<
   "incomplete universal character name">;
 def warn_delimited_ucn_incomplete : Warning<
   "incomplete delimited universal character name; "
-  "treating as '\\' 'u' '{' identifier">, InGroup<Unicode>;
+  "treating as '\\' '%0' '{' identifier">, InGroup<Unicode>;
 def warn_delimited_ucn_empty : Warning<
   "empty delimited universal character name; "
-  "treating as '\\' 'u' '{' '}'">, InGroup<Unicode>;
+  "treating as '\\' '%0' '{' '}'">, InGroup<Unicode>;
 def warn_ucn_escape_incomplete : Warning<
   "incomplete universal character name; "
   "treating as '\\' followed by identifier">, InGroup<Unicode>;

diff  --git a/clang/include/clang/Lex/Lexer.h b/clang/include/clang/Lex/Lexer.h
index d04b332934655..748a112b7d57b 100644
--- a/clang/include/clang/Lex/Lexer.h
+++ b/clang/include/clang/Lex/Lexer.h
@@ -769,6 +769,11 @@ class Lexer : public PreprocessorLexer {
   void codeCompleteIncludedFile(const char *PathStart,
                                 const char *CompletionPoint, bool IsAngled);
 
+  llvm::Optional<uint32_t>
+  tryReadNumericUCN(const char *&StartPtr, const char *SlashLoc, Token *Result);
+  llvm::Optional<uint32_t> tryReadNamedUCN(const char *&StartPtr,
+                                           Token *Result);
+
   /// Read a universal character name.
   ///
   /// \param StartPtr The position in the source buffer after the initial '\'.

diff  --git a/clang/lib/Lex/Lexer.cpp b/clang/lib/Lex/Lexer.cpp
index d4601261b58bc..122861c4d2520 100644
--- a/clang/lib/Lex/Lexer.cpp
+++ b/clang/lib/Lex/Lexer.cpp
@@ -37,6 +37,7 @@
 #include "llvm/Support/MathExtras.h"
 #include "llvm/Support/MemoryBufferRef.h"
 #include "llvm/Support/NativeFormatting.h"
+#include "llvm/Support/Unicode.h"
 #include "llvm/Support/UnicodeCharRanges.h"
 #include <algorithm>
 #include <cassert>
@@ -3119,27 +3120,28 @@ bool Lexer::isCodeCompletionPoint(const char *CurPtr) const {
   return false;
 }
 
-uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
-                           Token *Result) {
+llvm::Optional<uint32_t> Lexer::tryReadNumericUCN(const char *&StartPtr,
+                                                  const char *SlashLoc,
+                                                  Token *Result) {
   unsigned CharSize;
   char Kind = getCharAndSize(StartPtr, CharSize);
-  bool Delimited = false;
-  bool FoundEndDelimiter = false;
-  unsigned Count = 0;
-  bool Diagnose = Result && !isLexingRawMode();
+  assert((Kind == 'u' || Kind == 'U') && "expected a UCN");
 
   unsigned NumHexDigits;
   if (Kind == 'u')
     NumHexDigits = 4;
   else if (Kind == 'U')
     NumHexDigits = 8;
-  else
-    return 0;
+
+  bool Delimited = false;
+  bool FoundEndDelimiter = false;
+  unsigned Count = 0;
+  bool Diagnose = Result && !isLexingRawMode();
 
   if (!LangOpts.CPlusPlus && !LangOpts.C99) {
     if (Diagnose)
       Diag(SlashLoc, diag::warn_ucn_not_valid_in_c89);
-    return 0;
+    return llvm::None;
   }
 
   const char *CurPtr = StartPtr + CharSize;
@@ -3166,14 +3168,14 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
         break;
       if (Diagnose)
         Diag(BufferPtr, diag::warn_delimited_ucn_incomplete)
-            << StringRef(&C, 1);
-      return 0;
+            << StringRef(KindLoc, 1);
+      return llvm::None;
     }
 
     if (CodePoint & 0xF000'0000) {
       if (Diagnose)
         Diag(KindLoc, diag::err_escape_too_large) << 0;
-      return 0;
+      return llvm::None;
     }
 
     CodePoint <<= 4;
@@ -3187,7 +3189,13 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
       Diag(StartPtr, FoundEndDelimiter ? diag::warn_delimited_ucn_empty
                                        : diag::warn_ucn_escape_no_digits)
           << StringRef(KindLoc, 1);
-    return 0;
+    return llvm::None;
+  }
+
+  if (Delimited && Kind == 'U') {
+    if (Diagnose)
+      Diag(StartPtr, diag::err_hex_escape_no_digits) << StringRef(KindLoc, 1);
+    return llvm::None;
   }
 
   if (!Delimited && Count != NumHexDigits) {
@@ -3200,11 +3208,11 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
             << FixItHint::CreateReplacement(URange, "u");
       }
     }
-    return 0;
+    return llvm::None;
   }
 
   if (Delimited && PP) {
-    Diag(BufferPtr, diag::ext_delimited_escape_sequence);
+    Diag(BufferPtr, diag::ext_delimited_escape_sequence) << /*delimited*/ 0;
   }
 
   if (Result) {
@@ -3217,6 +3225,110 @@ uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
   } else {
     StartPtr = CurPtr;
   }
+  return CodePoint;
+}
+
+llvm::Optional<uint32_t> Lexer::tryReadNamedUCN(const char *&StartPtr,
+                                                Token *Result) {
+  unsigned CharSize;
+  bool Diagnose = Result && !isLexingRawMode();
+
+  char C = getCharAndSize(StartPtr, CharSize);
+  assert(C == 'N' && "expected \\N{...}");
+
+  const char *CurPtr = StartPtr + CharSize;
+  const char *KindLoc = &CurPtr[-1];
+
+  C = getCharAndSize(CurPtr, CharSize);
+  if (C != '{') {
+    if (Diagnose)
+      Diag(StartPtr, diag::warn_ucn_escape_incomplete);
+    return llvm::None;
+  }
+  CurPtr += CharSize;
+  const char *StartName = CurPtr;
+  bool FoundEndDelimiter = false;
+  llvm::SmallVector<char, 30> Buffer;
+  while (C) {
+    C = getCharAndSize(CurPtr, CharSize);
+    CurPtr += CharSize;
+    if (C == '}') {
+      FoundEndDelimiter = true;
+      break;
+    }
+
+    if (!isAlphanumeric(C) && C != '_' && C != '-' && C != ' ')
+      break;
+    Buffer.push_back(C);
+  }
+
+  if (!FoundEndDelimiter || Buffer.empty()) {
+    if (Diagnose)
+      Diag(StartPtr, FoundEndDelimiter ? diag::warn_delimited_ucn_empty
+                                       : diag::warn_delimited_ucn_incomplete)
+          << StringRef(KindLoc, 1);
+    return llvm::None;
+  }
+
+  StringRef Name(Buffer.data(), Buffer.size());
+  llvm::Optional<char32_t> Res =
+      llvm::sys::unicode::nameToCodepointStrict(Name);
+  llvm::Optional<llvm::sys::unicode::LooseMatchingResult> LooseMatch;
+  if (!Res) {
+    if (!isLexingRawMode()) {
+      Diag(StartPtr, diag::err_invalid_ucn_name)
+          << StringRef(Buffer.data(), Buffer.size());
+      LooseMatch = llvm::sys::unicode::nameToCodepointLooseMatching(Name);
+      if (LooseMatch) {
+        Diag(StartName, diag::note_invalid_ucn_name_loose_matching)
+            << FixItHint::CreateReplacement(
+                   makeCharRange(*this, StartName, CurPtr - CharSize),
+                   LooseMatch->Name);
+      }
+    }
+    // When finding a match using Unicode loose matching rules
+    // recover after having emitted a diagnostic.
+    if (!LooseMatch)
+      return llvm::None;
+    // We do not offer missspelled character names suggestions here
+    // as the set of what would be a valid suggestion depends on context,
+    // and we should not make invalid suggestions.
+  }
+
+  if (Diagnose && PP && !LooseMatch)
+    Diag(BufferPtr, diag::ext_delimited_escape_sequence) << /*named*/ 1;
+
+  if (LooseMatch)
+    Res = LooseMatch->CodePoint;
+
+  if (Result) {
+    Result->setFlag(Token::HasUCN);
+    if (CurPtr - StartPtr == (ptr
diff _t)(Buffer.size() + 4))
+      StartPtr = CurPtr;
+    else
+      while (StartPtr != CurPtr)
+        (void)getAndAdvanceChar(StartPtr, *Result);
+  } else {
+    StartPtr = CurPtr;
+  }
+  return *Res;
+}
+
+uint32_t Lexer::tryReadUCN(const char *&StartPtr, const char *SlashLoc,
+                           Token *Result) {
+
+  unsigned CharSize;
+  llvm::Optional<uint32_t> CodePointOpt;
+  char Kind = getCharAndSize(StartPtr, CharSize);
+  if (Kind == 'u' || Kind == 'U')
+    CodePointOpt = tryReadNumericUCN(StartPtr, SlashLoc, Result);
+  else if (Kind == 'N')
+    CodePointOpt = tryReadNamedUCN(StartPtr, Result);
+
+  if (!CodePointOpt)
+    return 0;
+
+  uint32_t CodePoint = *CodePointOpt;
 
   // Don't apply C family restrictions to UCNs in assembly mode
   if (LangOpts.AsmPreprocessor)

diff  --git a/clang/lib/Lex/LiteralSupport.cpp b/clang/lib/Lex/LiteralSupport.cpp
index 9a30a41c851d7..e781138466676 100644
--- a/clang/lib/Lex/LiteralSupport.cpp
+++ b/clang/lib/Lex/LiteralSupport.cpp
@@ -27,6 +27,7 @@
 #include "llvm/Support/ConvertUTF.h"
 #include "llvm/Support/Error.h"
 #include "llvm/Support/ErrorHandling.h"
+#include "llvm/Support/Unicode.h"
 #include <algorithm>
 #include <cassert>
 #include <cstddef>
@@ -233,7 +234,8 @@ static unsigned ProcessCharEscape(const char *ThisTokBegin,
       HadError = true;
       if (Diags)
         Diag(Diags, Features, Loc, ThisTokBegin, EscapeBegin, ThisTokBuf,
-             diag::err_delimited_escape_missing_brace);
+             diag::err_delimited_escape_missing_brace)
+            << "o";
 
       break;
     }
@@ -309,7 +311,8 @@ static unsigned ProcessCharEscape(const char *ThisTokBegin,
           << tok::r_brace;
     else if (!HadError) {
       Diag(Diags, Features, Loc, ThisTokBegin, EscapeBegin, ThisTokBuf,
-           diag::ext_delimited_escape_sequence);
+           diag::ext_delimited_escape_sequence)
+          << /*delimited*/ 0;
     }
   }
 
@@ -335,7 +338,7 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
     char Kind = *I;
     ++I;
 
-    assert(Kind == 'u' || Kind == 'U');
+    assert(Kind == 'u' || Kind == 'U' || Kind == 'N');
     uint32_t CodePoint = 0;
 
     if (Kind == 'u' && *I == '{') {
@@ -349,6 +352,22 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
       continue;
     }
 
+    if (Kind == 'N') {
+      assert(*I == '{');
+      ++I;
+      auto Delim = std::find(I, Input.end(), '}');
+      assert(Delim != Input.end());
+      llvm::Optional<llvm::sys::unicode::LooseMatchingResult> Res =
+          llvm::sys::unicode::nameToCodepointLooseMatching(
+              StringRef(I, std::distance(I, Delim)));
+      assert(Res);
+      CodePoint = Res->CodePoint;
+      assert(CodePoint != 0xFFFFFFFF);
+      appendCodePoint(CodePoint, Buf);
+      I = Delim;
+      continue;
+    }
+
     unsigned NumHexDigits;
     if (Kind == 'u')
       NumHexDigits = 4;
@@ -370,23 +389,20 @@ void clang::expandUCNs(SmallVectorImpl<char> &Buf, StringRef Input) {
   }
 }
 
-/// ProcessUCNEscape - Read the Universal Character Name, check constraints and
-/// return the UTF32.
-static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
-                             const char *ThisTokEnd,
-                             uint32_t &UcnVal, unsigned short &UcnLen,
-                             FullSourceLoc Loc, DiagnosticsEngine *Diags,
-                             const LangOptions &Features,
-                             bool in_char_string_literal = false) {
+static bool ProcessNumericUCNEscape(const char *ThisTokBegin,
+                                    const char *&ThisTokBuf,
+                                    const char *ThisTokEnd, uint32_t &UcnVal,
+                                    unsigned short &UcnLen, bool &Delimited,
+                                    FullSourceLoc Loc, DiagnosticsEngine *Diags,
+                                    const LangOptions &Features,
+                                    bool in_char_string_literal = false) {
   const char *UcnBegin = ThisTokBuf;
+  bool HasError = false;
+  bool EndDelimiterFound = false;
 
   // Skip the '\u' char's.
   ThisTokBuf += 2;
-
-  bool Delimited = false;
-  bool EndDelimiterFound = false;
-  bool HasError = false;
-
+  Delimited = false;
   if (UcnBegin[1] == 'u' && in_char_string_literal &&
       ThisTokBuf != ThisTokEnd && *ThisTokBuf == '{') {
     Delimited = true;
@@ -394,7 +410,8 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
   } else if (ThisTokBuf == ThisTokEnd || !isHexDigit(*ThisTokBuf)) {
     if (Diags)
       Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
-           diag::err_hex_escape_no_digits) << StringRef(&ThisTokBuf[-1], 1);
+           diag::err_hex_escape_no_digits)
+          << StringRef(&ThisTokBuf[-1], 1);
     return false;
   }
   UcnLen = (ThisTokBuf[-1] == 'u' ? 4 : 8);
@@ -455,7 +472,136 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
                      : diag::err_ucn_escape_incomplete);
     return false;
   }
+  return !HasError;
+}
+
+static void DiagnoseInvalidUnicodeCharacterName(
+    DiagnosticsEngine *Diags, const LangOptions &Features, FullSourceLoc Loc,
+    const char *TokBegin, const char *TokRangeBegin, const char *TokRangeEnd,
+    llvm::StringRef Name) {
+
+  Diag(Diags, Features, Loc, TokBegin, TokRangeBegin, TokRangeEnd,
+       diag::err_invalid_ucn_name)
+      << Name;
+
+  namespace u = llvm::sys::unicode;
+
+  llvm::Optional<u::LooseMatchingResult> Res =
+      u::nameToCodepointLooseMatching(Name);
+  if (Res) {
+    Diag(Diags, Features, Loc, TokBegin, TokRangeBegin, TokRangeEnd,
+         diag::note_invalid_ucn_name_loose_matching)
+        << FixItHint::CreateReplacement(
+               MakeCharSourceRange(Features, Loc, TokBegin, TokRangeBegin,
+                                   TokRangeEnd),
+               Res->Name);
+    return;
+  }
+
+  unsigned Distance = 0;
+  SmallVector<u::MatchForCodepointName> Matches =
+      u::nearestMatchesForCodepointName(Name, 5);
+  assert(!Matches.empty() && "No unicode characters found");
+
+  for (const auto &Match : Matches) {
+    if (Distance == 0)
+      Distance = Match.Distance;
+    if (std::max(Distance, Match.Distance) -
+            std::min(Distance, Match.Distance) >
+        3)
+      break;
+    Distance = Match.Distance;
+
+    std::string Str;
+    llvm::UTF32 V = Match.Value;
+    LLVM_ATTRIBUTE_UNUSED bool Converted =
+        llvm::convertUTF32ToUTF8String(llvm::ArrayRef<llvm::UTF32>(&V, 1), Str);
+    assert(Converted && "Found a match wich is not a unicode character");
+
+    Diag(Diags, Features, Loc, TokBegin, TokRangeBegin, TokRangeEnd,
+         diag::note_invalid_ucn_name_candidate)
+        << Match.Name << llvm::utohexstr(Match.Value)
+        << Str // FIXME: Fix the rendering of non printable characters
+        << FixItHint::CreateReplacement(
+               MakeCharSourceRange(Features, Loc, TokBegin, TokRangeBegin,
+                                   TokRangeEnd),
+               Match.Name);
+  }
+}
 
+static bool ProcessNamedUCNEscape(const char *ThisTokBegin,
+                                  const char *&ThisTokBuf,
+                                  const char *ThisTokEnd, uint32_t &UcnVal,
+                                  unsigned short &UcnLen, FullSourceLoc Loc,
+                                  DiagnosticsEngine *Diags,
+                                  const LangOptions &Features) {
+  const char *UcnBegin = ThisTokBuf;
+  assert(UcnBegin[0] == '\\' && UcnBegin[1] == 'N');
+  ThisTokBuf += 2;
+  if (ThisTokBuf == ThisTokEnd || *ThisTokBuf != '{') {
+    if (Diags) {
+      Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
+           diag::err_delimited_escape_missing_brace)
+          << StringRef(&ThisTokBuf[-1], 1);
+    }
+    ThisTokBuf++;
+    return false;
+  }
+  ThisTokBuf++;
+  const char *ClosingBrace =
+      std::find_if_not(ThisTokBuf, ThisTokEnd, [](char C) {
+        return llvm::isAlnum(C) || llvm::isSpace(C) || C == '_' || C == '-';
+      });
+  bool Incomplete = ClosingBrace == ThisTokEnd || *ClosingBrace != '}';
+  bool Empty = ClosingBrace == ThisTokBuf;
+  if (Incomplete || Empty) {
+    if (Diags) {
+      Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
+           Incomplete ? diag::err_ucn_escape_incomplete
+                      : diag::err_delimited_escape_empty)
+          << StringRef(&UcnBegin[1], 1);
+    }
+    ThisTokBuf = ClosingBrace == ThisTokEnd ? ClosingBrace : ClosingBrace + 1;
+    return false;
+  }
+  StringRef Name(ThisTokBuf, ClosingBrace - ThisTokBuf);
+  ThisTokBuf = ClosingBrace + 1;
+  llvm::Optional<char32_t> Res =
+      llvm::sys::unicode::nameToCodepointStrict(Name);
+  if (!Res) {
+    if (Diags)
+      DiagnoseInvalidUnicodeCharacterName(Diags, Features, Loc, ThisTokBegin,
+                                          &UcnBegin[3], ClosingBrace, Name);
+    return false;
+  }
+  UcnVal = *Res;
+  UcnLen = UcnVal > 0xFFFF ? 8 : 4;
+  return true;
+}
+
+/// ProcessUCNEscape - Read the Universal Character Name, check constraints and
+/// return the UTF32.
+static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
+                             const char *ThisTokEnd, uint32_t &UcnVal,
+                             unsigned short &UcnLen, FullSourceLoc Loc,
+                             DiagnosticsEngine *Diags,
+                             const LangOptions &Features,
+                             bool in_char_string_literal = false) {
+
+  bool HasError;
+  const char *UcnBegin = ThisTokBuf;
+  bool IsDelimitedEscapeSequence = false;
+  bool IsNamedEscapeSequence = false;
+  if (ThisTokBuf[1] == 'N') {
+    IsNamedEscapeSequence = true;
+    HasError = !ProcessNamedUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd,
+                                      UcnVal, UcnLen, Loc, Diags, Features);
+  } else {
+    HasError =
+        !ProcessNumericUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd, UcnVal,
+                                 UcnLen, IsDelimitedEscapeSequence, Loc, Diags,
+                                 Features, in_char_string_literal);
+  }
   if (HasError)
     return false;
 
@@ -493,9 +639,10 @@ static bool ProcessUCNEscape(const char *ThisTokBegin, const char *&ThisTokBuf,
     Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
          diag::warn_ucn_not_valid_in_c89_literal);
 
-  if (Delimited && Diags)
+  if ((IsDelimitedEscapeSequence || IsNamedEscapeSequence) && Diags)
     Diag(Diags, Features, Loc, ThisTokBegin, UcnBegin, ThisTokBuf,
-         diag::ext_delimited_escape_sequence);
+         diag::ext_delimited_escape_sequence)
+        << (IsNamedEscapeSequence ? 1 : 0);
 
   return true;
 }
@@ -1559,7 +1706,7 @@ CharLiteralParser::CharLiteralParser(const char *begin, const char *end,
       continue;
     }
     // Is this a Universal Character Name escape?
-    if (begin[1] == 'u' || begin[1] == 'U') {
+    if (begin[1] == 'u' || begin[1] == 'U' || begin[1] == 'N') {
       unsigned short UcnLen = 0;
       if (!ProcessUCNEscape(TokBegin, begin, end, *buffer_begin, UcnLen,
                             FullSourceLoc(Loc, PP.getSourceManager()),
@@ -1919,7 +2066,8 @@ void StringLiteralParser::init(ArrayRef<Token> StringToks){
           continue;
         }
         // Is this a Universal Character Name escape?
-        if (ThisTokBuf[1] == 'u' || ThisTokBuf[1] == 'U') {
+        if (ThisTokBuf[1] == 'u' || ThisTokBuf[1] == 'U' ||
+            ThisTokBuf[1] == 'N') {
           EncodeUCNEscape(ThisTokBegin, ThisTokBuf, ThisTokEnd,
                           ResultPtr, hadError,
                           FullSourceLoc(StringToks[i].getLocation(), SM),
@@ -2112,7 +2260,8 @@ unsigned StringLiteralParser::getOffsetOfStringByte(const Token &Tok,
 
     // Otherwise, this is an escape character.  Advance over it.
     bool HadError = false;
-    if (SpellingPtr[1] == 'u' || SpellingPtr[1] == 'U') {
+    if (SpellingPtr[1] == 'u' || SpellingPtr[1] == 'U' ||
+        SpellingPtr[1] == 'N') {
       const char *EscapePtr = SpellingPtr;
       unsigned Len = MeasureUCNEscape(SpellingStart, SpellingPtr, SpellingEnd,
                                       1, Features, HadError);

diff  --git a/clang/test/FixIt/fixit-unicode-named-escape-sequences.c b/clang/test/FixIt/fixit-unicode-named-escape-sequences.c
new file mode 100644
index 0000000000000..1f956427b1840
--- /dev/null
+++ b/clang/test/FixIt/fixit-unicode-named-escape-sequences.c
@@ -0,0 +1,29 @@
+// RUN: not %clang_cc1 -fsyntax-only -fdiagnostics-parseable-fixits %s 2>&1 | FileCheck -check-prefix=CHECK-MACHINE %s
+const char*
+\N{GREEK_SMALL_LETTER-OMICRON} = // expected-error {{'GREEK_SMALL_LETTER-OMICRON' is not a valid Unicode character name}} \
+                                 // expected-note {{sensitive to case and whitespaces}}
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-2]]:4-[[@LINE-2]]:30}:"GREEK SMALL LETTER OMICRON"
+
+"\N{zero width no break space}" // expected-error {{'zero width no break space' is not a valid Unicode character name}} \
+                               // expected-note {{sensitive to case and whitespaces}}
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-2]]:5-[[@LINE-2]]:30}:"ZERO WIDTH NO-BREAK SPACE"
+
+"abc\N{MAN IN A BUSINESS SUIT LEVITATING}" // expected-error {{'MAN IN A BUSINESS SUIT LEVITATING' is not a valid Unicode character name}} \
+                                           // expected-note {{did you mean MAN IN BUSINESS SUIT LEVITATING ('🕴' U+1F574)?}}
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-2]]:8-[[@LINE-2]]:41}:"MAN IN BUSINESS SUIT LEVITATING"
+
+"\N{AAA}" // expected-error {{'AAA' is not a valid Unicode character name}} \
+          // expected-note 5{{did you mean}}
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-2]]:5-[[@LINE-2]]:8}:"ANT"
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-3]]:5-[[@LINE-3]]:8}:"ARC"
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-4]]:5-[[@LINE-4]]:8}:"AXE"
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-5]]:5-[[@LINE-5]]:8}:"BAT"
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-6]]:5-[[@LINE-6]]:8}:"CAT"
+
+"\N{BLACKCHESSBISHOP}" // expected-error {{'BLACKCHESSBISHOP' is not a valid Unicode character name}} \
+                       // expected-note {{sensitive to case and whitespaces}}
+// CHECK-MACHINE: fix-it:"{{.*}}":{[[@LINE-2]]:5-[[@LINE-2]]:21}:"BLACK CHESS BISHOP"
+
+;
+
+

diff  --git a/clang/test/Lexer/char-escapes-delimited.c b/clang/test/Lexer/char-escapes-delimited.c
index 461122dcdb119..ecacb161b7bc8 100644
--- a/clang/test/Lexer/char-escapes-delimited.c
+++ b/clang/test/Lexer/char-escapes-delimited.c
@@ -2,17 +2,20 @@
 // RUN: %clang_cc1 -x c -std=gnu11 -fsyntax-only -pedantic -verify %s
 // RUN: %clang_cc1 -x c++ -std=gnu++11 -fwchar-type=short -fno-signed-wchar -fsyntax-only -pedantic -verify %s
 // RUN: %clang_cc1 -x c -std=gnu11 -fwchar-type=short -fno-signed-wchar -fsyntax-only -pedantic -verify %s
+// RUN: %clang_cc1 -x c++ -std=c++17 -ftrigraphs -fsyntax-only -pedantic -verify -DTRIGRAPHS=1 %s
 
 const char *errors =
-    "\u{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\u{"   //expected-error {{expected '}'}}
-    "\u{h}" //expected-error {{invalid digit 'h' in escape sequence}}
-    "\x{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\x{"   //expected-error {{expected '}'}}
-    "\x{h}" //expected-error {{invalid digit 'h' in escape sequence}}
-    "\o{}"  //expected-error {{delimited escape sequence cannot be empty}}
-    "\o{"   //expected-error {{expected '}'}}
-    "\o{8}" //expected-error {{invalid digit '8' in escape sequence}}
+    "\u{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\u{"   // expected-error {{expected '}'}}
+    "\u{h}" // expected-error {{invalid digit 'h' in escape sequence}}
+    "\x{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\x{"   // expected-error {{expected '}'}}
+    "\x{h}" // expected-error {{invalid digit 'h' in escape sequence}}
+    "\o{}"  // expected-error {{delimited escape sequence cannot be empty}}
+    "\o{"   // expected-error {{expected '}'}}
+    "\o"    // expected-error {{expected '{' after '\o' escape sequence}}
+    "\o{8}" // expected-error {{invalid digit '8' in escape sequence}}
+    "\U{8}" // expected-error {{\U used with no following hex digits}}
     ;
 
 void ucn(void) {
@@ -70,6 +73,30 @@ void concat(void) {
   (void)"\o{12" "}"; // expected-error {{expected '}'}}
 }
 
+void named(void) {
+  char a = '\N{LOTUS}'; // expected-error{{character too large for enclosing character literal type}} \
+                        // expected-warning {{extension}}
+
+  char b  = '\N{DOLLAR SIGN}'; // expected-warning {{extension}}
+  char b_ = '\N{ DOL-LAR _SIGN }'; // expected-error {{' DOL-LAR _SIGN ' is not a valid Unicode character name}} \
+                               // expected-note {{characters names in Unicode escape sequences are sensitive to case and whitespaces}}
+
+  char c = '\N{NOTATHING}'; // expected-error {{'NOTATHING' is not a valid Unicode character name}} \
+                            // expected-note 5{{did you mean}}
+  char d = '\N{}';          // expected-error {{delimited escape sequence cannot be empty}}
+  char e = '\N{';           // expected-error {{incomplete universal character name}}
+
+  unsigned f = L'\N{GREEK CAPITAL LETTER DELTA}'; // expected-warning {{extension}}
+
+  unsigned g = u'\N{LOTUS}'; // expected-error {{character too large for enclosing character literal type}} \
+                             // expected-warning {{extension}}
+
+  unsigned h = U'\N{LOTUS}';                      // expected-warning {{extension}}
+  unsigned i = u'\N{GREEK CAPITAL LETTER DELTA}'; // expected-warning {{extension}}
+  char j = '\NN';                                 // expected-error {{expected '{' after '\N' escape sequence}}
+  unsigned k = u'\N{LOTUS';                       // expected-error {{incomplete universal character name}}
+}
+
 void separators(void) {
   (void)"\x{12'3}"; // expected-error {{invalid digit ''' in escape sequence}}
   (void)"\u{12'3}"; // expected-error {{invalid digit ''' in escape sequence}}
@@ -79,3 +106,12 @@ void separators(void) {
                  // expected-error at -1 2{{expected ';'}}
                  // expected-warning at -2 3{{expression result unused}}
 }
+
+#if L'\N{GREEK CAPITAL LETTER GAMMA}' != L'Γ' // expected-warning {{extension}}
+#error "oh no!"
+#endif
+
+#ifdef TRIGRAPHS
+static_assert('\N??<DOLLAR SIGN??>' == '$'); // expected-warning 2{{trigraph converted}} \
+                                             // expected-warning {{named escape sequences are a Clang extension}}
+#endif

diff  --git a/clang/test/Lexer/unicode.c b/clang/test/Lexer/unicode.c
index b0cc28cfb915a..efbd63fb00630 100644
--- a/clang/test/Lexer/unicode.c
+++ b/clang/test/Lexer/unicode.c
@@ -39,9 +39,14 @@ extern int 𐠈;
 extern int ꙮ;
 extern int  \u1B4C;     // BALINESE LETTER ARCHAIC JNYA - Added in Unicode 14
 extern int  \U00016AA2; // TANGSA LETTER GA - Added in Unicode 14
+extern int _\N{TANGSA LETTER GA};
+extern int _\N{TANGSALETTERGA}; // expected-error {{'TANGSALETTERGA' is not a valid Unicode character name}} \
+                                // expected-note {{characters names in Unicode escape sequences are sensitive to case and whitespace}}
+
+
+
 // This character doesn't have the XID_Start property
 extern int  \U00016AC0; // TANGSA DIGIT ZERO  // expected-error {{expected unqualified-id}}
-extern int _\U00016AC0; // TANGSA DIGIT ZERO
 
 extern int 🌹; // expected-error {{unexpected character <U+1F339>}} \
                   expected-warning {{declaration does not declare anything}}

diff  --git a/clang/test/Parser/cxx11-user-defined-literals.cpp b/clang/test/Parser/cxx11-user-defined-literals.cpp
index 143cdb502c041..1a7e780588229 100644
--- a/clang/test/Parser/cxx11-user-defined-literals.cpp
+++ b/clang/test/Parser/cxx11-user-defined-literals.cpp
@@ -131,6 +131,7 @@ int operator""_\u212e""_\U0000212e""_℮""(const char*, size_t);
 int operator""_\U0000212e""_℮""_\u212e""(const char*, size_t);
 
 int operator""_\u{212f}(char);
+int operator""_\N{SCRIPT SMALL E}(char);
 
 int mix_ucn_utf8 = ""_℮""_\u212e""_\U0000212e"";
 

diff  --git a/clang/test/Preprocessor/ucn-pp-identifier.c b/clang/test/Preprocessor/ucn-pp-identifier.c
index 1d91ad422b697..44d3d9e033138 100644
--- a/clang/test/Preprocessor/ucn-pp-identifier.c
+++ b/clang/test/Preprocessor/ucn-pp-identifier.c
@@ -1,5 +1,6 @@
 // RUN: %clang_cc1 %s -fsyntax-only -std=c99 -pedantic -verify -Wundef
 // RUN: %clang_cc1 %s -fsyntax-only -x c++ -pedantic -verify -Wundef
+// RUN: %clang_cc1 %s -fsyntax-only -x c++ -pedantic -verify -Wundef -ftrigraphs -DTRIGRAPHS=1
 // RUN: not %clang_cc1 %s -fsyntax-only -std=c99 -pedantic -Wundef 2>&1 | FileCheck -strict-whitespace %s
 
 #define \u00FC
@@ -29,9 +30,14 @@
 
 // Make sure we reject disallowed UCNs
 #define \ufffe // expected-error {{macro name must be an identifier}}
-#define \U10000000  // expected-error {{macro name must be an identifier}}
-#define \u0061  // expected-error {{character 'a' cannot be specified by a universal character name}} expected-error {{macro name must be an identifier}}
-#define \u{fffe} // expected-error {{macro name must be an identifier}} expected-warning {{Clang extension}}
+#define \U10000000       // expected-error {{macro name must be an identifier}}
+#define \u0061           // expected-error {{character 'a' cannot be specified by a universal character name}} expected-error {{macro name must be an identifier}}
+#define \u{fffe}        // expected-error {{macro name must be an identifier}} expected-warning {{Clang extension}}
+#define \N{ALERT}       // expected-error {{universal character name refers to a control character}} \
+                   // expected-error {{macro name must be an identifier}} \
+                   // expected-warning {{Clang extension}}
+#define \N{WASTEBASKET} // expected-error {{macro name must be an identifier}} \
+                        // expected-warning {{Clang extension}}
 
 #define a\u0024
 
@@ -113,3 +119,20 @@ C 1
 #define \u{123456789}  // expected-error {{hex escape sequence out of range}} expected-error {{macro name must be an identifier}}
 #define \u{            // expected-warning {{incomplete delimited universal character name; treating as '\' 'u' '{' identifier}} expected-error {{macro name must be an identifier}}
 #define \u{fgh}        // expected-warning {{incomplete delimited universal character name; treating as '\' 'u' '{' identifier}} expected-error {{macro name must be an identifier}}
+#define \N{            // expected-warning {{incomplete delimited universal character name; treating as '\' 'N' '{' identifier}} expected-error {{macro name must be an identifier}}
+#define \N{}           // expected-warning {{empty delimited universal character name; treating as '\' 'N' '{' '}'}} expected-error {{macro name must be an identifier}}
+#define \N{NOTATHING}  // expected-error {{'NOTATHING' is not a valid Unicode character name}} \
+                       // expected-error {{macro name must be an identifier}}
+#define \NN            // expected-warning {{incomplete universal character name; treating as '\' followed by identifier}} expected-error {{macro name must be an identifier}}
+#define \N{GREEK_SMALL-LETTERALPHA}  // expected-error {{'GREEK_SMALL-LETTERALPHA' is not a valid Unicode character name}} \
+                                     // expected-note {{characters names in Unicode escape sequences are sensitive to case and whitespaces}}
+
+#define CONCAT(A, B) A##B
+int CONCAT(\N{GREEK, CAPITALLETTERALPHA}); // expected-error{{expected}} \
+                                           // expected-warning {{incomplete delimited universal character name}}
+
+#ifdef TRIGRAPHS
+int \N??<GREEK CAPITAL LETTER ALPHA??> = 0; // expected-warning{{amed escape sequences are a Clang extension}} \
+                                            // expected-warning 2{{trigraph converted}}
+
+#endif

diff  --git a/clang/test/Sema/ucn-identifiers.c b/clang/test/Sema/ucn-identifiers.c
index 38106767f9ab5..fb7181f0beca2 100644
--- a/clang/test/Sema/ucn-identifiers.c
+++ b/clang/test/Sema/ucn-identifiers.c
@@ -18,6 +18,7 @@ void goodCalls(void) {
   über(2);
   \U000000FCber(3);
   \u{FC}ber(4); // expected-warning {{Clang extension}}
+  \N{LATIN SMALL LETTER U WITH DIAERESIS}ber(4); // expected-warning {{Clang extension}}
 }
 
 void badCalls(void) {

diff  --git a/llvm/CMakeLists.txt b/llvm/CMakeLists.txt
index 79b355750bf2b..645ab26dce46c 100644
--- a/llvm/CMakeLists.txt
+++ b/llvm/CMakeLists.txt
@@ -1107,6 +1107,7 @@ if( LLVM_INCLUDE_UTILS )
   add_subdirectory(utils/PerfectShuffle)
   add_subdirectory(utils/count)
   add_subdirectory(utils/not)
+  add_subdirectory(utils/UnicodeData)
   add_subdirectory(utils/yaml-bench)
 else()
   if ( LLVM_INCLUDE_TESTS )

diff  --git a/llvm/include/llvm/Support/Unicode.h b/llvm/include/llvm/Support/Unicode.h
index ca17bba2fbb42..eb811daeee345 100644
--- a/llvm/include/llvm/Support/Unicode.h
+++ b/llvm/include/llvm/Support/Unicode.h
@@ -14,6 +14,10 @@
 #ifndef LLVM_SUPPORT_UNICODE_H
 #define LLVM_SUPPORT_UNICODE_H
 
+#include "llvm/ADT/Optional.h"
+#include "llvm/ADT/SmallString.h"
+#include <string>
+
 namespace llvm {
 class StringRef;
 
@@ -63,6 +67,30 @@ int columnWidthUTF8(StringRef Text);
 /// rules.
 int foldCharSimple(int C);
 
+/// Maps the name or the alias of a Unicode character to its associated
+/// codepoints.
+/// The names and aliases are derived from UnicodeData.txt and NameAliases.txt
+/// For compatibility with the semantics of named character escape sequences in
+/// C++, this mapping does an exact match sensitive to casing and spacing.
+/// \return The codepoint of the corresponding character, if any.
+Optional<char32_t> nameToCodepointStrict(StringRef Name);
+
+struct LooseMatchingResult {
+  char32_t CodePoint;
+  SmallString<64> Name;
+};
+
+Optional<LooseMatchingResult> nameToCodepointLooseMatching(StringRef Name);
+
+struct MatchForCodepointName {
+  std::string Name;
+  uint32_t Distance = 0;
+  char32_t Value = 0;
+};
+
+SmallVector<MatchForCodepointName>
+nearestMatchesForCodepointName(StringRef Pattern, std::size_t MaxMatchesCount);
+
 } // namespace unicode
 } // namespace sys
 } // namespace llvm

diff  --git a/llvm/lib/Support/CMakeLists.txt b/llvm/lib/Support/CMakeLists.txt
index 6c98945ec2172..e1045e459d706 100644
--- a/llvm/lib/Support/CMakeLists.txt
+++ b/llvm/lib/Support/CMakeLists.txt
@@ -221,6 +221,8 @@ add_llvm_component_library(LLVMSupport
   TypeSize.cpp
   Unicode.cpp
   UnicodeCaseFold.cpp
+  UnicodeNameToCodepoint.cpp
+  UnicodeNameToCodepointGenerated.cpp
   VersionTuple.cpp
   VirtualFileSystem.cpp
   WithColor.cpp

diff  --git a/llvm/lib/Support/UnicodeNameToCodepoint.cpp b/llvm/lib/Support/UnicodeNameToCodepoint.cpp
new file mode 100644
index 0000000000000..71ee4ce9f2dd1
--- /dev/null
+++ b/llvm/lib/Support/UnicodeNameToCodepoint.cpp
@@ -0,0 +1,551 @@
+//===- llvm/Support/UnicodeNameToCodepoint.cpp - Unicode character properties
+//-*- C++ -*-===//
+//
+// Part of the LLVM Project, under the Apache License v2.0 with LLVM Exceptions.
+// See https://llvm.org/LICENSE.txt for license information.
+// SPDX-License-Identifier: Apache-2.0 WITH LLVM-exception
+//
+//===----------------------------------------------------------------------===//
+//
+// This file implements functions to map the name or alias of a unicode
+// character to its codepoint.
+//
+//===----------------------------------------------------------------------===//
+
+#include "llvm/ADT/STLExtras.h"
+#include "llvm/ADT/StringExtras.h"
+#include "llvm/ADT/StringRef.h"
+#include "llvm/Support/Unicode.h"
+
+namespace llvm {
+namespace sys {
+namespace unicode {
+
+extern const char *UnicodeNameToCodepointDict;
+extern const uint8_t *UnicodeNameToCodepointIndex;
+extern const std::size_t UnicodeNameToCodepointIndexSize;
+extern const std::size_t UnicodeNameToCodepointLargestNameSize;
+
+using BufferType = SmallString<64>;
+
+struct Node {
+  bool IsRoot = false;
+  char32_t Value = 0xFFFFFFFF;
+  uint32_t ChildrenOffset = 0;
+  bool HasSibling = false;
+  uint32_t Size = 0;
+  StringRef Name;
+  const Node *Parent = nullptr;
+
+  constexpr bool isValid() const {
+    return !Name.empty() || Value == 0xFFFFFFFF;
+  }
+  constexpr bool hasChildren() const { return ChildrenOffset != 0 || IsRoot; }
+
+  std::string fullName() const {
+    std::string S;
+    // Reserve enough space for most unicode code points.
+    // The chosen value represent the 99th percentile of name size as of
+    // Unicode 14.
+    S.reserve(46);
+    const Node *N = this;
+    while (N) {
+      std::reverse_copy(N->Name.begin(), N->Name.end(), std::back_inserter(S));
+      N = N->Parent;
+    }
+    std::reverse(S.begin(), S.end());
+    return S;
+  }
+};
+
+static Node createRoot() {
+  Node N;
+  N.IsRoot = true;
+  N.ChildrenOffset = 1;
+  N.Size = 1;
+  return N;
+}
+
+static Node readNode(uint32_t Offset, const Node *Parent = nullptr) {
+  if (Offset == 0)
+    return createRoot();
+
+  uint32_t Origin = Offset;
+  Node N;
+  N.Parent = Parent;
+  uint8_t NameInfo = UnicodeNameToCodepointIndex[Offset++];
+  if (Offset + 6 >= UnicodeNameToCodepointIndexSize)
+    return N;
+
+  bool LongName = NameInfo & 0x40;
+  bool HasValue = NameInfo & 0x80;
+  std::size_t Size = NameInfo & ~0xC0;
+  if (LongName) {
+    uint32_t NameOffset = (UnicodeNameToCodepointIndex[Offset++] << 8);
+    NameOffset |= UnicodeNameToCodepointIndex[Offset++];
+    N.Name = StringRef(UnicodeNameToCodepointDict + NameOffset, Size);
+  } else {
+    N.Name = StringRef(UnicodeNameToCodepointDict + Size, 1);
+  }
+  if (HasValue) {
+    uint8_t H = UnicodeNameToCodepointIndex[Offset++];
+    uint8_t M = UnicodeNameToCodepointIndex[Offset++];
+    uint8_t L = UnicodeNameToCodepointIndex[Offset++];
+    N.Value = ((H << 16) | (M << 8) | L) >> 3;
+
+    bool HasChildren = L & 0x02;
+    N.HasSibling = L & 0x01;
+
+    if (HasChildren) {
+      N.ChildrenOffset = UnicodeNameToCodepointIndex[Offset++] << 16;
+      N.ChildrenOffset |= UnicodeNameToCodepointIndex[Offset++] << 8;
+      N.ChildrenOffset |= UnicodeNameToCodepointIndex[Offset++];
+    }
+  } else {
+    uint8_t H = UnicodeNameToCodepointIndex[Offset++];
+    N.HasSibling = H & 0x80;
+    bool HasChildren = H & 0x40;
+    H &= ~0xC0;
+    if (HasChildren) {
+      N.ChildrenOffset = (H << 16);
+      N.ChildrenOffset |=
+          (uint32_t(UnicodeNameToCodepointIndex[Offset++]) << 8);
+      N.ChildrenOffset |= UnicodeNameToCodepointIndex[Offset++];
+    }
+  }
+  N.Size = Offset - Origin;
+  return N;
+}
+
+static bool startsWith(StringRef Name, StringRef Needle, bool Strict,
+                       std::size_t &Consummed, char &PreviousCharInName,
+                       char &PreviousCharInNeedle, bool IsPrefix = false) {
+
+  Consummed = 0;
+  if (Strict) {
+    if (!Name.startswith(Needle))
+      return false;
+    Consummed = Needle.size();
+    return true;
+  }
+  if (Needle.empty())
+    return true;
+
+  auto NamePos = Name.begin();
+  auto NeedlePos = Needle.begin();
+
+  char PreviousCharInNameOrigin = PreviousCharInName;
+  char PreviousCharInNeedleOrigin = PreviousCharInNeedle;
+
+  auto IgnoreSpaces = [](auto It, auto End, char &PreviousChar,
+                         bool IgnoreEnd = false) {
+    while (It != End) {
+      const auto Next = std::next(It);
+      // Ignore spaces, underscore, medial hyphens
+      // https://unicode.org/reports/tr44/#UAX44-LM2.
+      bool Ignore =
+          *It == ' ' || *It == '_' ||
+          (*It == '-' && isAlnum(PreviousChar) &&
+           ((Next != End && isAlnum(*Next)) || (Next == End && IgnoreEnd)));
+      PreviousChar = *It;
+      if (!Ignore)
+        break;
+      ++It;
+    }
+    return It;
+  };
+
+  while (true) {
+    NamePos = IgnoreSpaces(NamePos, Name.end(), PreviousCharInName);
+    NeedlePos =
+        IgnoreSpaces(NeedlePos, Needle.end(), PreviousCharInNeedle, IsPrefix);
+    if (NeedlePos == Needle.end())
+      break;
+    if (NamePos == Name.end())
+      break;
+    if (toUpper(*NeedlePos) != toUpper(*NamePos))
+      break;
+    NeedlePos++;
+    NamePos++;
+  }
+  Consummed = std::distance(Name.begin(), NamePos);
+  if (NeedlePos != Needle.end()) {
+    PreviousCharInName = PreviousCharInNameOrigin;
+    PreviousCharInNeedle = PreviousCharInNeedleOrigin;
+  }
+  return NeedlePos == Needle.end();
+}
+
+static std::tuple<Node, bool, uint32_t>
+compareNode(uint32_t Offset, StringRef Name, bool Strict,
+            char PreviousCharInName, char PreviousCharInNeedle,
+            BufferType &Buffer, const Node *Parent = nullptr) {
+  Node N = readNode(Offset, Parent);
+  std::size_t Consummed = 0;
+  bool DoesStartWith =
+      N.IsRoot || startsWith(Name, N.Name, Strict, Consummed,
+                             PreviousCharInName, PreviousCharInNeedle);
+  if (!DoesStartWith)
+    return {N, false, 0};
+
+  if (Name.size() - Consummed == 0 && N.Value != 0xFFFFFFFF)
+    return {N, true, N.Value};
+
+  if (N.hasChildren()) {
+    uint32_t ChildOffset = N.ChildrenOffset;
+    for (;;) {
+      Node C;
+      bool Matches;
+      uint32_t Value;
+      std::tie(C, Matches, Value) =
+          compareNode(ChildOffset, Name.substr(Consummed), Strict,
+                      PreviousCharInName, PreviousCharInNeedle, Buffer, &N);
+      if (Matches) {
+        std::reverse_copy(C.Name.begin(), C.Name.end(),
+                          std::back_inserter(Buffer));
+        return {N, true, Value};
+      }
+      ChildOffset += C.Size;
+      if (!C.HasSibling)
+        break;
+    }
+  }
+  return {N, false, 0};
+}
+
+static std::tuple<Node, bool, uint32_t>
+compareNode(uint32_t Offset, StringRef Name, bool Strict, BufferType &Buffer) {
+  return compareNode(Offset, Name, Strict, 0, 0, Buffer);
+}
+
+// clang-format off
+constexpr const char *const HangulSyllables[][3] = {
+    { "G",  "A",   ""   },
+    { "GG", "AE",  "G"  },
+    { "N",  "YA",  "GG" },
+    { "D",  "YAE", "GS" },
+    { "DD", "EO",  "N", },
+    { "R",  "E",   "NJ" },
+    { "M",  "YEO", "NH" },
+    { "B",  "YE",  "D"  },
+    { "BB", "O",   "L"  },
+    { "S",  "WA",  "LG" },
+    { "SS", "WAE", "LM" },
+    { "",   "OE",  "LB" },
+    { "J",  "YO",  "LS" },
+    { "JJ", "U",   "LT" },
+    { "C",  "WEO", "LP" },
+    { "K",  "WE",  "LH" },
+    { "T",  "WI",  "M"  },
+    { "P",  "YU",  "B"  },
+    { "H",  "EU",  "BS" },
+    { 0,    "YI",  "S"  },
+    { 0,    "I",   "SS" },
+    { 0,    0,     "NG" },
+    { 0,    0,     "J"  },
+    { 0,    0,     "C"  },
+    { 0,    0,     "K"  },
+    { 0,    0,     "T"  },
+    { 0,    0,     "P"  },
+    { 0,    0,     "H"  }
+    };
+// clang-format on
+
+// Unicode 14.0
+// 3.12 Conjoining Jamo Behavior Common constants
+constexpr const char32_t SBase = 0xAC00;
+constexpr const uint32_t LCount = 19;
+constexpr const uint32_t VCount = 21;
+constexpr const uint32_t TCount = 28;
+
+static std::size_t findSyllable(StringRef Name, bool Strict,
+                                char &PreviousInName, int &Pos, int Column) {
+  assert(Column == 0 || Column == 1 || Column == 2);
+  static std::size_t CountPerColumn[] = {LCount, VCount, TCount};
+  char NeedleStart = 0;
+  int Len = -1;
+  int Prev = PreviousInName;
+  for (std::size_t I = 0; I < CountPerColumn[Column]; I++) {
+    StringRef Syllable(HangulSyllables[I][Column]);
+    if (int(Syllable.size()) <= Len)
+      continue;
+    std::size_t Consummed = 0;
+    char PreviousInNameCopy = PreviousInName;
+    bool DoesStartWith = startsWith(Name, Syllable, Strict, Consummed,
+                                    PreviousInNameCopy, NeedleStart);
+    if (!DoesStartWith)
+      continue;
+    Len = Consummed;
+    Pos = I;
+    Prev = PreviousInNameCopy;
+  }
+  if (Len == -1)
+    return 0;
+  PreviousInName = Prev;
+  return size_t(Len);
+}
+
+static llvm::Optional<char32_t>
+nameToHangulCodePoint(StringRef Name, bool Strict, BufferType &Buffer) {
+  Buffer.clear();
+  // Hangul Syllable Decomposition
+  std::size_t Consummed = 0;
+  char NameStart = 0, NeedleStart = 0;
+  bool DoesStartWith = startsWith(Name, "HANGUL SYLLABLE ", Strict, Consummed,
+                                  NameStart, NeedleStart);
+  if (!DoesStartWith)
+    return None;
+  Name = Name.substr(Consummed);
+  int L = -1, V = -1, T = -1;
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, L, 0));
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, V, 1));
+  Name = Name.substr(findSyllable(Name, Strict, NameStart, T, 2));
+  if (L != -1 && V != -1 && T != -1 && Name.empty()) {
+    if (!Strict) {
+      Buffer.append("HANGUL SYLLABLE ");
+      if (L != -1)
+        Buffer.append(HangulSyllables[L][0]);
+      if (V != -1)
+        Buffer.append(HangulSyllables[V][1]);
+      if (T != -1)
+        Buffer.append(HangulSyllables[T][2]);
+    }
+    return SBase + (std::uint32_t(L) * VCount + std::uint32_t(V)) * TCount +
+           std::uint32_t(T);
+  }
+  // Otherwise, it's an illegal syllable name.
+  return None;
+}
+
+struct GeneratedNamesData {
+  StringRef Prefix;
+  uint32_t Start;
+  uint32_t End;
+};
+
+// Unicode 14.0 Table 4-8. Name Derivation Rule Prefix Strings
+// This needs to be kept in sync with
+// llvm/utils/UnicodeData/UnicodeNameMappingGenerator.cpp
+static const GeneratedNamesData GeneratedNamesDataTable[] = {
+    {"CJK UNIFIED IDEOGRAPH-", 0x3400, 0x4DBF},
+    {"CJK UNIFIED IDEOGRAPH-", 0x4E00, 0x9FFC},
+    {"CJK UNIFIED IDEOGRAPH-", 0x20000, 0x2A6DD},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2A700, 0x2B734},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2B740, 0x2B81D},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2B820, 0x2CEA1},
+    {"CJK UNIFIED IDEOGRAPH-", 0x2CEB0, 0x2EBE0},
+    {"CJK UNIFIED IDEOGRAPH-", 0x30000, 0x3134A},
+    {"TANGUT IDEOGRAPH-", 0x17000, 0x187F7},
+    {"TANGUT IDEOGRAPH-", 0x18D00, 0x18D08},
+    {"KHITAN SMALL SCRIPT CHARACTER-", 0x18B00, 0x18CD5},
+    {"NUSHU CHARACTER-", 0x1B170, 0x1B2FB},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0xF900, 0xFA6D},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0xFA70, 0xFAD9},
+    {"CJK COMPATIBILITY IDEOGRAPH-", 0x2F800, 0x2FA1D},
+};
+
+static llvm::Optional<char32_t>
+nameToGeneratedCodePoint(StringRef Name, bool Strict, BufferType &Buffer) {
+  for (auto &&Item : GeneratedNamesDataTable) {
+    Buffer.clear();
+    std::size_t Consummed = 0;
+    char NameStart = 0, NeedleStart = 0;
+    bool DoesStartWith = startsWith(Name, Item.Prefix, Strict, Consummed,
+                                    NameStart, NeedleStart, /*isPrefix*/ true);
+    if (!DoesStartWith)
+      continue;
+    auto Number = Name.substr(Consummed);
+    unsigned long long V = 0;
+    // Be consistent about mandating upper casing.
+    if (Strict &&
+        llvm::any_of(Number, [](char C) { return C >= 'a' && C <= 'f'; }))
+      return {};
+    if (getAsUnsignedInteger(Number, 16, V) || V < Item.Start || V > Item.End)
+      continue;
+    if (!Strict) {
+      Buffer.append(Item.Prefix);
+      Buffer.append(utohexstr(V, true));
+    }
+    return V;
+  }
+  return None;
+}
+
+static llvm::Optional<char32_t> nameToCodepoint(StringRef Name, bool Strict,
+                                                BufferType &Buffer) {
+  if (Name.empty())
+    return None;
+
+  llvm::Optional<char32_t> Res = nameToHangulCodePoint(Name, Strict, Buffer);
+  if (!Res)
+    Res = nameToGeneratedCodePoint(Name, Strict, Buffer);
+  if (Res)
+    return *Res;
+
+  Buffer.clear();
+  Node Node;
+  bool Matches;
+  uint32_t Value;
+  std::tie(Node, Matches, Value) = compareNode(0, Name, Strict, Buffer);
+  if (Matches) {
+    std::reverse(Buffer.begin(), Buffer.end());
+    // UAX44-LM2. Ignore case, whitespace, underscore ('_'), and all medial
+    // hyphens except the hyphen in U+1180 HANGUL JUNGSEONG O-E.
+    if (!Strict && Value == 0x116c &&
+        Name.find_insensitive("O-E") != StringRef::npos) {
+      Buffer = "HANGUL JUNGSEONG O-E";
+      Value = 0x1180;
+    }
+    return Value;
+  }
+  return None;
+}
+
+llvm::Optional<char32_t> nameToCodepointStrict(StringRef Name) {
+
+  BufferType Buffer;
+  auto Opt = nameToCodepoint(Name, true, Buffer);
+  return Opt;
+}
+
+llvm::Optional<LooseMatchingResult>
+nameToCodepointLooseMatching(StringRef Name) {
+  BufferType Buffer;
+  auto Opt = nameToCodepoint(Name, false, Buffer);
+  if (!Opt)
+    return None;
+  return LooseMatchingResult{*Opt, Buffer};
+}
+
+// Find the unicode character whose editing distance to Pattern
+// is shortest, using the Wagner–Fischer algorithm.
+llvm::SmallVector<MatchForCodepointName>
+nearestMatchesForCodepointName(StringRef Pattern, std::size_t MaxMatchesCount) {
+  // We maintain a fixed size vector of matches,
+  // sorted by distance
+  // The worst match (with the biggest distance) are discarded when new elements
+  // are added.
+  std::size_t LargestEditDistance = 0;
+  llvm::SmallVector<MatchForCodepointName> Matches;
+  Matches.reserve(MaxMatchesCount + 1);
+
+  auto Insert = [&](const Node &Node, uint32_t Distance,
+                    char32_t Value) -> bool {
+    if (Distance > LargestEditDistance) {
+      if (Matches.size() == MaxMatchesCount)
+        return false;
+      LargestEditDistance = Distance;
+    }
+    // To avoid allocations, the creation of the name is delayed
+    // as much as possible.
+    std::string Name;
+    auto GetName = [&] {
+      if (Name.empty())
+        Name = Node.fullName();
+      return Name;
+    };
+
+    auto It = std::lower_bound(
+        Matches.begin(), Matches.end(), Distance,
+        [&](const MatchForCodepointName &a, std::size_t Distance) {
+          if (Distance == a.Distance)
+            return a.Name < GetName();
+          return a.Distance < Distance;
+        });
+    if (It == Matches.end() && Matches.size() == MaxMatchesCount)
+      return false;
+
+    MatchForCodepointName M{GetName(), Distance, Value};
+    Matches.insert(It, std::move(M));
+    if (Matches.size() > MaxMatchesCount)
+      Matches.pop_back();
+    return true;
+  };
+
+  // We ignore case, space, hyphens, etc,
+  // in both the search pattern and the prospective names.
+  auto Normalize = [](StringRef Name) {
+    std::string Out;
+    Out.reserve(Name.size());
+    for (char C : Name) {
+      if (isAlnum(C))
+        Out.push_back(toUpper(C));
+    }
+    return Out;
+  };
+  std::string NormalizedName = Normalize(Pattern);
+
+  // Allocate a matrix big enough for longest names.
+  const std::size_t Columns =
+      std::min(NormalizedName.size(), UnicodeNameToCodepointLargestNameSize) +
+      1;
+
+  LLVM_ATTRIBUTE_UNUSED static std::size_t Rows =
+      UnicodeNameToCodepointLargestNameSize + 1;
+
+  std::vector<char> Distances(
+      Columns * (UnicodeNameToCodepointLargestNameSize + 1), 0);
+
+  auto Get = [&Distances, Columns](size_t Column, std::size_t Row) -> char & {
+    assert(Column < Columns);
+    assert(Row < Rows);
+    return Distances[Row * Columns + Column];
+  };
+
+  for (std::size_t I = 0; I < Columns; I++)
+    Get(I, 0) = I;
+
+  // Visit the childrens,
+  // Filling (and overriding) the matrix for the name fragment of each node
+  // iteratively. CompleteName is used to collect the actual name of potential
+  // match, respecting case and spacing.
+  auto VisitNode = [&](const Node &N, std::size_t Row,
+                       auto &VisitNode) -> void {
+    std::size_t J = 0;
+    for (; J < N.Name.size(); J++) {
+      if (!isAlnum(N.Name[J]))
+        continue;
+
+      Get(0, Row) = Row;
+
+      for (std::size_t I = 1; I < Columns; I++) {
+        const int Delete = Get(I - 1, Row) + 1;
+        const int Insert = Get(I, Row - 1) + 1;
+
+        const int Replace =
+            Get(I - 1, Row - 1) + (NormalizedName[I - 1] != N.Name[J] ? 1 : 0);
+
+        Get(I, Row) = std::min(Insert, std::min(Delete, Replace));
+      }
+
+      Row++;
+    }
+
+    unsigned Cost = Get(Columns - 1, Row - 1);
+    if (N.Value != 0xFFFFFFFF) {
+      Insert(N, Cost, N.Value);
+    }
+
+    if (N.hasChildren()) {
+      auto ChildOffset = N.ChildrenOffset;
+      for (;;) {
+        Node C = readNode(ChildOffset, &N);
+        ChildOffset += C.Size;
+        if (!C.isValid())
+          break;
+        VisitNode(C, Row, VisitNode);
+        if (!C.HasSibling)
+          break;
+      }
+    }
+  };
+
+  Node Root = createRoot();
+  VisitNode(Root, 1, VisitNode);
+  return Matches;
+}
+
+} // namespace unicode
+
+} // namespace sys
+} // namespace llvm

diff  --git a/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp b/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
new file mode 100644
index 0000000000000..86e8378eceb1f
--- /dev/null
+++ b/llvm/lib/Support/UnicodeNameToCodepointGenerated.cpp
@@ -0,0 +1,20911 @@
+
+//===------------- Support/UnicodeNameToCodepointGenerated.cpp ------------===//
+// Part of the LLVM Project, under the Apache License v2.0 with LLVM Exceptions.
+// See https://llvm.org/LICENSE.txt for license information.
+// SPDX-License-Identifier: Apache-2.0 WITH LLVM-exception
+//
+//===----------------------------------------------------------------------===//
+//
+// This file implements mapping the name of a unicode code point to its value.
+//
+// This file was generated using ./bin/UnicodeNameMappingGenerator.
+// Do not edit manually.
+//
+//===----------------------------------------------------------------------===//
+
+/*
+UNICODE, INC. LICENSE AGREEMENT - DATA FILES AND SOFTWARE
+
+See Terms of Use <https://www.unicode.org/copyright.html>
+for definitions of Unicode Inc.’s Data Files and Software.
+
+NOTICE TO USER: Carefully read the following legal agreement.
+BY DOWNLOADING, INSTALLING, COPYING OR OTHERWISE USING UNICODE INC.'S
+DATA FILES ("DATA FILES"), AND/OR SOFTWARE ("SOFTWARE"),
+YOU UNEQUIVOCALLY ACCEPT, AND AGREE TO BE BOUND BY, ALL OF THE
+TERMS AND CONDITIONS OF THIS AGREEMENT.
+IF YOU DO NOT AGREE, DO NOT DOWNLOAD, INSTALL, COPY, DISTRIBUTE OR USE
+THE DATA FILES OR SOFTWARE.
+
+COPYRIGHT AND PERMISSION NOTICE
+
+Copyright © 1991-2022 Unicode, Inc. All rights reserved.
+Distributed under the Terms of Use in https://www.unicode.org/copyright.html.
+
+Permission is hereby granted, free of charge, to any person obtaining
+a copy of the Unicode data files and any associated documentation
+(the "Data Files") or Unicode software and any associated documentation
+(the "Software") to deal in the Data Files or Software
+without restriction, including without limitation the rights to use,
+copy, modify, merge, publish, distribute, and/or sell copies of
+the Data Files or Software, and to permit persons to whom the Data Files
+or Software are furnished to do so, provided that either
+(a) this copyright and permission notice appear with all copies
+of the Data Files or Software, or
+(b) this copyright and permission notice appear in associated
+Documentation.
+
+THE DATA FILES AND SOFTWARE ARE PROVIDED "AS IS", WITHOUT WARRANTY OF
+ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE
+WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
+NONINFRINGEMENT OF THIRD PARTY RIGHTS.
+IN NO EVENT SHALL THE COPYRIGHT HOLDER OR HOLDERS INCLUDED IN THIS
+NOTICE BE LIABLE FOR ANY CLAIM, OR ANY SPECIAL INDIRECT OR CONSEQUENTIAL
+DAMAGES, OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE,
+DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER
+TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR
+PERFORMANCE OF THE DATA FILES OR SOFTWARE.
+
+Except as contained in this notice, the name of a copyright holder
+shall not be used in advertising or otherwise to promote the sale,
+use or other dealings in these Data Files or Software without prior
+written authorization of the copyright holder.
+*/
+
+#include "llvm/Support/Compiler.h"
+#include <cstddef>
+#include <cstdint>
+namespace llvm {
+namespace sys {
+namespace unicode {
+extern const char *UnicodeNameToCodepointDict;
+extern const uint8_t *UnicodeNameToCodepointIndex;
+extern const std::size_t UnicodeNameToCodepointIndexSize;
+extern const std::size_t UnicodeNameToCodepointLargestNameSize;
+const char *UnicodeNameToCodepointDict =
+    " _-ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789OWER RIGHT CURLY BRACKET SECTIONM "
+    "LEFT MEMBER OF DOUBLE VERTICALPER BODY TILTING FROM HIP JOINTSFACE WITH "
+    "SYMBOLS COVERING MOUTHVED STEM PARAGRAPH SIGN ORNAMENTVE LESS-THAN ABOVE "
+    "SLANTED EQUAL KORANIC STOP SIGN ISOLATED FORMROFLEX CLICK WITH RETROFLEX "
+    "HOOKSWIRL BIRGA WITH DOUBLE ORNAMENTOWNWARDS HARPOON WITH BARB RIGHT "
+    "HORIZONTAL STROKES TO THE RIGHT LEFTWARDS TRIANGLE-HEADED "
+    "ARROWFT-POINTING ANGLE QUOTATION MARK LOWER HALF INVERSE MEDIUM "
+    "SHADERONT-TILTED SHADOWED WHITE ARROWDIFIER LETTER LABIALIZATION MARKDIC "
+    "KASHMIRI INDEPENDENT SVARITAMARK WITH LEFT RIGHT ARROW ABOVEOUBLE-LINE "
+    "EQUAL ABOVE LESS-THANL ARABIC LETTER TAH AND TWO DOTSLL BUT UPPER LEFT "
+    "QUADRANT BLACKRIGHT SEMICIRCLE WITH THREE DOTSLAR SIGN WITH OVERLAID "
+    "BACKSLASH CONTAINING SMALL WHITE TRIANGLEEN ARM ENDING IN ARROW POINTING "
+    "LAGAB TIMES U OVER LAGAB TIMES ULOWER LEFT CURLY BRACKET "
+    "SECTIONRIGHTWARDS TRIANGLE-HEADED ARROWTRIANGLE-HEADED RIGHTWARDS ARROW "
+    "DOWNWARDS EQUILATERAL ARROWHEAD DOWNWARDS TRIANGLE-HEADED ARROWER ARROWS "
+    "CIRCLING ANTICLOCKWISEER IGI SHIR OVER SHIR UD OVER UDER TAB NI OVER NI "
+    "DISH OVER DISHESS-THAN ABOVE DOUBLE-LINE EQUALETALLED BLACK AND WHITE "
+    "FLORETTEATHARVAVEDIC INDEPENDENT SVARITAAND MIDDLE RIGHT TO LOWER "
+    "CENTREWO DOTS ABOVE AND TWO DOTS BELOWWO DOTS OVER ONE DOT PUNCTUATIONS "
+    "VERTICALLY BELOW AND SMALL TAHTIMES ASH2 KU OVER HI TIMES ASH2AND "
+    "LEFTWARDS OPEN CIRCLE ARROWSTICAL BAR DOUBLE RIGHT TURNSTILENORMAL FACTOR "
+    "SEMIDIRECT PRODUCTD ARROW WITH TRIANGLE ARROWHEADSSEMICIRCULAR "
+    "ANTICLOCKWISE ARROWINTING DOWNWARDS THEN NORTH EASTHT-POINTING ANGLE "
+    "QUOTATION MARKHUR KAZAKH KIRGHIZ ALEF MAKSURA THIRD WHITE RIGHT POINTING "
+    "INDEX SHADOWED WHITE RIGHTWARDS ARROWIDE AND JOINED WITH "
+    "INTERSECTIONUPPER AND LOWER ONE EIGHTH BLOCKIGHTWARDS HARPOON WITH BARB "
+    "DOWNTER-THAN ABOVE DOUBLE-LINE EQUALH SUPERSCRIPT ALEF ISOLATED "
+    "FORMROXIMATELY NOR ACTUALLY EQUAL TOAISING BOTH HANDS IN CELEBRATIONIRECT "
+    "PRODUCT WITH BOTTOM CLOSEDTOP HALF DIVIDED BY VERTICAL BARGREATER-THAN "
+    "ABOVE SLANTED EQUALTOM-LIGHTED RIGHTWARDS ARROWHEADH HAMZA ABOVE WITH "
+    "ALEF MAKSURA H HORIZONTAL MIDDLE BLACK STRIPERONG CENTRALIZATION STROKE "
+    "BELOW TRIANGULAR THREE QUARTERS BLOCK TORTOISE SHELL BRACKET "
+    "ORNAMENTWNWARDS ARROW WITH TIP LEFTWARDSDED HIGH STOP WITH FILLED "
+    "CENTRETION SIGN WITH CIRCUMFLEX ACCENTS AND UPWARDS OPEN CIRCLE "
+    "ARROWSHAND WITH MIDDLE FINGER EXTENDEDOF UPWARDS TRIANGLE-HEADED "
+    "ARROWLEFTWARDS HARPOON WITH BARB DOWNED ARABIC-INDIC DIGIT FOUR "
+    "BELOWEDIUM SHADE AND RIGHT HALF BLOCKLE-LINE EQUAL ABOVE GREATER-THANARDS "
+    "ARROW ABOVE LEFTWARDS ARROW BAR AT END OF HORIZONTAL STROKEEDIUM SHADE "
+    "AND LOWER HALF BLOCKE TO MIDDLE LEFT TO LOWER CENTREED ARABIC-INDIC DIGIT "
+    "FOUR ABOVEED COMMA QUOTATION MARK ORNAMENTE-POINTED BLACK RIGHTWARDS "
+    "ARROWE CONTAINING BLACK SMALL LOZENGEARDROP-SPOKED PROPELLER ASTERISKE "
+    "SQUARED LATIN CAPITAL LETTER PLE COMMA QUOTATION MARK ORNAMENTUG2 OVER "
+    "TUG2 TUG2 OVER TUG2 PAPARDS HARPOON WITH BARB DOWNWARDS-POINTING ANGLE "
+    "BRACKET ORNAMENTRIANGLE-HEADED OPEN CIRCLE ARROW BETWEEN MIDDLE AND RING "
+    "FINGERSED UPWARDS EQUILATERAL ARROWHEAD-SHADOWED WHITE RIGHTWARDS "
+    "ARROWAISED HAND WITH FINGERS SPLAYEDETALLED OUTLINED BLACK "
+    "FLORETTEACK-TILTED SHADOWED WHITE ARROWTNAMESE ALTERNATE READING MARK "
+    "RINGS OVER ONE RING PUNCTUATIONRIGHTWARDS HARPOON WITH BARB UPAND MIDDLE "
+    "LEFT TO LOWER CENTREONE HUNDRED THIRTY-FIVE DEGREES CROSSING ASH OVER ASH "
+    "OVER ASHUPWARDS HARPOON WITH BARB RIGHTRING OVER TWO RINGS "
+    "PUNCTUATIONLEFTWARDS EQUILATERAL ARROWHEADIN WHITE CIRCLE IN BLACK "
+    "SQUAREMAKSURA WITH SUPERSCRIPT ALEF -HIRAGANA PROLONGED SOUND MARKSAD "
+    "WITH LAM WITH ALEF MAKSURADOWNWARDS AND RIGHTWARDS ARROWEFT SEMICIRCLE "
+    "WITH THREE DOTSGHT FOUR POINTED PINWHEEL STARDOT BELOW AND THREE DOTS "
+    "ABOVEAND JOINED BY DASH WITH SUBSETGREATER-THAN ABOVE EQUALS SIGNINDEX "
+    "THUMB CURVE THUMB INSIDEDIVIDED BY HORIZONTAL BAR AND EART EXCLAMATION "
+    "MARK ORNAMENTHT CENTRALIZATION STROKE BELOWON WITH RIGHTWARDS ARROW "
+    "ABOVEMODIFIER LETTER LEFT HALF RINGOPEN CENTRE EIGHT POINTED STARQAF WITH "
+    "LAM WITH ALEF MAKSURAHIGH-REVERSED-9 QUOTATION MARKMINTON RACQUET AND "
+    "SHUTTLECOCKAGGRAVATED INDEPENDENT SVARITAEXTENDED ARABIC-INDIC DIGIT "
+    "TEVERSED LUNATE EPSILON SYMBOLWITH RIGHTWARDS ARROW AT LEFTONAL INDICATOR "
+    "SYMBOL LETTER  OVER RIGHTWARDS ARROW TO BARSUPERSCRIPT ALEF INITIAL "
+    "FORMNS-SERIF INTERROBANG ORNAMENTEFTWARDS HARPOON WITH BARB "
+    "UPSEMICIRCULAR PATH AROUND POLEDOWN MIDDLE THUMB INDEX CROSSDOWN HEAVY "
+    "AND RIGHT UP LIGHTCKED FACE WITH EXPLODING HEAD WITH REVERSED NEGATION "
+    "SLASHLIGHT FOUR POINTED BLACK CUSP DOWN INDEX THUMB HOOK MIDDLEDOT OVER "
+    "TWO DOTS PUNCTUATIONPUNCTUATION CHINOOK FULL STOPUP HEAVY AND RIGHT DOWN "
+    "LIGHTCONTAINING BLACK SMALL CIRCLEACE DIRECTION POSITION NOSE FTING POINT "
+    "RIGHTWARDS ARROWT LITTER IN ITS PLACE SYMBOLOUND-TIPPED RIGHTWARDS "
+    "ARROWISMILLAH AR-RAHMAN AR-RAHEEMDOWN HEAVY AND LEFT UP LIGHTUPWARDS AND "
+    "RIGHTWARDS ARROWRECTANGULAR PATH AROUND POLEEFT ARC GREATER-THAN "
+    "BRACKETMONOGRAMMOS TESSERA DODEKATASALTIRE WITH ROUNDED CORNERSBESIDE AND "
+    "JOINED WITH UNIONMIDDLE RING LITTLE CONJOINEDASTERISKS ALIGNED "
+    "VERTICALLYUP HEAVY AND LEFT DOWN LIGHTUPPER CENTRE TO MIDDLE RIGHTHREE "
+    "HUNDRED FIFTEEN DEGREESLEFTWARDS OF DOWNWARDS ARROWDOUBLE ANUSVARA "
+    "ANTARGOMUKHAHADED WHITE RIGHTWARDS ARROWU ALAYHI WAAALIHEE WA-SALLAMIBE "
+    "SYLLABLE BOUNDARY MARKEREDGE-TAILED RIGHTWARDS ARROWLIQUID MEASURE FIRST "
+    "SUBUNIT-FEATHERED RIGHTWARDS ARROWRIANGULAR ONE QUARTER BLOCKIMPERFECTUM "
+    "CUM PROLATIONE OUR BALLOON-SPOKED ASTERISKEAVY WHITE RIGHTWARDS ARROWIDE "
+    "ARC ANTICLOCKWISE ARROWIDE-HEADED RIGHTWARDS ARROWCIRCLE WITH NORTHWEST "
+    "ARROWBETWEEN TWO HORIZONTAL BARSHEAD MARK WITH MOON AND SUNZERO FOR ODD "
+    "POWERS OF FOURWO DOTS BELOW AND DOT ABOVEHANDED INTERLACED "
+    "PENTAGRAMLESS-THAN ABOVE EQUALS SIGNBRDA RNYING YIG MGO MDUN MABRDA "
+    "RNYING YIG MGO SGAB MARIGHT ARC LESS-THAN BRACKETUPPER MIDDLE LEFT TO "
+    "UPPER CONTINUOUS UNDERLINE SYMBOL AND LEFT SEMICIRCLE ARROWSTALIC LATIN "
+    "CAPITAL LETTER ONE LARGE AND ONE SMALL EYEENTATION FORM FOR VERTICAL "
+    "LARGE EQUILATERAL ARROWHEADEMICIRCULAR CLOCKWISE ARROWFINGER COVERING "
+    "CLOSED LIPSSTRUMENTAL NOTATION SYMBOL-PHARYNGEAL VOICED FRICATIVE BARREE "
+    "WITH TWO DOTS BELOWKATHAKA INDEPENDENT SVARITATWO HUNDRED SEVENTY "
+    "DEGREESDOUBLE PRIME QUOTATION MARKDOUBLE ANGLE QUOTATION MARKRIPLE "
+    "VERTICAL BAR OPERATOR DIVIDED BY HORIZONTAL RULEPPY PERSON RAISING ONE "
+    "HANDWALLPLANE SHOULDER HIP MOVELOWER MIDDLE LEFT TO LOWER FOUR FINGERS "
+    "CONJOINED BENTLOWER TONAL RANGE INDICATORLIGHT CENTRALIZATION "
+    "STROKEYAJURVEDIC MIDLINE SVARITAINDUSTRIAL STANDARD SYMBOLMEEM WITH HAH "
+    "WITH TATWEELDOTTED SUBSTITUTION MARKERCRIPT LIGATURE ET ORNAMENTSSIAN "
+    "ASTROLOGICAL SYMBOL ONOMICAL SYMBOL FOR URANUSOORPLANE SHOULDER HIP "
+    "MOVEHTORA SKLIRON CHROMA VASIS OR APPROXIMATELY EQUAL TOLANTED SOUTH "
+    "ARROW WITH HORIGHT PARENTHESIS ORNAMENTDOTTED LUNATE SIGMA "
+    "SYMBOLDROP-SHADOWED WHITE SQUAREMODIFIER FITZPATRICK TYPE-AND MIDDLE "
+    "FINGERS CROSSEDE ONE-WAY LEFT WAY TRAFFIC GAD OVER GAD GAR OVER GARLINE "
+    "FEED SEPARATOR SYMBOLRIPLE DOT PUNCTUATION MARKLEFTWARDS OF UPWARDS "
+    "ARROWTHREE DOTS ABOVE DOWNWARDSU REVERSED OVER U REVERSEDBLE TENNIS "
+    "PADDLE AND BALLERSTRASS ELLIPTIC FUNCTIONOCKED FEMALE AND MALE SIGN "
+    "WITHIN TRIANGLE ARROWHEADUNEVEN EYES AND WAVY MOUTH LESS THAN THE "
+    "DENOMINATORAND RIGHT ONE EIGHTH BLOCK NEGATED WITH VERTICAL BARJECT "
+    "REPLACEMENT CHARACTERMARRIED PARTNERSHIP SYMBOLIDEOGRAPHIC ITERATION "
+    "MARKOTATED FLORAL HEART BULLETALEF MAKSURA ISOLATED FORMORTHOGONAL "
+    "CROSSHATCH FILLWITH LEFTWARDS ARROW ABOVECLOCKWISE ARROW WITH "
+    "MINUSLLALLAHOU ALAYHE WASSALLAMCAT FACE WITH SMILING EYESOUTLINED "
+    "RIGHTWARDS ARROWINVERTED EXCLAMATION MARKBREVE WITH INVERTED "
+    "BREVEFECTIVENESS OR DISTORTIONOLD ASSYRIAN WORD DIVIDERMBINING "
+    "CRYPTOGRAMMIC DOTLEFT PARENTHESIS ORNAMENTREE-HUNDRED-AND-TWENTIETHSTROKE "
+    "AND TWO DOTS ABOVETERNION INTEGRAL OPERATORRIGHT DIAGONAL HALF BLACKRIPLE "
+    "BIRGA WITH ORNAMENTDOUBLE CANDRABINDU VIRAMAOUBLE BIRGA WITH ORNAMENT "
+    "WITH DOUBLE MIDDLE TILDERANCH BANK IDENTIFICATIONELD HOCKEY STICK AND "
+    "BALL WITH DOUBLE GRAVE ACCENTMULTIPLICATION SIGN BELOWNIVERSAL RECYCLING "
+    "SYMBOLLEFTWARDS ARROW WITH HOOKONE UNDER EIGHTEEN SYMBOLLOW QUILT SQUARE "
+    "ORNAMENTFFICULTY AT THE BEGINNINGBUT NOT ACTUALLY EQUAL TOTTED "
+    "SUBSTITUTION BRACKETTAB OVER TAB GAR OVER GARMEDIUM TRIANGLE ARROWHEAD "
+    "OVER NUN LAGAR TIMES SALRIST CIRCLE HITTING WALL  WITH DOUBLE VERTICAL "
+    "BARCROSSING NORTH EAST ARROW WITH CIRCLED ONE OVERLAYCAT FACE WITH CLOSED "
+    "EYESDIAERESIS AND HOOK SYMBOLDRY MEASURE FIRST SUBUNITING ON THE FLOOR "
+    "LAUGHINGAND MALE AND FEMALE SIGNVOICED LARYNGEAL SPIRANTTEARDROP-SPOKED "
+    "ASTERISKTED INTERPOLATION MARKERUPRIGHT RECTANGULAR ZERORIGHTWARDS THEN "
+    "CURVING BLACK LENTICULAR BRACKETIGATURE OPEN ET ORNAMENTARROW POINTING "
+    "DIRECTLY BLIC ADDRESS LOUDSPEAKERCULINE ORDINAL INDICATORING FACE WITH "
+    "OPEN MOUTHMTAVRULI CAPITAL LETTER ARM CIRCLE HITTING WALL WELVE POINTED "
+    "BLACK STARLARGE TRIANGLE ARROWHEADLINE HORIZONTAL ELLIPSISORIZONTAL BAR "
+    "WITH NOTCHWITH UPWARDS ARROW ABOVEONE-HUNDRED-AND-SIXTIETHBUSINESS SUIT "
+    "LEVITATINGPERSCRIPT ALEF MOKHASSASCONSECUTIVE EQUALS SIGNSDESCENDING "
+    "MUSICAL NOTESGLOTTAL STOP WITH STROKEEYES AND HAND OVER MOUTHLICATION "
+    "PROGRAM COMMANDFINGER AND THUMB CROSSEDGREATER-THAN OR EQUAL TOISOSCELES "
+    "RIGHT TRIANGLEWITH CANCELLATION STROKEOTTOM SHADED WHITE "
+    "ARROWOTTOM-SHADED WHITE ARROWDIAGONAL CROSSHATCH FILLUPWARD POINTING "
+    "TRIANGLESINGLE-LINE NOT EQUAL TOSYLLABLE REPETITION MARKT BLACK "
+    "RIGHTWARDS ARROWMALL CIRCLE TO THE RIGHTSMALL ARABIC LETTER TAH DOUBLE "
+    "HORIZONTAL STROKE POINTING BACKHAND INDEXEQUAL TO OR "
+    "GREATER-THANINTERSECTION WITH SERIFSHEAVY BLACK HEART BULLETBERKANAN "
+    "BEORC BJARKAN BCOMPATIBILITY IDEOGRAPH-LEFT DIAGONAL HALF BLACKWO DOTS "
+    "VERTICALLY ABOVEDOWNSCALING FACTOR KIIZH OVER TOP SQUARE "
+    "BRACKETLY-RECYCLED PAPER SYMBOLE PLUS A PLUS SU PLUS NASTROKE THROUGH "
+    "DESCENDERPOINTING DOWNWARDS ABOVESHAPE WITH A DOT INSIDEIVE FINGERS "
+    "SPREAD OPENALGAMATION OR COPRODUCTCIRCUMFLEX ACCENT ABOVEININE ORDINAL "
+    "INDICATORLSCHREIBER PAUSE SYMBOLUPWARDS THEN NORTH WESTLEFT-SHADED WHITE "
+    "ARROWCLUSTER-INITIAL LETTER ALEF MAKSURA FINAL FORMMITIAN CONJUGATE "
+    "MATRIXISTED RIGHTWARDS ARROWSSING DIAGONAL CROSSING YELORUSSIAN-UKRAINIAN "
+    "ISOLIDUS BINARY RELATION WITH HALF-CIRCLE BELOWRIGHT HORIZONTAL SECANTUP "
+    "SPREAD THUMB FORWARDORIGINAL OF OR EQUAL TOPUNCTUATION END OF "
+    "TEXTVERTICAL BISECTING LINERIGHT DIAGONAL ELLIPSISORAH WITH NINE BRANCHES "
+    "POINTING AT THE VIEWERREE VARIATION SELECTOR WO-WAY LEFT WAY TRAFFICWHITE "
+    "FOUR POINTED CUSPHANKED RIGHTWARDS ARROWWESTERN PWO KAREN TONE-ESS "
+    "OUTLINED WHITE STARP WITH EXCLAMATION MARK HUNDRED TWENTY-EIGHTH BARBED "
+    "RIGHTWARDS ARROWRTOISE SHELL BRACKETED OMBINING ANUSVARA ABOVEATTACHING "
+    "VERTICAL OMETDOT BELOW AND DOT ABOVEAVOURING DELICIOUS FOODRAISED "
+    "OMISSION BRACKETPA OVER PA GAR OVER GARGREEK SMALL LETTER IOTAASCENDING "
+    "MUSICAL NOTESIDE ARC CLOCKWISE ARROWAND WOMAN HOLDING HANDSRIGHT-POINTING "
+    "TRIANGLEOVER RIGHTWARDS HARPOON CAKE WITH SWIRL DESIGNZANTINE MUSICAL "
+    "SYMBOL IGHT-SHADED WHITE ARROWHT TRIFOLIATE SNOWFLAKEOVERLAPPING LOGICAL "
+    "ANDHREE POINTED BLACK STARARTY HORN AND PARTY HATCURRENT SYMBOL FORM TWO "
+    "ROTATED NINETY DEGREESUBLE VERTICAL BAR BELOWDOWNWARDS THEN CURVING "
+    "ARABIC LETTER TAH ABOVEANG DEPARTING TONE MARK WITH DECORATIVE COVEROVER "
+    "NU11 BUR OVER BUROVER LEFTWARDS HARPOONUIGHUR KIRGHIZ YEH "
+    "WITSYMPTOTICALLY EQUAL TOOVER SHIR BUR OVER BURCONSONANT MODIFIER "
+    "BARDOMAIN ANTIRESTRICTIONND RECORDING COPYRIGHTTRIPLE VERTICAL "
+    "STROKEUPPER RIGHT AND LOWER DOUBLE SOLIDUS OVERLAYLATIN CAPITAL LETTER "
+    "SLONG HORIZONTAL STROKERIGHT-POINTING FLEURONQUESTION MARK ORNAMENT WITH "
+    "THREE DOTS ABOVEUBSCRIPT SMALL LETTER LOW PARAPHRASE BRACKET WITH SINGLE "
+    "ZAPYATAYAPUNCTUATION KUNDDALIYAUPPER ONE EIGHTH BLOCKARMENIAN ETERNITY "
+    "SIGNDOUBLE VERTICAL STROKEPRECEDED BY APOSTROPHEPOINTING UPWARDS "
+    "BELOWKEEPING STILL MOUNTAINTWO HORIZONTAL STROKESPERSET OF NOR EQUAL "
+    "TODOUBLE-LINED HEAD MARKMNYAM YIG GI MGO RGYANEAST-POINTING AIRPLANEIGEL "
+    "LONG-BRANCH-SOL SDOWNWARDS ZIGZAG ARROWACKSLANTED SOUTH ARROWRECTILINEAR "
+    "BLACK STARI YFESIS TETARTIMORIONREE-CIRCLE ALTERNATE IDOWN-POINTING "
+    "TRIANGLEHEXIFORM LONG ANUSVARANOT INCLUDING THE POLESHORT VERTICAL "
+    "STROKES SYMBOL FOR LIGHTHOUSEUSTOMER ACCOUNT NUMBERIN DEPARTING TONE "
+    "MARKDRESSED TO THE SUBJECTSHORT RIGHTWARDS ARROWLEFT TRIANGLE "
+    "OPERATORALEF WITH LAM WITH YEH RIGHT ARROWHEAD ABOVEING HEAD IN "
+    "SILHOUETTEHORT HORIZONTAL STROKEINDIRECT QUESTION MARKSEMI-VOICED SOUND "
+    "MARKCURLY BRACKET ORNAMENTCJK UNIFIED IDEOGRAPH-TRIPLE RIGHT "
+    "TURNSTILEYIAKENG PUACHUE HMONG  WITH CIRCUMFLEX ABOVEWITH HORIZONTAL "
+    "STROKECONSONANT SIGN MEDIAL ROUND A POINT OPERATORWITH JEEM INITIAL "
+    "FORMWASALLAM ISOLATED FORM-ROTATED DIVISION SIGNRROW WITH ROUNDED "
+    "HEADGREATER-THAN DIAERESISWITH VOICED SOUND MARKLE BESIDE VERTICAL "
+    "BARINVERTED SMALL V BELOWINVERTED SMALL V ABOVE OVER STAMPED ENVELOPEBAR "
+    "ABOVE INTERSECTIONREASE FONT SIZE SYMBOLARD SHELL FLOPPY DISKDOWNWARDS "
+    "ARROW ABOVEACUTE AND HOOK SYMBOLEFT-POINTING TRIANGLE-SHAPED BAG "
+    "DELIMITEREFT OPEN BOX OPERATORDOWN HORIZONTAL LIGHTEFT HORIZONTAL "
+    "SECANTDOWN HORIZONTAL HEAVYYIG MGO TSHEG SHAD MA-ROUND NOTEHEAD DOWN "
+    "ABOVE SHORT DOWN TACKAKIA TELOUS ICHIMATOSINVERTED GLOTTAL STOPINVERTED "
+    "BRIDGE BELOWDELIMITER TSHEG BSTARHALF TRIANGULAR COLONHAND INTERIOR "
+    "PRODUCTWO-CIRCLE ALTERNATE IWO-CIRCLE NUKTA ABOVEINTERSECTION "
+    "OPERATORINTERSECTING LOGICAL TILDE OPERATOR ABOVE GRUENT WITH DOT "
+    "ABOVEHOCKEY STICK AND PUCKHORIZONTAL TABULATIONHOUSAND MILLIONS SIGNTHICK "
+    "LETTER SELECTORCTOR OR CROSS PRODUCTCRUCIFORM NUMBER FOURTEEN POINTED "
+    "ASTERISKCROSSE STICK AND BALLXTRA SHORT VOWEL MARKFINAL CONSONANT SIGN "
+    "EIGHT SPOKED ASTERISKELATIONAL COMPOSITIONVOICED ITERATION MARKDOUBLE "
+    "LEFT TURNSTILEEQUAL TO OR LESS-THANER RIGHT CORNER ANGLEALLING DIAGONAL "
+    "SLASHLATTENED OPEN A ABOVEFLATTENED PARENTHESISDIGRAMMOS EX "
+    "DODEKATATRIANGULAR HALF BLOCKWITH INVERTED V ABOVEGHT OPEN BOX "
+    "OPERATORTOUCHING INSIDE MOUTHGRAMMOS OKTO DODEKATAARKENING OF THE "
+    "LIGHTVERY HEAVY BARB ARROW WITH VERTICAL STROKE AND SLANTED PARALLELSH "
+    "AMPERSAND ORNAMENT WITH SHORT RIGHT LEGAND VOWEL LENGTH MARKPAP PLUS PAP "
+    "PLUS LU3RATING SYSTEM COMMANDVERTICAL LINE OVERLAYBOTTOM U-SHAPED ARROWND "
+    "TELEPHONE RECEIVERRISING DIAGONAL SLASHMORPHOLOGICAL DIVIDERSHORT "
+    "LEFTWARDS ARROWMIDDLE RING LITTLE ONSIDE TO SIDE SCISSORSMALE WITH STROKE "
+    "SIGNBUT NOT EQUIVALENT TOARYSTIAN FIVE HUNDREDQUADRANT CIRCULAR ARCRELICT "
+    "HOUSE BUILDINGREVERSED FEATHER MARKLETTER SMALL CAPITAL OP SHADED WHITE "
+    "ARROWOCAL NOTATION SYMBOL-OPPOSING AN PLUS NAGABESIDE RIGHT "
+    "TRIANGLENTISTRY SYMBOL LIGHT OHAMMAD ISOLATED FORMLESS-THAN OR EQUAL "
+    "TOWITH SOROCHYA NOZHKAHAR2 TIMES GAL PLUS RUMAI PALAUNG TONE-5HALF CIRCLE "
+    "WITH DOTPLUS GISH TIMES TAK4VAL WITH OVAL INSIDEINSIDE MOUTH RELAXEDINING "
+    "OBLIQUE STROKEDOUBLE ANGLE BRACKETCRESCENT MOON SYMBOLGRA GCAN -CHAR "
+    "RTAGSENARMONIOS ANTIFONIAA- SHOG GI MGO RGYAN OVER TUR ZA OVER "
+    "ZAUBHAANAHU WA TAAALAAONE MARK SGAW KAREN INVERSE WHITE CIRCLEINVERTED "
+    "CANDRABINDU OVER LAGAR GUNU SHEAND NORTH EAST ARROWWET CULTIVATION "
+    "SIGNSIDEWAYS NOON GHUNNAONCAVE-SIDED DIAMONDBSET OF NOR EQUAL TODOUBLE "
+    "DOT TONE MARKPOTABLE WATER SYMBOLSINGLE DOT TONE MARKIRCLES HITTING WALL "
+    "HREE-DOT NUKTA ABOVEFOUR RAISED KNUCKLESBETWEEN PALM FACINGSANGE "
+    "ANTIRESTRICTIONCURRENCY SYMBOL RIELTRANSPOSITION MARKERSEPARATOR MIDDLE "
+    "DOTSEPARATOR KEY SYMBOLFORMS LIGHT VERTICALOVER LEFTWARDS ARROWTHROUGH "
+    "SMALL CIRCLENIS RACQUET AND BALLWITH FOUR DOTS ABOVESCRIPTION CHARACTER "
+    "CURVED ANGLE BRACKETHORIZONTAL BAR WITH OTLESS J WITH STROKEFINAL "
+    "CONSONANT MARKMULTIPLE PUNCTUATIONINDEX RING LITTLE ONUP-POINTING "
+    "TRIANGLEAND NORTH WEST ARROWDOTLESS HEAD OF KHAHIMAGE OF OR EQUAL "
+    "TOGHTWARDS ARROW BELOWEVERSED ROTATED RANAAND SOUTH EAST ARROWAND SOUTH "
+    "WEST ARROWFIVE SPOKED ASTERISK79 OVER LAK-079 GUNULEFT-TO-RIGHT "
+    "SECANTHIGH RATHA OR LOW PAWORD REPETITION MARKHIGH TONE APOSTROPHEE "
+    "CONSONANT MODIFIERCONSONANT SIGN HAARULEFT AND LOWER RIGHTCENTRE VERTICAL "
+    "LINERIGHT QUADRANT BLACKRIGHT-POINTING ANGLEJUDEO-SPANISH VARIKAKHAMTI "
+    "REDUPLICATIONARXIS KAI FTHORA VOUREAN STANDARD SYMBOLYRENAIC TWO "
+    "DRACHMASLATALIZED HOOK BELOWRIGHT U-SHAPED ARROWLE WITH POPPING "
+    "CORKWARE-FUNCTION SYMBOLLASHING SWEAT SYMBOL WITH HORIZONTAL BARL "
+    "FUNCTIONAL SYMBOL CHEMICAL SYMBOL FOR  AND DIAGONAL STROKESTAR WITH "
+    "MIDDLE DOTCHARACTER INTRODUCERDOWN ARROWHEAD BELOWEMESTVENNY ZADERZHKA "
+    "BEGIN LOGOGRAM MARKREVERSED ONE HUNDREDRIGHT ANGLE WITH DOTYIG MGO PHUR "
+    "SHAD MA ABOVE LEFT TRIANGLEOW-9 QUOTATION MARK WITH STRIKETHROUGHGIBBOUS "
+    "MOON SYMBOLTHANG LONG ANUSVARALEADING MCHAN RTAGSVARIATION INDICATORSEVEN "
+    "EIGHTHS BLOCKNETWORKED COMPUTERSKULL AND CROSSBONESLANTED EQUAL ABOVE "
+    "VASTNESS OR WASTINGAHU ALAYHI WA-AALIHNE HUNDRED TWENTY PNDRED POINTS "
+    "SYMBOLRROW NO-BREAK SPACEIGATURE AYIN-DALETHSH PLUS HU PLUS ASHFLOORPLANE "
+    "TWISTINGRATUM SUPER STRATUMOTATED ARDHAVISARGAWOMEN HOLDING HANDSBETWEEN "
+    "MIDDLE RING WITH VERTICAL TAILDOWN POINTING INDEXTIGHTLY-CLOSED "
+    "EYESALTERNATE LAKH MARKD CIRCUMFLEX ACCENTVARIANT WITH SQUARENOGRAPHIC "
+    "FULL STOPGAPPED CIRCLE ARROWUP HORIZONTAL LIGHTLF MADDA OVER "
+    "MADDAREE-QUARTER CIRCLE NORTH ARROW WITH HOANSPOSITION BRACKETSEQUENCE "
+    "INTRODUCERARENTHESIS NOTEHEADHORT STROKE OVERLAYVERTICAL TABULATIONOVER E "
+    "NUN OVER NUNTRANNO MALO POVYSHEUP HORIZONTAL HEAVY AND "
+    "PROSGEGRAMMENIVARIANT FORM ILIMMUFT-POINTING FLEURON LOVE YOU HAND "
+    "SIGNHURISAZ THURS THORN AND RETROFLEX HOOKARTIAL DIFFERENTIALLEFT "
+    "POINTING INDEXTO LOWER RIGHT FILLQUESTION MARK ABOVECIRCLED SANS-SERIF "
+    "HAND COVERING MOUTHWITH YEH FINAL FORMET WITH WHITE CROSSLEFT TO LOWER "
+    "RIGHTATED TELLER MACHINERIGHT TO LOWER LEFTINSIDE CIRCLE BELOWCIRCLED "
+    "WHITE ARROWRY CULTIVATION SIGNURRENCY SYMBOL BAHTITED LIABILITY SIGNVERSE "
+    "FINAL BARLINEUBLE DOT WITHIN DOTVERSAL INTERSECTIONISPUTED END OF AYAHOP "
+    "SEMICIRCLE ARROWDENOMINATOR SIXTEENLEFT U-SHAPED ARROWQUADRUPLE "
+    "CRESCENTSA END LOGOGRAM MARKSYMBOL FOR BEGINNERPREFIXED NASAL SIGN "
+    "FLUTTERING IN WINDC DIGRAPH WITH CURLSTRAIGHT THUMB BENTRIGHT MIDDLE "
+    "STROKETWENTY-FIVE DEGREESSTRATIAN FIFTY MNASIN CHEN SPUNGS SHADTURNED "
+    "SECTION MARKTURNED PADA PISELEH KASKAL U GUNU DISHEVEN POWERS OF FOURDOWN "
+    "AND HORIZONTALIMIDIA SEXTULA SIGNPARAGRAPH SEPARATORARABIC FORM "
+    "SHAPINGILDING CONSTRUCTIONHEAD-SHAPED POINTERNAXIAN FIVE HUNDREDFIVE "
+    "FINGERS SPREAD IN A RECTANGLE BOXLUB-SPOKED ASTERISKMSHELL MOBILE "
+    "PHONETART OF RUB EL HIZBANS-SERIF CAPITAL LING SHIRT WITH SASHSLANTED "
+    "NORTH ARROWMOVES AGAINST CHEEKRAILING MCHAN RTAGSWEST POINTING LEAF OVER "
+    "INVERTED SHUGGLY VERTICAL LINEUM WITH DRUMSTICKSWITH STROKE SYMBOLTO "
+    "LOWER LEFT FILLBAARAKA WA-TAAALAATOP U-SHAPED ARROWGISH CROSSING "
+    "GISHASTROLOGICAL SIGN PERFIXED LETTER RAATIN SMALL LETTER RIST CIRCLE "
+    "FRONT EVERSED CHELYUSTKAABBREVIATION MARK EVENTEEN FULL STOPATERRESTRIAL "
+    "ALIENTYPE A ELECTRONICSARROW SHAFT WIDTH WHITE VERTICAL BAR FOR "
+    "SIMALUNGUN SAU-SHAPED ORNAMENTSQUARTER NOTE STEM ERTICAL BAR "
+    "VIRAMAEPIGRAPHIC LETTER DOUBLE PUNCTUATIONPUNCTUATION BINDU ENTY-TWO "
+    "POINT TWOENTERING TONE MARKASTED SWEET POTATOVARIANT FORM LIMMUGATIVE "
+    "ACKNOWLEDGEWITH JUSTIFICATIONDOWN-OUTPUT SYMBOLOTLESS DALATH RISH NOT "
+    "LITTER SYMBOLOU ALAYHE WASALLAMOUCHTONE TELEPHONE AND NO DOTS ABOVEORK ON "
+    "THE DECAYEDEAST POINTING LEAFTROFLEX HOOK BELOW AND SMASH PRODUCTOW TONE "
+    "APOSTROPHEFORTY-FIVE DEGREESFORKED PARAGRAPHOSVERY SMALL DIAMOND AND "
+    "YPOGEGRAMMENIFIVE EIGHTHS BLOCKPACING CANDRABINDU WITH KAVYKA "
+    "ABOVEIGATURE ZAYIN-YODHJEEM ISOLATED FORMYLLABLE LENGTHENER WITH FLOWING "
+    "SANDSET OVER BUILDINGSKANTAJA NAASIKYAYACUP WITHOUT HANDLEKBAR ISOLATED "
+    "FORMSEPTUPLE CRESCENTSHUNDREDS UNIT MARKNINETEEN FULL STOPCTLY EQUIVALENT "
+    "TOUPPER MIDDLE RIGHTHOUSANDS SEPARATORNISH VERSE DIVIDERNITE PART "
+    "INTEGRALHORIZONTALLY BELOWSMALL CIRCLE ABOVEKOREAN CHARACTER ONORMAL "
+    "SUBGROUP OFCANTILLATION SIGN HOLDING BACK TEARSLOWER MIDDLE RIGHTCOPPER "
+    "ANTIMONIATEAND LOW RIGHT RING THUMB INDEX THUMBCONTINUING "
+    "OVERLAPMATHEMATICAL SPACESINGLE PUNCTUATIONINDEPENDENT VOWEL IN "
+    "POSSESSION SIGN WITH CIRCLE ABOVEITAN SMALL SCRIPT  WITH CIRCLE BELOW "
+    "WITH CROSSED-TAILSHAN REDUPLICATIONBOTTOM RIGHT KASRAIGSAW PUZZLE PIECEIX "
+    "SPOKED ASTERISKSYMMETRIC SWAPPING SPREAD THUMB SIDEUP ARROWHEAD "
+    "BELOWTILTING FROM WAISTYPTIAN HIEROGLYPH NYOOGA NAAKSIKYAYABASELINE ROUND "
+    "DOTHAIS LUS NTOG NTOGS PRESSED TOGETHERNYET THYOOM TA-ROLHILOSOPHERS "
+    "SULFURSMALL RED TRIANGLERYUKOVAYA SVETLAYALEFT MIDDLE STROKEUTLINED BLACK "
+    "STARLOSED CIRCLE ARROWLEFT-STEM TONE BARS INSIDE AND ABOVESOUL ISOLATED "
+    "FORMVOCALIZATION MARK WITH BULLET NOSEA PLUS HA PLUS DAPUNCTUATION SIGN "
+    "ALTERNATE NUMBER BUT RELIEVED FACECONSONANT SIGN PA-GAAHLAA TTUDDAAGAMBDA "
+    "WITH STROKEAPLI DYO DODEKATALAGOLITIC LETTER WHITE PARENTHESISDELPHIC "
+    "FIVE MNASINVERTED MCHU CANYEH ISOLATED FORMCONTOURED OUTLINESIGN O WITH "
+    "CROSSPRECEDING SOLIDUS ALTERNATION MARKASTERN PWO KAREN MEEM INITIAL "
+    "FORMPRESSIONLESS FACEPRIZNAK MODIFIER MEDIUM BARB ARROWCIRCLES WITH "
+    "DOTSCONTINUATION SIGNWHITE SHOGI PIECERIATION SELECTOR-CANDRABINDU "
+    "ABOVEEAR SCREEN SYMBOL WITH TILDE ABOVEABBREVIATION SIGNKE BOTTLE AND "
+    "CUPKHAH INITIAL FORMLAPPING LESS-THANSTRAIGHT MOVEMENT AND PALATAL "
+    "HOOKREATIONAL VEHICLEAMPHYLIAN DIGAMMARIGHT HALF CIRCLEVERY SMALL "
+    "SQUARECLOSED LITTLE YUSCOMBINING NUMBER LAH ISOLATED FORM WITH SOUND "
+    "WAVESULAR MEDIUM SHADESQUARED TIMES KURLHOUETTE OF JAPANMANENT PAPER "
+    "SIGNEMICOLON UNDERBARMALL WHITE CIRCLELIAN HIEROGLYPH ALD PERMIC LETTER "
+    "URNED DAMMA BELOWURNED COMMA ABOVEQUAT REVERSED ESHCAL SYMBOL BOTTOMAEUM "
+    "ONE PLETHRON0 WHEELED CHARIOTCANCELLATION MARKTRIPLE DASH ARROWHIRTEEN "
+    "FULL STOPVARIANT FORM IMINVRE TOURNOIS SIGNTHREE SOUND WAVESUP POINTING "
+    "INDEXVARIANT FORM USSUHORIZONTAL DOUBLEHORIZONTAL SINGLEGENERIC "
+    "MATERIALSOURTEEN FULL STOPNG STROKE OVERLAYNFORMATION SOURCEFROM SMALL "
+    "CIRCLEFRACTION ONE HALFBOTTOM HALF BLACKIASTRE MARK ABOVESERVER EYE "
+    "SYMBOLICTED LEFT ENTRY-NEGATIVE CIRCLED IDEOGRAPHIC COMMA OVER ZU PLUS "
+    "SARHAH ISOLATED FORMUP AND HORIZONTALRYBLION BASE SIGNVARIANT FORM "
+    "ASH9TONAL RANGE MARK ONE EIGHTH BLOCK-DENTAL PERCUSSIVEBE WITH "
+    "MERIDIANSGREATER-THAN SIGNGREATER-THAN NOR BRIGHTNESS SYMBOLBERBER "
+    "ACADEMY YAS REVOLVING LIGHTHEART-SHAPED EYES PLUS SHA3 PLUS AOPEN-HEADED "
+    "ARROWWO VERTICAL DOTS WITH NOT EQUAL TOTIAL ARTS UNIFORMING POLE AND "
+    "FISHFACING BABY CHICKVEE WITH UNDERBARY ON BLACK SQUAREAUKAZ LAGU LOGR "
+    "LATHERING TOGETHERINEAR ANNOTATION TARTING FROM SIGNNE EYEBROW "
+    "RAISEDPINWHEEL ASTERISKINITIAL LETTER RAMILITARY AIRPLANEVERAGE WITH "
+    "SLASHTAN ISOLATED FORM GRAVEYARD SYMBOL TO BLACK DIAMONDAND BLACK "
+    "SQUARESOWER NUMERAL SIGNIGHTEEN FULL STOP LAGAB TIMES ASH2NASALIZATION "
+    "MARKFINGER-POST ARROW LAGAR OVER LAGARTERSYLLABIC TSHEGNAUDIZ NYD NAUD "
+    "NTEN THOUSAND SIGNBRACKET EXTENSIONFLICK ALTERNATINGCTION "
+    "APPLICATIONCROSS PUNCTUATIONVARIANT FORM ESHCH WITH UMBRELLAARENTHESES "
+    "ABOVEDOUBLE TURNSTILEDITORIAL CORONISVERY HEAVY SHAFTDOUBLE DOT "
+    "ABOVECONSONANT JOINERVIEWING CEREMONYBOTTOM HALF RINGCORNER "
+    "DOWNWARDSDOUBLE CRESCENTSAFFRICATION MARKUPERSCRIPT ALAPHUP-OUTPUT "
+    "SYMBOLCOMPRESSED ARROWANABAZAR SQUARE UPPER OVER LOWERVOWEL LENGTHENERUP "
+    "MIDDLE HINGEDDOWN RIGHT BARB BOLD GREEK CROSSDEWAYS U BRACKETDOUBLE "
+    "ZAPYATAYAB2 TENU PLUS TABDOTTED CRESCENTSCASIAN ALBANIAN DOUBLE HEAD "
+    "MARKCREAMING IN FEARCORNER LEFTWARDSIFTEEN FULL STOP LIGHT MOON "
+    "ARTASERIFS AT BOTTOMNION WITH SERIFSHYPHENATION MARKSMALL NOON ABOVEIDED "
+    "GREEK CROSSORIZONTAL JOINERIGHTH NOTE STEM IMENSIONAL ANGLEINDEPENDENT "
+    "SHININDEX THUMB SIDEHIGH SPACING DOTMAGNIFYING GLASSRISING TONE MARK "
+    "SMALL ROTATIONS INSERTION POINTRIZONTAL ELLIPSEINES CONVERGING HMATULLAH "
+    "ALAYHESLANTED EQUAL TOSMALL CAPITAL ELHOLDING TOGETHERPEN CENTRE "
+    "CROSSLTERNATE HASANTALOWER OVER UPPERSTUCK-OUT TONGUESTRING "
+    "FRETBOARDSTRAIGHT STRETCHSTICKING OUT FARSTERISK OPERATOR PLUS KAK PLUS "
+    "AADIAN SYLLABICS K PERMITTED HEREO-MINOAN SIGN CMLD ASSYRIAN ONE LEFT "
+    "HALF CIRCLELEFT ARROW ABOVENTAIGANA LETTER SANS-SERIF ARROW OR THE IMAGE "
+    "OFYATHOS BASE SIGNLLOW PAN OF FOODTAKANA-HIRAGANA IPPER-MOUTH FACEIRCLE X "
+    "NOTEHEADLIGHT BARB ARROWLIGHT AND RIGHT ISTOS DISC SIGN OLD WHITE "
+    "CIRCLEIVE POINTED STAROLD TAMIL VIRAMAYIR MKPARAQ MEUNEPSILON "
+    "UNDERBARUDLY CRYING FACEEN MILLIONS SIGNRIGHT DOWN BARB END OF TEXT "
+    "MARKUBJOINED LETTER ENTRE WHITE STARENUMERATION SIGNERCURY SUBLIMATERAYS "
+    "AND DOTTED RIGHT HALF BELOWRIGHT HALF BLACKMIDDLE AND RIGHTMIDDLE AND "
+    "BELOWRAIDO RAD REID R TIMES GAN2 TENUUMBER SIGN ABOVEDVUMYA ZAPYATYMI "
+    "TIMES DISH TENUSHU2 PLUS KASKALRESH-AYIN-DALETHREPETITION MARK-WAVY HAMZA "
+    "BELOWE PLUS GAN2 TENUPLE MEASURE REST AND HEAVY RIGHTULDERED OPEN "
+    "BOXECIMAL SEPARATOR AND LIGHT RIGHTEFORE COMPLETIONRECORD SEPARATORWITH "
+    "HEARING AIDWITH CENTRED DOTSIGN RISING TONE WITH BUNNY EARSWITH LEFT "
+    "UPTURNPRECEDING SUBSETQUALS SIGN BELOWWITH HAMZA ABOVEQ WITH HOOK "
+    "TAILTRIPLE CRESCENTSSITION INDICATORPRECHGESANG STEMNAL DIGIT "
+    "SHAPESEVERSED VISARGA EVERY OTHER TIMEMESTVENNY KLYUCHPLACEHOLDER MARKR "
+    "PLUS GAN2 TENUFALLING DIAGONAL WITH DOT INSIDEPOSTPOSITION MENFFERENCE "
+    "BETWEEN CAPPED MOUNTAINFLOORPLANE SPACEND OF PARAGRAPHMURDA "
+    "MAHAPRANABINDING BRACKETNASALIZED TONE-N-ARY SUMMATIONUSTER NOTEHEAD "
+    "BLOCK DIAGONAL NOON WITH KASRANOON FINAL FORMNO GOOD GESTURENJOINING "
+    "MACRONNA DOUBLE HELIXRIGHT RERENGGANATINATE MYSLITEPERTHO PEORTH PPLUS "
+    "SIGN BELOWATA LINK ESCAPEPRISHTHAMATRA EPUT SYMBOL FOR RIGHTWARDS "
+    "TICKRIGHTWARDS AND QUADRUPLE ARROWQUADRUPLE DASH R WITH FISHHOOKPENSION "
+    "RAILWAYRIGHT HALF RINGVERTICAL SECANTREAMY EYEBROWS RECEPTIVE "
+    "EARTHRECITATIVE MARKREVERSE SOLIDUSREVERSED OPEN EGHT REPEAT SIGNON TOP "
+    "OF MODEMNVERTED UBADAMASALTER PAHLAVI BENT OVER INDEXBELOW LONG "
+    "DASHBELGTHOR SYMBOLODO SOFT HYPHENS IN SILHOUETTES ELEVATUS MARKOGOGRAM "
+    "KHAMTI BAR ABOVE UNIONOLIDUS OPERATORNOT APPROXIMATEOND PLACE "
+    "MEDALONJOINED HINGEDONTOUR INTEGRALORIZONTAL COLONORT EQUALS SIGNOUBLE "
+    "BACKSLASHOW-FALLING TONEOWER HALF BLACKRNAMENT STROKE-RMAN PENNY SIGNPEN "
+    "SQUARED DOTTOP RIGHT FATHADOING CARTWHEELFOUR DOTS WITH FOUR "
+    "ENCLOSURESFRACTION DIGIT FTER COMPLETIONDIGA AELA-PILLADIALYTIKA "
+    "TONOSTRIANGULAR MARKDI ALLAHOU ANHUGEMINATION MARKGGLY LINE "
+    "BELOWDESCENDING TONEFORWARD TILTINGGROUP SEPARATORHAKING PARALLELHALF "
+    "FILL SPACETIP ON THE LEFTHEH MEDIAL FORMTILDE DIAERESISTHROWING A "
+    "KISSDAGESH OR MAPIQHOOKED INDEX UPTHREE DISH TENUHORIZONTAL "
+    "DASHHORIZONTAL FILLEH INITIAL FORMDOWNWARDS TRENDUMAI PALAUNG FAE "
+    "ISOLATED FORME MUSICAL NOTESE OVER INFINITYDOWN SEQUENTIALULTIPLICATION "
+    "XUGMENTATION DOTEFT REPEAT SIGNEFTWARDS ARROWSDOUBLE TRIANGLEUBLE RING "
+    "BELOWERICAN FOOTBALLESIDE LESS-THANU PLUS U PLUS UESSARON CHRONONETIC "
+    "VERSE SIGNTWO WITH STROKEEXPONENT SYMBOLTVIMADUR SYMBOLLONG VOWEL SIGNLD "
+    "TAMIL SHORT LEFT DOWN BARB LEFT HALF BELOWLEFT HALF BLACKCIRCUIT-OUTPUT "
+    "LEFT HAND INDEXLETTER CAPITAL LEVEL TONE MARKLEVEN FULL STOPLIGHT AND "
+    "LEFT LMOST EQUAL TO UR POINTED STARLONG HOOK BELOWCKET CALCULATORLOOK OF "
+    "TRIUMPHLOSED INSULAR GCAPITAL LETTERSSIXTEENTH NOTESMALAKON CHROMA "
+    "MARRYING MAIDENMEEM FINAL FORMBROWS STRAIGHT BREAKING HYPHENMIDDLE "
+    "DIAGONALSHORT OVER LONGINVERTED STROKEHOUSAND STATERSHREE DOTS "
+    "BELOWIAMOND UNDERBARIDING ENCLOSUREIGN PALI VIRAMAIMISEOS "
+    "CHRONOUIMPERFECTA RESTING SYMBOL FOR CORNER WITH DOTINGLE HEAD MARKINUS "
+    "SIGN BELOWINVERTED LAZY SSHITA PLUS GISHIRCUMFLEX BELOWTAI LAING TONE-ITH "
+    "FINGERNAILSIZED WHEELCHAIRSTROKE NOT SIGNKISIM5 TIMES BISTERESIS SYMBOLST "
+    "SYRIAC CROSSST QUARTER MOONSSICAL BUILDINGCLOSED BY CURVELATION "
+    "FUNCTIONXTEEN FULL STOPAMARITAN SOURCE WITH DESCENDER CORNER "
+    "BRACKET-CARRIER LETTERZAIN FINAL FORM OVER SIG4 SHU2 NEPOSTOYANNAYA OVER "
+    "MOUNTAINSVOWEL SEPARATORZERO WITH SLASH TOUCHING INDEX THUMB STRAIGHT "
+    "CLOUD AND RAINYNCHRONOUS IDLE TIMES IGI GUNU WITH RIGHT LEGVOWEL "
+    "SHORTENERWITH DOWN ARROWACHES THE LIMITWITH RAIN DROPSAI LAING DIGIT  "
+    "OPERATOR WITH ALMOST EQUAL TOWHITE DOT RIGHTWALLPLANE SPACE PLUS HI PLUS "
+    "A-PIECE SWIMSUIT THROUGH CIRCLE AND LOWER LEFTAMOUNT OF CHECK DEYTEROU "
+    "ICHOU WITH DIAERESIS ALTERNATE FORM-NO-EVIL MONKEY PARESTIGMENON ALIF "
+    "LENGTHENER2 CHARIOT FRAMEALAYHE ASSALLAMAND PARALLEL TOBLACK "
+    "TRIANGLEBLADE SCISSORSPARATED SYMBOLD-UP NEWSPAPERPARTMENT STOREFORWARD "
+    "INDEX INOLOGICAL DOTMOTHETIC ABOVEFINAL ANUSVARAAND COLD SWEATINVERTED "
+    "BIRGASEL LOCOMOTIVEUP RIGHT BARB OVER GUD LUGALINSERTION SIGNVRON "
+    "SNOWFLAKESEPARATOR MARKING HANDS SIGNSMALL TRIANGLEUSPENSION MARKDASIA "
+    "PNEUMATAINFINITY BELOWPAO KAREN TONESHESHIG TIMES IGHTWARDS VANEUNIT "
+    "SEPARATORTRIANGLE WITH XO EKFONITIKONTERMINAL MARK-UNION OPERATORDI "
+    "ALLAAHU ANHWITH LEFT HOOKPPED MIDDLE UPDEYTEROS ICHOSDIAGONAL "
+    "MOUTHTETARTOS ICHOSDIAGONAL PATH PROTECTED AREAMRACHNOTIKHAYARING "
+    "MEGAPHONEGERED TREMOLO-BAG MEMBERSHIP HASER FOR VAVWITH DOT BELOWPEN MARK "
+    "BELOWSMALL LETTER JLOTUS POSITIONSMALL LETTER DBHATTIPROLU AAANGLE "
+    "OPENING SHAN MEDIAL WAPLE WITH HEARTPLETE INFINITYLOWER DIAGONALPLITTING "
+    "APARTED SYMBOL FOR IKHAYA PUTNAYATELPIECE CLOCKWITH FATHATAN CERTAINTY "
+    "SIGNENDED MULTIMAPLEFTWARDS AND CRIFICIAL WINEYOUTHFUL FOLLYEND OF "
+    "SECTIONONE SOUND WAVELEFTWARDS TICKTWO WHITE DOTSSTRONG ISOLATEENNA WITH "
+    "BARSCEPTER OF JOVECENTURIAL SIGNOOTNOTE MARKERTWO ENCLOSURESLESS-THAN NOR "
+    "-HEADED ARROW SPEECH BUBBLESEMIVOWEL SIGN ALLAJALALOUHOUCOLON OPERATORUAL "
+    "WHEELCHAIRSQUIGGLE ARROWOBLIQUE HYPHENERIAL ARAMAIC ERIC "
+    "INDICATOREPENTHETIC YUTLETTER OVERLAPNYI ZLA NAA DAUBHAYATO MUKHAERTICAL "
+    "JOINEROLD RESOLUTIONALF TREE TRUNKVONIC ASTERISKLACE OF SAJDAHLITTLE "
+    "SECTIONOT TILDE ABOVELIGHTLY SMALL UPPED INDEX UPOTHERS CIRCLEDTURKIC "
+    "LETTER FATHATAN ABOVEISED ROUND DOTSECOND SUBUNITLINE EXTENSION1 OVER "
+    "LAK-081ROSS ON SHIELDIRCULAR VIRAMAFFED FLATBREADFFICE BUILDINGOUR OBOLS "
+    "SIGNSMOKING SYMBOLOUSING THUNDERLEVEN TWELFTHSSURROUND FROM OPPOSING "
+    "PIRIGJOINED SQUARESAMNUC PII KUUHORANGE DIAMONDORD SEPARATOR EXCLAMATION "
+    "OHTWO DOT LEADERINVERTED DAMMANORTH ARABIAN -CURRENCY SIGNIWAZ TIR TYR "
+    "TIVE OBOLS SIGNIVE KEY SYMBOLOSITION SYMBOLITA PLUS GISH ISSION "
+    "TICKETSVERTICAL HEAVYSIDE-DOWN FACEZAKAYA LANTERNTIMES OPERATORDIRECTION "
+    "FLIPREH FINAL FORMRD PLACE MEDALAU LENGTH MARKWORD SEPARATOR CROSSING "
+    "ESH2GYPTOLOGICAL AVERTICAL LIGHTDOUBLE-STRUCK DIO MICROPHONEVERTICAL "
+    "ABOVEDOES NOT EXISTGHT WITH STARSGUNU TIMES ASHAFETY SCISSORSHIRD-STAGE "
+    "HLIREATIVE HEAVENTHER CHRISTMASAROUND-PROFILEHREE-LEGGED TEVENIENCE "
+    "STOREQUINARIUS SIGNVERTICAL COLONRIGHT CROSSBARUNDER RELATIONMENSION "
+    "ORIGINTHOUSANDS MARKUND MARK ABOVEZAH WITH MEEM REVERSED-SCHWA WITH LONG "
+    "LEGREE-LINE STAFFMEDIUM DIAMONDTHOUSANDS SIGNTHAKA ANUDATTAAI LENGTH "
+    "MARKTOP HALF BLACK AND DIAERESISTRANSMIT STATEDUN3 GUNU GUNUTHALAN ETHEL "
+    "OTHREE POINTED TIMES SHU TENUMID-LEVEL TONEHESIVE BANDAGERRIAGE RETURN OF "
+    "THE HORNSAPPED PRESENT-ESASA DOTTEDMALO POVYSHE GTER TSHEG MADOUBLE "
+    "STROKEEVERSED DAMMACULATED LORRYHIEROGLYPHIC MESSENIAN TENDVOECHELNAYA "
+    "JES SU NGA ROGYA GRAM SHADOPPOSING NAGARPENTRY PLANETU WAS-SALAAMDOUBLE "
+    "CIRCLEVERLAY MIDDLEAN RUPEE SIGNVERGREEN TREEROTATED BIRGABY "
+    "DEFINITIONURNED W BELOWUPERIMPOSED XLISION SYMBOLUPONDIUS SIGNDOTTED "
+    "ZLAMA IRCLED INDEX NING MOVEMENTIOT SYLLABLE FICATION CARDNINE "
+    "TWELFTHSINVERTED TURNITING THROUGHHINESE TONE YSYNDESMOS NEOIVE SLOW SIGN "
+    "AND SKI BOOTAMUHU ALAYNAAIVE POINT ONEDOUBLE MUCAADHERICAL ANGLEDOUBLE "
+    "HYPHEN AND YEN SIGNMALL LETTER ZOTEHEAD BLACKISH LIRA SIGNNUMERIC SIGN "
+    "MEDIUM SQUARE VARIANT FORMERTION SYMBOLAR WITH QUILLHAKASSIAN CHEARLAUG "
+    "SYMBOLSAMYOK SANNYACIRCLE INSIDESSAGE WAITINGUPSILON WITH U WITH "
+    "STROKENUMERATOR ONEOLVING HEARTSOMAN NUMERAL CHRYSANTHEMUMSTABLE "
+    "SYMBOLL-TYPE SYMBOLOBLIQUE LINE ARCHAIC KOPPAER BOARD FILLS KRYZHEM ON S "
+    "KAI APOTHESHAM DIGIT ONEMASORA CIRCLELATERAL CLICKNTY FULL STOPOGOTYPE "
+    "SIGN S UP TOGETHER-PER-EM SPACE-OR-PLUS SIGNLEFT CROSSBARSAL PLUS "
+    "TUG2ARGOSYNTHETON-OFF CALENDARCITATION MARKTIRTA TUMETESEUROPE-AFRICAYOD "
+    "YOD PATAHCROSSING GAN2WO-LINE STAFFYMBOL TAU RHOKAPYEOUNPIEUPRTABLE "
+    "STEREOSILI PNEUMATACROSSING GABAOON NOTEHEAD CROSSING MUSHARROW "
+    "OVERLAYH-TYPE SYMBOLVERTICAL BARS OPPOSING KUREMPHATIC TONESIGN "
+    "AVAGRAHASIGN PAMUDPODVERTICAL FILLONAL COMPUTERMARKS CHAPTERMELODIC "
+    "QITSACRIPTION TAKESTERTIUS SIGNCRIPTIONAL PAK WORK SYMBOLLEGETOS ICHOSONG "
+    "RIGHT LEGCHECKER BOARDUPWARDS TRENDONG-LEGGED DEONGRATULATIONARRED "
+    "TRIDENTSHESH PLUS KII WITH STROKEGAR FRACTION  BAT AND BALL CROSSING "
+    "KA2WITH INTEGRALAUDATE CHRIVIFOREMENTIONEDMODIFIER MARK WITHOUT SNOWED "
+    "PAPERCLIPSZHOU NUMERAL VEN POINT ONENG TERMINATORPPOSING LUGALGAW KAREN "
+    "SHADIAERESIZED UWITH ASTERISKBOHAIRIC KHEIPA NJI PIPAEMED DOUBLE VERBASAN "
+    "LETTER MINDER RIBBONSIA-AUSTRALIA WITH JEGOGANHREE TWELFTHSPAIRED "
+    "ARROWSUSICAL LEIMMA BZHI MIG CANRN PENTATHLONLVEOLAR CLICKTE ORDER "
+    "MARKGIFT ENVELOPEVE-LINE STAFFSMALL LETTERSYUUKALEAPINTURIZONTAL "
+    "TAILEELING PERSON WITH TEE TOPPLUS OPERATORFROWNING FACEIMAGE "
+    "BRACKETRIPLE SVARITAIGHT TWELFTHSRACKETS ABOVEWAVY OVERLINELVE FULL "
+    "STOPTHIRD SUBUNITMINUS WHITE XMINUS SIMILARILE SEPARATORBACKSLASH BARW "
+    "RING INSIDE DIMINUTION-1FINAL SEMKATHEHU FEOH FE FFULL SURROUND HEADED "
+    "ARROWSELECTED AREAUDDISA SIRRAHDIC MARK SIGNBALL AND HOOPUSHING "
+    "UPWARDWAW-AYIN-RESHOUT MIDDLE UP WITH INK PENOURTH SUBUNITRANKS CASKET "
+    "INVERTED FORKVICE CONTROL  DIRECTIONAL TROFLEX CLICKRIGHT "
+    "HARPOONAWELLEMET YAZNAP PIZZICATOFINAL LETTER MAILBOX WITH TOP HALF "
+    "RINGANNED LEATHERLOCATION SIGNACCOMMODATION B BAR SYMBOLBOTTOM CORNERFT "
+    "ARROWHEAD TED HAND SIGNUFFLE PRODUCTMULTIOCULAR OQUARTERS SIGNEAVENLY "
+    "EARTHPREPONDERANCEFIXED-FORM RAIFI ROHINGYA LOCK WITH KEYILABIAL "
+    "CLICKINTEREST SIGNWAVY LOW LINEEDIC ANUSVARAMOBILE PHONESVOWEL SIGN "
+    "PABOWING DEEPLY WITH OVERBARUE OF LIBERTY TIMES KASKALLEFT-LIGHTEDVOLTAGE "
+    "SIGNCRESCENT BARSHORT RIKRIKNUITY SYMBOLUPPER CORNERENOS CHRONOUDIGRAPH "
+    "YORIALLPOINT PENDIGRAPH KOTOMPTY CENTRE LU PLUS ESH2DICTION SIGNLEADING "
+    "EYESMPHASIS MARKMEDARY CAMELMBELLISHMENTACE INTEGRALS SUBPUNCTISLUS "
+    "NOTEHEADLOWERED FLAGDOWN NEUTRALN ELEMENT OFENT ARROW POULL NOTEHEAD-MAIL "
+    "SYMBOLUME INTEGRALSHED BARLINESMALL DOUBLELEFT HARPOONCROSSING "
+    "NUNMONOGRAPH UKMUM TIMES PAMEDIUM SHAFTNGLE BARLINEDOUBLE ARROWEGIN "
+    "SEGMENTUBSCRIPT TWOMADDA ABOVE MALL SECTIONAFU LEERAEWAWDATA SQUARESMALL "
+    "TRIPLELICKING LIPSAA AS-SALAAM-DZUD RTAGS DASHED ARROWNORTHERN TSESMILING "
+    "FACEEIGHTH NOTESMIDDLE PIECELL MODIFIER-UN WITH RAYSACUTE ACCENTSECTION "
+    "SIGNLINKING MARKLINGING FIREDOT OPERATORLLE PATTERN NJALA GONDI LIMBS "
+    "DIGITSDOUBLE ARCH  WITH INDEX NDING PERSONM NSHUT NYAMLER CONSTANTSH ZIDA "
+    "TENUNCK CONSTANTCROSSING LU2CROSSING KALCROSSING GI4DENTAL CLICKNATURAL "
+    "SIGNENARIUS SIGNNARROW SHAFTDOWN HARPOONDUG TIMES NIUGHT BALLOONMING TO "
+    "MEETNERSHIP SIGNNEPOSTOYANNYMETA STAVROUEMELY HEAVY  WITH DAGESHEAGULL "
+    "BELOW SKEWED LEFTLOWER CORNERNOTCHED HOOKNOTCHED TAILEMISOFT SIGNEEPING "
+    "SMALLDE MARK SIGNMANNAZ MAN MUH PLUS GISHSAZ IS ISS IRNAM BCAD MARISTMAS "
+    "TREETEARS OF JOYTE SEPARATOR IN TRIANGLEIN MIDDLE UPBINING MARK PHEME "
+    "JOINERANG KHANG GYBLACK CIRCLEFOUNTAIN PENFORMING ARTSINDEX MIDDLEPOETRY "
+    "MARK-GAW KAREN EURION CHRONONPOUTING FACEIGATURE SHRITERNATE AYINPORT "
+    "CONTROLBEHIND CLOUDUTH-SLAVEY KUTH ARABIAN TRIPLE DANDATRIPLE "
+    "FLAMEBETWEEN LIPSFT RERENGGANINUSOID SIGNUSEATED FACEINVERTEBRATEAND "
+    "OPERATORBRATION MODEAND CRESCENTBRIDGE ABOVEBSCRIPT ALEFOUR TWELFTHSYAN "
+    "NUMERAL IRAGANA HOKAOUGHT BUBBLEFERENCE MARKOUCHES THUMBFEMININE "
+    "DOTBUTTON MOUSEFOLDED HANDSBLOWING FACEBLUE DIAMONDING ENVELOPE "
+    "KLYUCHEVAYAING HITTING ING OPERATORXIRON KLASMAFLAG ON POSTROLLING EYES "
+    "LINE SYMBOLINTEGRATION OVER KASKAL RIGHT DOUBLERED KEYBOARD AND "
+    "PICTUREGUARDED AREAGROUND SLIDEGREEN DRAGONRCHAIC SAMPITHREE HEARTSWITH "
+    "SMALL VRANCHING OUTHEAD-BANDAGEHAND FORMAT RIAL TRAMWAYRIAGE SYMBOLHASIS "
+    "SYMBOLARALLELOGRAMHALF BRACKETREVERSE MARKVER EQUAL TOAR DIAERESISHAH "
+    "WITH DALREN CROSSINGREFACE COLONHIBITED SIGNBAHIRGOMUKHAQUARTER "
+    "SIGNQUARED ARROW CROSSING GUBACK OF HANDQUIRREL TAILIDENTICAL TOGEBA "
+    "KAREN IRING OVERLAYVAKRAHASANYAPROTOS ICHOSGBY FOOTBALLRAFFIC LIGHTHREE "
+    "FINGERSATNAH HAFUKHVICTORY HANDTOP-LIGHTED ATTOOED HEADRAH BEN YOMO6 LONG "
+    "NGGOO-SHAPED SIGNTHODOX CROSSHYPHEN-MINUSRIGHT SINGLETHIC LETTER TRAGRAM "
+    "FOR THETA SYMBOLWIGGLY FENCEOPPOSING LU2 OVER KISIM5OQ NSHUT YUMLARGE "
+    "DOUBLE ON PEDESTALS ABOVE SIGN OVER MIDDLEALT PAN SIGNOPLE HUGGINGOHAZARD "
+    "SIGNLATALIZATIONYOD TRIANGLEOGOGRAM NYAJYOUTHFULNESSON US SYMBOLYMBOL "
+    "BINDU OK HAND SIGNKANA REPEAT CIRCLED PLUSLARGE TRIPLECENDING NODESS-THAN "
+    "SIGNEVERING FACEERPENDICULARKLYUCHEVAYA CK-O-LANTERNOPENING LEFTSUR OVER "
+    "SURKAPPA SYMBOLCIRCLES AND OING TO MEETOID NOTEHEADOTTOM HALF OT "
+    "MONGKEUAEQCHARACTER-1BCABBAGE-TREEALTERNATING FALLING DOTS OVER TWO "
+    "PIIRTY-SECOND BYSMAL WATERONISHED FACEETRETES SIGNLAYING CARDSCHAIR "
+    "SYMBOLKHAMTI TONE-KHMIMIC KHEICHARACTER-18CALENDAR PADCIAN LETTER "
+    "-SIMPLIFIED IVE TWELFTHS OF ANTIMONYROUNDED ZEROHREE BALUDAE WITH "
+    "VEILGRAMMA SIGNHORA DIGIT ULO TWO SUMLACK SULFURTRAIGHT WAWL OF THREADL "
+    "TIMES LAL0 FOOTSTOOL WITH JACKSWHITE JOKERI TIMES NUNI TIMES BADESH "
+    "DIGRAPHACKED COMMATHIRDS SIGNLACKLETTER MACING FACE-OFF SYMBOLLEFT "
+    "SYMBOLLEFT SINGLEXAGRAM FOR ENTHESIZED 6 LONG NGGE-MINUS SIGN WITH "
+    "FLASHE2 TIMES ANLEEP SYMBOLLEAF CLOVERHEELED SHOEWO TWELFTHSHAGGAR "
+    "YAZHLATIN CROSSERCENT SIGNHEAVEN MARKDUATION CAPHEATED FACE WITH "
+    "COMMAEPIDAUREAN HAWH HMONG  WITH CARONHANG KHUDAMSINGLE AND 5 LONG "
+    "MBOOLCE TSA CANMBA BAYANNALD SCRIPT XSIMILE SIGNMBLER GLASSLD POLISH "
+    "OLEFT DOUBLESSANGKIYEOKGRAVE-ACUTEACUTE-GRAVEHOKHLOM ON THREE "
+    "TIMESEORGIAN NARSTERED SIGNHLETIC SHOEACTIVE SIGNHITE DRAGONGSUM "
+    "-KHYILDYO CHRONONGUISED FACETONAL MARK UMAN FIGUREWASLA ABOVETIEE "
+    "SHEUOQTIGHT ACUTE WITH DASIASPIRATED FAHIGH STROKELETION MARKJECT "
+    "SYMBOLLON SKEWED JIHVAMULIYAUG RTAGS GYSVASTI SIGNINDICESIMA TRUNCATED "
+    "AEEZING FACELEU SATANGAINDERGARTENJOYOUS LAKEKAARA POLLUFOURTH ROOT WITH "
+    "TRILLZZA WA JALL WITH TITLOUISHED FACELOSED ENTRYSPEED TRAININ EQUAL "
+    "TOLOSING MARKLOTI NAGRI IMULTANEOUSUETTE BREADTUNE "
+    "COOKIEYEORINHIEUHIRCLED TEXTIPLE TONGUEFGHANI SIGNTA EQUAL TOISIGOTHIC "
+    "ZWING NEEDLEFINAL SIGMA-COPPER ORE WRIST FLEXFIRE ENGINEIVERY TRUCKUBLE "
+    "TONGUESYURA SASAKWINKING EYEIX TWELFTHSWE PALAUNG SYMBOL VIDJ WITH "
+    "MAPIQIEN MONSTERKRAINIAN IETRESS SIGN LTED FLOWERGE AT "
+    "NIGHTKTIESELSKABLTERNATE YAXI RADICAL LINE FILLERLU PLUS IGIGENTLE WIND3 "
+    "LONG NGGOTETRAFONIASXESTES SIGNTH-THALATHAEAVER DENE ENG DIGRAPHSTEAMY "
+    "ROOMGHAIN WITH THAM DIGIT LUPOVODNAYAIBLE-CREE YTWO FINGERSEUNJOMNDEUQTY "
+    "THOUSANDILIQUA SIGNEDICAL MASKILCROW SIGNABOVE RIGHTIL "
+    "FRAGMENTXTINGUISHERTENS DIGIT WITH GARDENEN STRAIGHTTRIAN CAMELGAP "
+    "FILLER-SMALL CLOUDSTORIC SITEGAYANUKITTA WITH PLATELT OF CLOTHETEI MAYEK "
+    "TRESVETLAYASECOND MARKPHNAEK MUANRISING DOTSBETA SYMBOLZIGZAG LINEUTH "
+    "CORNERSCURVED BENDRITING HANDBELOW RIGHTPODCHASHIEMUPADHMANIYAUTING "
+    "WHALECROSSING URPARAKALESMABLACK ARROWCROSSING BUCROSSING ENCROSSING "
+    "IMCROSSING PIRIPLE PRIMENSE CHEEKS  PROPORTIONCTION MARK CTION "
+    "MARK-PERISPOMENI I ZAPYATOYAWNING FACEDE KIKAKUI VARYS ICHOSQUERED "
+    "FLAGQUIQUADRATEND OF PIECEVYKA ABOVE  SHOE STILEND ODD SIGNSHAAYATHIYAVE "
+    "OF PEACEDENT EMBLEMNBLENDED UKRIGHT-LIGHTRIGHT-HAND UNJO WYNN W S "
+    "ZAPYATOYNIKOLSBURG POST OFFICEVA V CHELNUBANK "
+    "SYMBOLDALETH-RESHVAMAGOMUKHAPUT MORTUUMNG LEFT LEGRING LIQUIDDASH SYMBOL "
+    "DECORATIONCAN RGYINGSRPOON ABOVECARET TILDE OF FLOWERSOLD NUBIAN ORT "
+    "BARLINEAMUSED FACEORCE SYMBOLVISARGA ONERYVNIA SIGNCK SEXTANT-OHINGYA "
+    "YEHOF MASHFAATZERO THIRDSOF ENVELOPERUNNING MANONIAN SIGN  OVER BULUG "
+    "OVER IDIM CH AND LAMPCHING CHICKCELANDIC-YRCE OF PIZZAOMAN SIYAQ "
+    "CCUMULATIONOPPOSING ENOPPOSING IMOR OPERATORBOTTOM MARKNYIS -KHYILCONTAIN "
+    "AS BREVE BELOWOUTHERN TSEROR-BARRED RONTHISMATAOVERSTRUCK COND "
+    "SCREENNUSVARA ONENUN HAFUKHANUMBER ZEROROKUTASTI ANUMBER SIGNCREDIT "
+    "SIGNNTIMONY ORE PLUS MASH2OUBLE ACUTEBZHI -KHYIL PLUS NUNUZURRENT "
+    "SIGNOUBLE DANDANITIAL IZHECOMBINATIONOUNDED FACEROSS ACCENTBUMPY "
+    "ABOVERCHAIC JNYAMIDDLE STEMASE TO THE  AND MACRONDONG "
+    "TSHUGSDOACHASHMEEREAKTHROUGH TIMES ESH2AILLESS PHIRIGHT GUARDMONOCULAR "
+    "OMOVED BELOWDIATONON DIATH PRODUCTRANSMISSIONRIGHT HEAVYRIGHT LIGHTMFON "
+    "PIPAEMME LONG CANMED RGYINGSARAM GONDI  UPPER HALFRESPONDS "
+    "TOAESCULAPIUSAESHAE NYAMARM SPIRAL ARMS RAISEDDOLLAR SIGNDOUBLE "
+    "SHADDOUBLE RINGDOUBLE MARKARPEGGIATO AGAZ DAEG DMICAL HEARTMIDDLE "
+    "BENTDOUBLE AND MIDDLE HOOKAGONAL SIGNDESK PERSONSHEQEL SIGNUNIT DIGIT "
+    "MUUSIKATOANMUNCIA SIGNRADITIONAL N THE VERGERACHMA SIGNATION SPACE TACK "
+    "BELOWRA SOMPENG ATION POINTRAISED FLAGRAGGISMATAOTING STAR1 PLASTICSZH "
+    "DIGRAPHFAHRENHEITQUISH QUADOSTAL MARKVEL SLIDERTHMIKON N 1 LONG "
+    "MBEURIPIGMENTIT MBAAKETC WITH DOTROUND DOT HEAVY BEATISMUTH OREGHT "
+    "LIFTERWO SHORTS OUT INDEX URVED OMETBSTRUCTIONHERMOMETERION BOTTLEXED "
+    "BICEPSBROKEN BARHAAPRAANA WING HEARTOUTER JOIN AND BREVEFINAL HETHOUTHERN "
+    "TAATRICHISMAOSSED SHEIVIOUS PAGEAYER BEADS AND ARROWOUND OMEGA AND "
+    "ACUTEFFICULTIESTAIL GLASSATTY WITH OUR FIFTHSRSI SYMBOLTWO SHORTSOON "
+    "LILITHOON SELENAEUTRAL YERSTRUCTION RGE CIRCLEUR YIG MGOUR HUNDREDR2 PLUS "
+    "SUYMBOL AIVAOP NKAARAEKAI SYMBOLKA SATANGAK2 PLUS BUGIMEL-HETHRHO "
+    "SYMBOLETTA-PILLAKINDI MVOPSTRAL SIGNHAMZA MARKI ARCHAIONTYPE COLONOPEN "
+    "SHELFCHAD RTAGSUR CORNERSCH BALLOONRGE SQUARESTROM SIGNTWO THIRDSRESH "
+    "BELOW5 PLASTICS OF DHARMAHEADSTROKEORTHERN TARIGHT SIGNIXTHS DISHROUNDED "
+    "ERF SHE-GOATT AND BOLT3 PLASTICSHUNGARIAN TIMES SIGNTING HEARTEVERSED PE6 "
+    "PLASTICSJONG TILE REVERSED IITH DIGIT SYLLABLE MZU OVER ZUCAPITAL ETOROME "
+    "SIGNVERAGE BOXPLUS BELOWIKRON ISONUTH OR SPYPLUS ERIN2TEMPLATIONHOOK "
+    "ABOVEPLUS NAGA BELOW LEFTWITH SPOONHAN DIGIT FRONT WALLY AND RICEGREE "
+    "SLASHRCHAIC KHAWITH STRAWANGKHANKHUGAGE CLAIMFTOGGOS OUGGING FACERING "
+    "ABOVEILE FOLDERIDDLE MARKIGATING RA DRAWINGS TERNATIVE PRALINEAR "
+    "GBAKURUNENTESE CROSSPPOPOTAMUSRIGHT HOOKIED SHRIMPTRESS AND "
+    "TREFACTIONHREE ABOVEXHEEJ CEEVIDEOGRAPH POLICE CARANGULAR TOTOP "
+    "CORNERGANDA MARKHOTIC HOOKPOUND SIGNIGATURE OEGAS BZUNG TRETCHED "
+    "CROEZENIAN INHERENT A AND MOUSEBOLD SHAFT2 LONG MBOING-SHIFT ANDHI "
+    "MARKING LARGE INITIAL RAROAD OMEGAAUTOMOBILE2 PLASTICSFOR RECORDINDU "
+    "BELOWTAMAN SIGNUSEL HORSEGOLUBCHIK THDAY CAKERED DRAGONTHAPASCAN 2 PLUS "
+    "ASH AND KNIFEUSHED FACEVIE CAMERA LATE FORMICAL TAPERRDHACANDRAWITH "
+    "WINGSASTERISCUSICK FIGUREPASSIMBANG KABA TENUPEDAL MARK7 PLASTICSRKING "
+    "FACE4 PLASTICSRECIPITATEFORMATTINGGUA PI MAOINDEX BENTBLACK "
+    "FLAGASPIRATIONGGRAVATIONBA SATANGALPAPRAANA  WITH RAIN WITH PLUSA TANG "
+    "LAIED FINGERSNTITY MARKED FIGURE-N NGGEUAETALENT SIGN WITH "
+    "PAGEENETRATIONNTO SHRINESHMIRI YEHLEFT-HAND -LUE KARANENS SYMBOLLEK ATTAK "
+    "NAKE BELOWEDESTRIANSLENDED YUS POVODNAYALOWER HOOKALEF LAMEDCROSS MARK "
+    "THOUSANDSCROPHONIC UBLE DASH  WITH RINGSHARP SIGNLEFT GUARDLEFT "
+    "LIGHTMONOGRAM BLEFT HEAVYMONOFONIASDIRGA MUREEONGCHIEUMMONOSPACE AILED "
+    "BIRD PLUS SHU2EARTH MARKW OR MODELCOMPONENT-COMPONENT OANDAKHIATUPPER "
+    "HOOKNUMBER TENDIATONIKI LTERNATE UA PLUS KURLTIC CROSSSBUB "
+    "-CHALENTHUSIASMLEFT SERIFA PLUS IGIEBENSTIMME WITH LOW DIGIT ZEROMONTH "
+    "SIGNSGOR RTAGSSMALL TAH EIGHTIETHSLONG FINALLONG OVER UP HARPOONZAR "
+    "AMULETNDU TEMPLELONG TSHEGCY MESSAGEDA PLUS HANGUAGE TAGUP OR DOWNUP "
+    "NEUTRALNGLICANA WLLOW HEARTDA SATANGA SCHROEDERSELINE ESHAB2 TIMES EICH "
+    "STARKABATA TREED WITH DOTLOGICAL ORAKKHANGYAOSMILO SIGNNASPIRATEDUNKIA "
+    "SIGNLHAG RTAGSLGIZ EOLHX WITH TAILSPACE MARKCURLED WAWNANGMONTHONOTE WITH "
+    "LET SYMBOLSCAN LINE-ND SEGMENTLINDRICITYLIMITATIONDED PERSONNDA PA "
+    "NJISE-CREE SKLIGHT BULBLIGHT BEATMOTORCYCLE WITH TICKEEKING EYE RGYA "
+    "GRAMCURLY HAIRELT BUCKLE RESUPINUSMEL SYMBOLMALL ALEPHSSANGARAEAON MEDIAL "
+    "E PLUS SUMCISIVENESSADAK BINDILANE MERGE WITH EGGS TIMES SHESS OF MILKU "
+    "CIN HAU UM ROTUNDAKRYZHEVAYAWHOLE NOTEST PALETTEOLON EQUALLACK JOKEROLING "
+    "FACEDUOUS TREEWHITE HAIRRUPEE MARKLA USED ASMEEM ABOVEUMAN EARTHSIDEWAYS "
+    "IZEIRO SIGNU2 PLUS BACIRCLED CAST-FEEDINGOMMA BELOWDOUBLE BARSSANGPIEUPM "
+    "STALLIONMINO TILE  OVER KAD5COLATE BARAEDA-PILLAUAM TSHOOJRUDIMENTA "
+    "-SHAPED HASIXTEENTHSEQUIHOPPERALLY MARK LE LETTER ME PLUS "
+    "ENLE-DELAYEDCHECK MARKEARLY FORMUARDEDNESSADDA WITH OF HYGIEIAWHITE "
+    "FLAGMILLE SIGN WITH BASE WITH BELTMADDA MARK SPARKLERHEADSCARFHARD SIGNIA "
+    "SYMBOLHARACTERSSEMICOLONNGER SHIPZ DIGRAPHNCLOSING NFORZANDOSHAB CEEBLOND "
+    "HAIRIDEWAYS UARCHAIC MRFUL FACEQUSHSHAYAXHAUSTIONNG SANDALIDEOGRAM "
+    "QUADCOLONLONG TIP TIMES PAPSEPTEMBERQUEEN OF IALECT-P NDAILING ICE CREAM5 "
+    "CYPERUS5 LONG JO AND TAILWRY SMILEWORDSPACEMRACHNAYAHINOCEROSHOT "
+    "SASAKMAEMGBIEEWRINKLES HIMA SIMARED JOKERMUKPHRENGRCHAIC IIHIYYAALAAREAK "
+    "HERE TIMES HAM HE-GOATRDEL DKARRCHAIC RALVIN SIGNREDNE ON  APODEXIAHOOK "
+    "MARKMBROIDERYZAL SASAKMALL RINGHWAZ EH E3 PLUS ANTIMES NA2RIED FACE5 "
+    "BATHTUBLOWER DOTI PLUS LI STREAMERMHANCHOLLR PLUS RA "
+    "TROMIKONMETOBELUSMARK CIM ZAKRYTAYAHREE FOR  AND CURLHI SYMBOLMARK SHADNA "
+    "KHONNAXCITEMENTREFORMED  AND BELTSIVE FACE TIMES UDISEN-ISEN PLUS LAL "
+    "PLUS KU3ROTATION-OTAL SIGNOF STIMME-STACCATO PLUS GUDT ON BONE PLUS GALS "
+    "DIGRAPHODIASTOLET OF MEATLARGEMENTYRANISMA OKED HEADITRA SIGNZERO "
+    "SIGNOKED TAILLAN SIGN  OF BLOODIVE-PULL-IVINATIONNVERTED ROUTH WIND PLUS "
+    "ZA7 PLUS TUROUT MOUTHYEAR SIGNYEH ABOVEYEH WITH OURA SIGNORTH "
+    "WINDTAKHALLUS PLUS SAGSPIRITUS IRST MARKTABE SIGNOCCLUSIONZENE RINGON "
+    "GROUNDL ME HANDKYO TOWERON TEUAEQSTEBASKETRTER MARKRUM CLEF-OO DENNENKU "
+    "RU KHAKSTREPTON OVER LUMONE MARK- OVER BALKEMPHRENGONE THIRDSTRELNAYARTS "
+    "MEDAL0 LONG LEONG GRAVEKING BOOTONGSEONG "
+    "RPORATIONOKOUFISMAORT-TWIG-SSANGSIOS1 CHARIOT OF PAPERJERUSALEMLACKFOOT "
+    "RWARI DDAOM SYMBOLK GESTUREKA- SHOG KAMEYTSA OP HALF OSTAL BALLPLE "
+    "HEARTLITTLE UP GARSHUNILISSANDO IGN NUKTAIGN SAFHAIGN TOMPILINE FACETEH "
+    "ABOVELIGHTNING-AMMONIACIGHTH ASHTED PLANT RICKSHAWNO TELEIAPIDERY HAILE "
+    "TILDE247 DIPTEILIPPINE Y BLOSSOMNIGHT OF NGUN SIGNPROJECTORZIR SASAKSMALL "
+    "YUSPPOSITIONLLABLE OMPPOINTED LLABLE B0NIGGAHITA RA OR RINIHSHVASASOF "
+    "PASUQ FROM BARLIVERANCENING SIGNIGH HAMZAP ELAMITEING LANESP DIGRAPH-LOW "
+    "TONEING STONENTRACTIONINISHMENTROJECTIONINNYIIYHELEFT "
+    "TACKNUSVARAYAPAA-PILLAOW KAVYKATANDSTILL2 GARMENTOVER MUSHLEFT RINGOVER "
+    "GAN2-MID TONENTERPRISEPENTASEMEPENT SIGNIN SQUAREINAL NOTENSERT AT "
+    "INARBORASRNEY PARAY-FOURTH Y-FOURTHSRO WIDTH NTESSENCE-KHYUD "
+    "PAPANYANGGAING CARD ING DOLLSPADE SUITING GLOVEED DIGIT ETRASIMOUEAVY "
+    "DOWNURNED AYBBITE LIPSEBIT SIGNTRESVETLOAVE ARROWETTI BALLCHOSEONG URLY "
+    "LOOPFROM WALLUTRA MARKFACING UPED PLANETABOVE TO UPPER DOTATHAMASATAL "
+    "RUNOUTCORN FACEVIGINTILEUURDHAJA UBSTITUTEANG CITI URNED GANFEH WITH "
+    "TUKWENTISDEPARTUREURAMAZDAABKHASIAN ANTHAKHATDENT AND VERLONG "
+    "AAJANYALANUR-DE-LISACE NOTE ALI GALI VRAKHIYA G IN HOLEA PLUS "
+    "NAVELOPMENTAOS ICHOSCAPITAL QGREATER YANTAYALANBICYCLISTCAPITAL IANSKRIT "
+    "SUE MAEMBAGITTARIUSBIAL SIGNCARTRIDGEDAD WITH B DIGRAPHEIGHT OF "
+    "CRESCENDOVISARGAYAVOCALIC RBEER MUGSVER LUGALD SALTIRETUTEYASATCANG "
+    "TE-UTONE MAI EEN WITH ER BUBBLEVICE MARKBING CANEGRIK SIGNENTRY SAWWITH "
+    "FACEATTACHED EFAIDRIN CAPITAL DANGGEUAETEFORMED TARISTERA HALF NOTEFISH "
+    "TAILEMPTY SETDOWN SIGNDOWN STEPCOIN SIGNADMA GDANBASE UNITWING STAREURO "
+    "SIGNADEG ADEGARM CLOCKAROSHTHI VOETOCHIEFINAL NUNCHANICAL CUBE ROOTCLOSED "
+    "PLESAME DOTALPAPRANAES AKURU EMBEDDINGAFFE FACEFLAT SIGNAF PERSONBOTH "
+    "BENTTREDECILEALAYALAM ERTY LINEBO GYFU GHALSHELETTTED STEMDOWN HANDBO "
+    "BAIMAIHALF SIGNELEGRAPH AISED DOTFINAL NGABRUL SHADFOUR BENTAS MEMBERETER "
+    "SIGNTO CORNERERCIAL ATE AT LEFTUNGSEONG VANAGARI URUZ UR UVINE "
+    "LEAFUPTSTIMMEUVUZHAKKUAINTBRUSHFINAL MEMDRAM SIGNHAIKSUKI "
+    "UNGLASSESCHAVIYANICOMPLETEDWASH TAILUMED HEADELLOWSHIPTRAIGHT UDUS "
+    "RTAGSVEUAENGAMANEROSIS KAIYARAAEVEN OF CHATTAWA OVER "
+    "KGKATAKANAKASRATANETRASEMEL POLISHETA SIGNCK CHARTET SHOESOHM SIGN PLUS "
+    "DI PLUS DUL-LAKUNAEST WINDLA LENGACLIMBING OVER ZIEUFEUAETONE FOR  OVER "
+    "MUCHINESE ON CROSSOMMA BARCLOSED TOMANIAN OM NTEUMOLLOWINGBUNDANCEBOX "
+    "TRAYOVER GA2OVER BU FILE BOXBRA FACETTO MARK8 KANAKOYBEYFILIROSSED OANC "
+    "SIGNYENISEI IRD MARKYER YAGHTAI LUE FEBRUARYTAALUJA IS FORM BOL SIGNING "
+    "ROD  LANTANGBOT FACETAR EYESOVERRIDEIS WHEELTTENTIONOVER TIROVER SHEOVER "
+    "SAGOVER GI4FINAL THCASSETTE1 BARLEYJACK OF "
+    "JAVIYANISWIMMINGEXCHANGECEILING RSE DUNGJUNCTIONSUPERSETCER "
+    "BALLEVERANCEOO TYPE SUCCEEDSCANDICUSIS-PILLAC SIYAQ OTIFIED YESIEUNG "
+    "NUTILLUCABLEWAYITA MFONOT MBUAETURNED MCAL DISC OTTAVA AMS HORNT NGGEET1 "
+    "HELMETYIDDISH ORM FEED OF YARNOREHEAD  ON LEFTNAVIYANIECH YIWNLTRY "
+    "LEGEBEEFILILUB SUITSMA SIGNNCE SIGNM ALLAAHED BRICKULLS LEGNAMENNY "
+    "ZAKRYTOEAIYANNOINA METEKN-JOINERSIX DOTSACKSPACELORRAINEABAAFILIWBOY "
+    "HATABOAFILIDAMMATANLONG BARNG RTAGSDANTAJA LONG S TNEUTRAL E OF "
+    "POOUKEUTNDALOW DOUBNEIFORM LOW STOPNED FOODDDY BEARLOZHITIE "
+    "SLIDINGSIFISTONHAN-AKATDIM GUNUUNG DASHAEN NYAMMON TIMESHORT ERSIGN "
+    "LAEMEM-QOPHUNDERTIEUNDERDOTDIT CARD TTUDDAGMMATION MIONIAN DOCUMENTW "
+    "PRINTSDUSHENNAMALL AXEMY HOUSE TALENTSMANDARINDVISVARAMANGALAMDVANTAGE "
+    "SCOTS SSHKIR KAMARRATANDS-CREE SHOE JOTDIAMONDSWASH KAFDIFONIASME "
+    "BADGEUATRILLOERAL URNER TRUTHALLIANCESALT OF VOLUTION-PHIEUPHUAREG "
+    "YALEANING SQUEEZEDYRILLIC EOUT BOXVOMITINGCOUNCIL COUNTERSA SIGN "
+    "AUBJOINERENICIAN ESH LOOPODESTONE0 BRONZEOCUS OF OCK SALTOCALIC "
+    "MYPORROON-X BELOWOBOOFILICOMBINEDEREVODKAERDIGRISLATION XSNA LDANSE "
+    "WEDGEELEPHANTEK ONKARNITIAL ZD BUBBLESOFTNESSD CROSS NINE OF SCRIPT "
+    "GLKULIZMYUP TRUCKNI ABOVE YUQ NAEUDAWADI  SATCHELEGORIAN "
+    "SENTAGONLOCATIVENOTE PAD POLNAYA-KHIEUKHSPERSIONSANYAKA EN NTEUMNRES "
+    "TOSLESS SHALESSER YNOVEMBERS OCHKOM-EM DASHLF RING LFWIDTH  RASWADI-CREE "
+    "THCURLICUENO THUMBCURSIVE NO SLASHY BEETLERDEL NAGIMANSIS GBASINNAASTERN "
+    "WGLASNAYAAZHAAKKU CURRENTTO-LEFT ATAKANA XCELLENTVERGENCEATE "
+    "MARKATEBOARDTHOSCOPEBINOVILETICK IN PENTAGONAPITAL FRILLIONSREE "
+    "MARKINAGARI ARTYRIA RED HAIRBACKWARDFRAKTUR BATBEIT QAIRTHRAY "
+    "POPPERHESPIAN REATNESSTHIOPIC BACK YERANS SIGNFRICAN DPAVIYANI ANTENNAAST "
+    "WINDHOP BELLQUINTILEBEVERAGEBER POLEGORAZDO  HANDLESAVY BANDTRICOLONGREAT "
+    "SA CEDILLATER FACEIGMOID SWRINKLEDVE SASAK3 ARMOURWRITING RAMMA GGRAUGHTS "
+    "BILLIONSATH MARKHREE OF RASMIAN GARITIC BIEE FONTRI DISHWON "
+    "SIGNAY-NIGHTRIYOOSAN AT DUSK56 TURO2FLOURISHFOR STOPPALOCHKABLE "
+    "SIGNICHAEAN ARCASITEPUSHPIKAZWJ THAJV OVER MAR "
+    "TSHESHARBAHAYZWARAKAYHARMONICBLINEAR PAKPAK ETIRRUP RTISMOS EANE "
+    "TREEARKLEAN BLED CARHAGALL HWO ABOVEPRECEDESHALF GURGENITIVEVESSEL "
+    "BPROSTAYAPUB DAWBPAIRTHRAARSI YEHRESVETLYWN HEARTI SHAKTIING BELL KEMBANG "
+    "FACING ING BOWLTOWARDS ARRIVINGPUN IYEKPTHAHA SOV ROGLF FACE RAMBATAY "
+    "SIGNGOLIAN VAYANNAVE DOT QUEEZE GHEUGHEEL PUMPUBUFILI-WELSH ERNIN "
+    "ANJAEMLILAMITE ZQAPHA D MADDAD MOUTHIBIFILIGRADUALPSTICKSALLOT "
+    "X-TIKEUTSCOOTER CHIKI LASHES  CER-WAAXIMATAQUARIUS-CREE RIANGQI LIGHT "
+    "XCOMING 3 OMEGABAMBOOSSOLDIERTRAINERA NAME VAPOURSVANESE "
+    "THESEOSPUSHPINSANDHI CRACKER-MU-MO--SHIFT-3 SPICE3 SWORD-MACRONENSHUETI "
+    "RTAGS6 NGGOOI NTEUMSAMPHAOLE LEAFVOICINGPURPLE A -PHRUSPRINGSCOPTIC "
+    "THIEUTHHYAAUSHNUMBERSSA VAH BAIRKANSAYANNAVAV YODCONTACTEN "
+    "LEAFS-SAJDALEUT KAVOWEL K-THIRTYTHKUQI SANGAN ALESMA GLAGOLIER "
+    "THAN-KIYEOKLEYBALLNTAINS LAYANNALEK TOO3 WHEELLENGTH-TORNADOAS "
+    "SIGNHAARKAADYNAMICSHIFT TMANCHU WO WAENMUNGKAH TEDUNGMARCATOVYSOKO DU "
+    "NJAAWO MARKMASSAGEMRACHNYDIARGONDRIL BUMAAYYAATIKRAMAEAD OREHEXAGONUM "
+    "IYEKMAI SATTIVATE VEW NOWREATHY ASHTRA ACTER TDHALATHE GLASSE DRINKAD "
+    "NECKASH FRODIPLOUNDISIMOUMERICASUN MEUTAETMEUNHANGUL DOFONONSHORT AMINIMA "
+    "MINGKALSIDDHAMARDNESSAHAPAKHARRED OMBOL B0ARRED BREREKANHEADINGWO FOR "
+    "RESILLOHALANTASIGN UD5 NGGEEAELAENGHAYANNA WAAJIBMEETORUAU "
+    "MARKVEMENT-DANCINGDANESE  WOLOSONG MASKRAKHANG SHAKERHIUCHUSNESTED "
+    "SERPINADAYANNAUKKAKHANEQUDAADA FACENIKAHITLJUDIJER2 GUNUEIGHT KUP TACKUP "
+    "STEPUP SIGNWORSHIPRA REPAAPEZIUMAUNTLETAULDRON BUTTONUP "
+    "MARKWDRIVERLYGISMAEAVY YAATAEAN ASUTORUDEAVOURRD DISKRD FACENAYANNA "
+    "STRIDESHAKINGNANCIALHI SIGNRDO RJE APLOUNUP HANDRANGKEPRARIETYATH OF ED "
+    "RICEWAZ EOHSEXTILERAYANNAECEMBER SLOWLYTAISYOU3 AREPAYMAIC "
+    "LBULANCESUKUUDOBUFFALOOUR OF RISIMOU9 CLOTH MENDUTRTHIAN OUT HUB2 WOMAN "
+    "MUQDAMJIBWAY ANGKUOQ7 NGUAN OPEN-O MUOMAEONTIEENBLACHKOWIFRUITCELSIUSOP "
+    "MARK KEFULAXOPHONEEULEUNGOVER ANCHEINAP0 WHEATTTHACANANGLONGKAYANNAFINAGH "
+    "0 SPEAROVER DUVILIK BYNAMIC FORKINGRIPPLE "
+    "CHEVRONKEUAERICHIEUCHTROLLEYUSSYERUTTILIK BREVIS YELLOW BERRIES3 "
+    "EIGHTBERGINETALL AAPHUTHAOONGONANANGLED KARO BAONG UEXPLOYAN URFACE "
+    "URGLASSPENGKALCAP TENISIBLE T ASHESRMUKHI  ISLANDF SASAKPAYEROKIVE OF "
+    "IMILAR F DAVIDOT NGOMITALIC PECTIVEOT REPHPEGERMAFATIGUE "
+    "OCLOCKORTIETHCANDRA ILLEANNCABINET7 NGGUAITON RA1 ARROWAN MARKJAIN "
+    "OMJARATI TCHFORKJAYANNARRECTUSJECTIVEWIGNYANCAYANNAURATIONTAYANNAJERAN "
+    "JIL DRUMBIG YUSORKHON FAYANNA26 EYYYPAYANNATA MARKOREVMA SYNAGMAIKHAHITY "
+    "GREENORCULUSUT TIMEPERVISEANGOLATCK LIMEPOVODNYSTERINGGENERALFLUENCE9 "
+    "NGGAAKUTAARUKYLISMAESTIVALCLEAVER3 MONTHKPAK "
+    "WAVILLAINKOMBUVATYSCAPEOLAPUK KOQNDONKORONISINNABAR "
+    "FLEXUSOKRYTIEANDERERALTILLOPRENKHACLOTHESLAGIOS "
+    "ROGRESSTHALIYALAK-050OCTOBERIC WANDOCTAGONCOASTERP PIEETICYCLESOGDIAN "
+    "OWILO SL SEGNOBARREKHPPROACHOFFICERST TUBEUYGHUR BORZAYAOF SOAPCLOSE EOX "
+    "BACKICOPTEROX LINEROKEN L2 OLIVEYA LAMPOMERANGPALLAWAPOMOFO  "
+    "LONSUMKKURUNIETNAHTATASHEELYAH LI TRYASKAPANSIOSPANESE YAYANNAKHA "
+    "YATGAYANNAFINAL YBOURINGON FACEYANMAR  MAELEEIFIED "
+    "ETSECHKABOARDERAMAKKANOW ALEF PLOPHUAM ALEFRY "
+    "FACEARADDOBOWTIEPBOARDDIESISROCKET TIKHYNACLESSICKLEBLINK "
+    "DICINEDOKMAIANCHORRENGTHAPYRUSAJANI PECIALVILIANAPLI MURNAMABISHOPDERMA "
+    "PALUTAPEAKS BURGERAEMMAE AGUNG MURDAASSINGVERTKAC CLEF LONGA "
+    "LELETUNGAAMARBUTADGEHOGN DASHSHAYIMVIRIAMSHMAAMRICORNREMEDYZHITSAASHGABOW "
+    "TIE KAPALAILUREN-NISFARSEOSMPLING MELIKN YANGOTTED-BOFILINSUZ ANOWMANON "
+    "KEYNOZHEKSAUCERNSANAQPOKOJIPOMMEENTEVMANTIIMUCHURCHNTOGENUUMISHCREASECRAYO"
+    "NCHEMA ONOCLEANUARYNOKHUKCHEIKHCUPPEDNOR BUCHESS CUMBER "
+    "QATANBEFILICHIRETCHO CHOBELOSOFOUNDPUFFEDCLOSETS "
+    "TENTOGONEKODHADHANIMALBANWA  EPOCHS SHOE EQUIDOCENCEOCIETYCODILE "
+    "DIPLIUYANNAQETANARIISAPQAMATSNKNOWNOITIC "
+    "PWATCHUZEIROBAFILISAADIYCKNESSRAVEL-PEPPERAPISMACARIK CASTLECATAWANEUME "
+    "AKEUAEBGBIEERAKLITATTERYATTIC BISCUSCALATEOSETTERKAANU SPLITAK-668NDA "
+    "TARBITSAPENCILDE DOGAKABATUP BOWNISTERRSHANAPIRIT OOMUUTRSIAN  "
+    "CARETNIRUGU RULERRSENICCEVITUNIZKO "
+    "RISEMEUPNAYACHADINCHAMKOANGKATOPITSANGBAT NCH "
+    "FRPICKETRACINGDAGGERRAAKANOPEN POPEN DAUTUMNBETAN OOPED SOUNAP9 MUENKE "
+    "PHOKAYAH UBLE XEUNYAMELLITELIGIONLIGON 2 NGGUI MAIMI HOOKKASAR 2 MBOO6 "
+    "NGGEEUREUTSTROFO-HIEUHEN GHEEUAENAKEYCAP-HIDETEMPUS SPATHIGHAMALIB "
+    "YAMLEVEL-3 NGGAIASMA WEORTHGHETTISPADESGHEUAEEMASTIHORT "
+    "IGOBLINSUCKEDEVENTHLONG EUGGAGEGORGON00-102GO NGUEENTH-INSHIPSURANG4 "
+    "DART4 DEERWRENCH4 KPEEINGAATLISHA HUR PALITIKIUCIBLEHUMBS EIGHTYGLAZ "
+    "HINHALETARGETUDARKA2 KPOOLLIPOPAASHAETOPBARGNANT LAMEDHYOMBO TE USETE "
+    "TSEERMATASTLERSUAEQTUXO NEOSTOLI LASTON7 NGONKRISISLD "
+    "MAPFRAMESUANGXIKNIFE IGGLESGANGIA3 GBEE3 HEEIYRENE STANCYSTANCE7 MBEEKY "
+    "WAYESTAN 7 KAPOU MBITILBOAT7 MBUU7 NDOOIN YEHKUSHU2LAFRONSSLESSET "
+    "KUTILLAGETRIKE 9 NJEEKTIKO 7 GUANLAMADH6 TREEENIKI 0 "
+    "NGGOGEDOLAKILLERTRAPLIIDE ESFORMEE-IEUNGYSTICKINDHI GEADALEU "
+    "MBUTAUROSTHAKKUGGLING0 NYONA-KARA0 NYUNTAU ROEPACT INAGMA-PIEUPSPLIT "
+    "KLITONTERON SPITALINCUNXX FACEA HAAMXIMIZEIEVAN GBASAQTEUWEN0 "
+    "NGGIENTIMAFORTIS1 WINE8 NYENMANYA WN BOWWN BOXSYOUWA8 NYANTUXEDOF "
+    "CLEFDVANCEDUCEUSHERMESIX OF HEISEITIMATEF MARE1 GBOO1 GOLDIXTY "
+    "PHIMAHUGURAMUMADDAHMADR MEYANNAE WAVEIYANNAMALGAMITULUMAGRANTSYNAFIHIBIT "
+    "5 WOOLMALL FWINDOWTIKENOHEUAEP8 MBEEITABLEAFFIX TURBAN1 NDEEFATHA "
+    "HASHKAFAMILYISSIMOHAM AIHAMEDHISSHARHAMILOISSANTAGOGUE5 MERIWO OF ME "
+    "DIEFF OF MECHIK1 HORNTAIKHUTIRYAKITHER HE MGOAESURAT NJAQHALF "
+    "HIRINGUTAMINGEXHALE8 HOOUHO HOISKAPI 4 NGENSIXTHS4 NJOOM BOARM "
+    "BULLHIVETEGS-PA SURED YAKASHED ICEWBERRYED CAPGRASP 4 MUANWORKER6 HUAN6 "
+    "GUEIYIN-DOSWORDSEXISTS4 NYINHINGE EAHMUKXYOOJFLUTEPEAN 8 KPEFEARN8 "
+    "GBUFSAAQRONOSPAATOBREW INNA PASEQ2-VASZHAINPATAKIMMERINTHU1 "
+    "WVIIMGBAFLAGSPCHA  LACA7 NEN7 MIN2 NJA2 HEN1 PEEANGELOTHALEYBUSBISAHILLU "
+    "2 NJUPEITHZIDI 8 FEEILVERYAMOKPEN O JERA2 HOOPEN-P1 TWO2 POO2 PTEYECEK2 "
+    "MBUROGOMWISADBORZYTSADI2 SEE MOOD1 YOOTTOCK2 MBEBOOTSFORCEBSTERTTORU1 "
+    "TEE2 MBA1-VASIRACYTUEUMIPEHA7 TWE KAWI7 NIN8 KPOYENAP2 KPA2 "
+    "KPIBLANKTSEEBWINDUBLAKOOUNCEURTLEIPINGWINJA7-"
+    "VASFLICTTSEREHIRIQHISTIHIUTHATIYA4 NDO6 GBARAIDAHOLAM4 TOO4 WUIATAF 4 "
+    "WOO4 VOOWLINETON AGVANGGURE HOLARHIMELRATERGULUSRASHAAWAY "
+    "WU318WUAETAVROSHOTELGORGIQUIRY6 KOOHOUR 32 JE CHWV4 KPU4 MON4 MBO4 LOO4 "
+    "LEERACHYAUTHS4 GBIZSEKAR-RUB CAPO4 ABB AMPS5 NDUHASE-HATHIHAYINHALA AR "
+    "AERIEENRIEULHAINU5 KEEZYGOS5 MBI "
+    "ALLORICEMHANNATINNETIPPIARERUHALQAASPERTILES4-VASHETHERDIONHI "
+    "ROTIGMA5-VASRCHIDRELAARELA "
+    "REIWATKAANREGIATMAAUARTARHADDAAPPLEHAALUASEIAPMUNK3 HINPLUTOPLUTA HAA "
+    "UTIESBENDE GORAPLHAU3 FOOGAMALPPAGE6 WEEBASSAGEAN 6-VASPONSEPOLI  "
+    "FUJIZILDEXING GAZE-BEITH3 HON ICONBHADHBHETHRITSITRIOLIKARAIHVUSXTRA- "
+    "ILUTTEGEHIKURUXW XWUTEUXPITER3 BOO7 FUA7 GBEGESH2GADOL7 HUNPI RO7 JEE3 "
+    "RA3HUTA TORSO DEKABAARUTHINGRILLA3 VEEQAAFUI KOIBACUSTRACKGOGI "
+    "TORCH3-VASHROOMI-RESVATOR3 WEI COATHUMP 6 SOO6 SIAICHON6 TA2ICRONBASA "
+    "PTUNEGHULU6 RA2BALAGTRAIFVIET GHNUTPEPETPSILIIARDSIAUDAVAAVU3 "
+    "NDIANNONNNAN -ALAFAAMAEEKEET-BEAMUBURUUBUTSEISMANIS "
+    "FYURIICUBEDEMBICNINTHAADHUSOLVEWBOATLOBE "
+    "SENTONGENTEGALILOMKAEESHIUGUSTVRIDOLOOP UDAATNIEUNEIDONNGUE  SARIEGL "
+    "HDAIC NGMANEGIONLOAN ALGARLEASEWFISHLEERIEOPLEEO-EUENUTOUBITOO BOX9-VASO "
+    "RUAO PLA-SIOSLAYARO KAIO ANGSADHENZEUMSAKINALLI "
+    "ALLEY-RINGSALADCROWNNSYONNSUAENSIEESATA "
+    "ENANOSAUILEMLJACTRICNUENGENJETNTXIVENENGOTERIA UNADATUSNTHA A "
+    "YUESPINEUMMERMSHAEMROCKUNGBAMPIRESHOOKSILA3MPAREVZMET TELUMALONMUOY "
+    "SHIMAADULTMAQAFMUCH DSMANMI ROSHTINDKAR "
+    "MISRAMETRYDLINGWAQFAMINGOSICLEAGMA "
+    "MIEUMWAAVUDOTS-"
+    "MELONAEMAEMEEMUMEIZIAEPENDWICHAEREEMENOEMEPETMETEGMMOTHUNOO LURALEATH "
+    "LWAY "
+    "SKATEEBALLDELTANCORADENCEDEPTHUKARADBOATLOURENENOENEMKANASHINEGARDESTYNA "
+    "POSHARUMADYAMAI KMAIZEDHAM E GEEWATTOMAALAACHKAUNITYM "
+    "RAMMAAEHENDEPSHANGEAGLE TABSSHAR2SHARANADA MACUSNABLACHULASUKUNCIEUCF "
+    "COWRUSH CHUTECCEPT1 FANOMBIEEYYAL0 MANAMEKH8 NWAK-020RYASOTUUMUSTNUTOLD "
+    "XRRITOKO LA9 MUNITUALCANUSCEREKSTORMROWN F SOWYIZETF "
+    "EWEKNOBSUQUETCHADACAUSEEURAELATIKRUHUAKARORRUDAA9 DEE0-VASOQPEN9 KUAJANG "
+    "WIANGCAUDA8 RO2EVAL 1 DWEKHAPHEUAEMCHOOLCHOOIRUMP-CHIME0 "
+    "OILRULAIKESH2KERETCHESTCHERYKBALL9 MENU U U0 DWOERKHA8 "
+    "MANCCOLICAKESCLUBSJUDGECAKRAURITYLAGUSESHE3JUDULALOG "
+    "LABOROPLETLABATVITAEFAIHUOBYLAOCADO0 BEELAMDA8-VASESO E9 WVE9 "
+    "WVAJERVISURYAISTLE0 DOO0 JOO0 HEESTARTKUSMACKAGEKURONURINE9 YEEET TUOJKI "
+    "8 NANCLONECALYAORUTOOKARACECAK9 NDEOKEE 9 NDACAANGITHI 9 "
+    "PU2JUEUIOSTERALPHA0 GBOCECEKCLIFF9 NUNL-JUZ9 NONL NET0 GEE0 "
+    "HANCKTIEKWAENFAAFURUISROOKVEYZRRORRROISHYATUKIZETATURUWAIRWAHAYEUXUNAVWAET"
+    "WAAKUNAHSINKRPSEVEUXSIKIRIFYURUSVESTZATAZZY TZELZIZ2VOS "
+    "YUDHRUSISOKARUTUYUKUZELOZAYNUTANSA-ITAXIUTTYTFONXEYNZIETXEIAWAW "
+    "SUABVIDAUON SLURULU SUNGRSO-RT TRUNARUNGROA "
+    "YWAASELFWDERSEEVSEENWULUROARUHURRUKUVIYOVEDESEYEVUEQHEYSHEENHEEPHEROHERUHE"
+    "YNHEYTHHWA2 YAHID HIINHILDHAVEHAYNHWAA2 SOHUEN2 RO2 QOHSHUHWAH2 "
+    "PEIANOIARA2 NOHMI 2 VIHOKEHOM HOPHHOSTHSDA3 MUFFINFIRIFITA3 PA3 MI3 ME3 "
+    "TAEZZO3 YU3 LE3 RIFAIBFASTFEEMFETHFEUQGIBAGIDAGIEAGIR2GOALGORTGROMGRU "
+    "GUINFWAA3 L33 KU3 JO3 JEGAMEGAML3 EEGEDEGGWS3 A3GHOMKMA KOBAKOETKOKEKOKO1 "
+    "KU1 KIKWAA1 IN1 HA1 GA1 DULAAN1 DO1 RAKANGKAPHKCET1 QI1 "
+    "POKICKLFERLFIELIFULIUMLIWNLOLL1 DAKALIILUYIK HINORINY 2 L22 KAIFAT2 "
+    "BUIGERIITOJOT JEONJIIM1 YI1 VU1 SU1 SI1 SAKAAFKAD3KAKOIPODIQAAISI "
+    "1358ARGIAROO7 JAATIMAPAQ7 LUAPON7 KIARA36 NA6 RU6 QABASH6 POBAYI6 LA6 L66 "
+    "JOATYA7 EIAULA7 DD7 DA7 BE6 WU6 SEBAGSBALD8 QE8 PI8 KO8 JIAAMU8 GU8 "
+    "FOAFEL8 EN9 JA9 TA9 TO9 TU9 SO9 SI9 SE9 PI9 PAA IEA-HA8 WE8 SUAACUALTA7 "
+    "VO7 TIAMLA7 REAN X8 DU8 BOAILM7 ZAALDAEAAE5 FE5 FADZHA5 DE5 BB5 AU5 AN5 "
+    "A2EANSEEEEDGER5 LIDIM2EENG5 JU5 IN5 GI4 FI4 NE4 L44 KE4 DO4 WAEENUEETA4 "
+    "ZEEHEH4 WIEIPTEIRTEIWS4 TU4 TE6 DIBUNGBUOYCANOCASECAYNCHAUCHEH6 "
+    "HIBERDBETH6 JE6 HEBOOKBORE6 FU5 VACWAA5 TODAGSDAIR5 TEDDAKDDHI5 OODEAD5 "
+    "NU5 MOCKEN5 WE5 WACOONCOREHUVA5 VECRETNDAPPAWN0 "
+    "BINCERPEEPNAM2NHAYOXIANGA2 OHMNET NEO -UM NDUEPLUMMUASPOLOMPET0 "
+    "NIPLUGPRIL0 PUMMU2QEF NAG NAAUPEUX0 HO0 JUPHABPHIN0 "
+    "KOMVATMUINOBATOFUMOENGODLEOONEOBROO-YOOOTH R SOJI ONA  "
+    "WEBNRUAOUBTNPEANOWC-ONE-RAYNJAMORAXNWAANUTSORIINUNGNTOCNTAANSUB0 ZO C "
+    "DRAFE0 SA0 YEQOPAMFAALUMNMARUMESOMARYREIAMIIM028BMIINMLYARGU2LOVOLUIS0 "
+    "WIMEARQHAU0 RADE6DA2UOPZUP8 ID70D42WAU5 "
+    "UCYACWIWOQUEHUEZ8F04-"
+    "0UDYA7AOMSREX9819E3UMXDJAE80DZEVOKAUMAUJAWXZOOZJEB89B576-"
+    "0620AZUVAUAYD6D7ZORQ00PUQQIGQIF7 "
+    "OQARPOQQUFVNOQOTQOFCA9550557BXGCAHBUD5B68 "
+    "AUQAAG-CAIVOYAL2BAU72C5-0VUUBIBIMNYOT18D15514DIWRMU Y00I-IHOJHOX0 E0 "
+    "UL000-0LJE04A0B9LFA1 XSUUJHAK00121JAH1-21-0JEUKUEKAQSIIFOMFLYO "
+    "YOAYXEHTUJFAJOEH3 IFUEES-OIX4 "
+    "EF8CF143-0XAUEZHEYKXAN305X0031CXWVXWG25320BNII-TE3 "
+    "DTJE2DD2-0HHANIB40488309713938291716494B4E1D1AQWR7R0C0D0VDW099F39092G9G3";
+uint8_t UnicodeNameToCodepointIndex_[239405] = {
+    0x00, 0x05, 0xc0, 0x00, 0x6b, 0x15, 0xc0, 0x00, 0x95, 0x12, 0xc0, 0x00,
+    0xdd, 0x06, 0xc0, 0x01, 0x03, 0x14, 0xc0, 0x01, 0x27, 0x18, 0xc0, 0x01,
+    0x41, 0x16, 0xc0, 0x01, 0x57, 0x03, 0xc0, 0x01, 0x7b, 0x04, 0xc0, 0x01,
+    0xd8, 0x0e, 0xc0, 0x01, 0xfe, 0x17, 0xc0, 0x02, 0x22, 0x0a, 0xc0, 0x02,
+    0x3f, 0x0b, 0xc0, 0x02, 0x5d, 0x19, 0xc0, 0x02, 0x7d, 0x08, 0xc0, 0x02,
+    0x95, 0x0f, 0xc0, 0x02, 0xb1, 0x0d, 0xc0, 0x02, 0xd1, 0x10, 0xc0, 0x02,
+    0xef, 0x1a, 0xc0, 0x03, 0x15, 0x07, 0xc0, 0x03, 0x2d, 0x09, 0xc0, 0x03,
+    0x84, 0x11, 0xc0, 0x03, 0xa6, 0x1c, 0xc0, 0x04, 0x0a, 0x0c, 0xc0, 0x04,
+    0x2c, 0x42, 0x00, 0xe3, 0xc0, 0x04, 0x44, 0x1b, 0x40, 0x04, 0x5a, 0x03,
+    0xc0, 0x04, 0x6e, 0x43, 0x30, 0x23, 0xc0, 0x04, 0x9d, 0x0a, 0xc0, 0x04,
+    0xaf, 0x14, 0xc0, 0x04, 0xcb, 0x11, 0xc0, 0x04, 0xea, 0x0e, 0xc0, 0x05,
+    0x25, 0x0b, 0xc0, 0x05, 0x37, 0x17, 0xc0, 0x05, 0x4c, 0x07, 0xc0, 0x05,
+    0x72, 0x1b, 0x40, 0x05, 0x8a, 0x07, 0xc0, 0x05, 0xa2, 0x0b, 0xc0, 0x05,
+    0xe9, 0x16, 0xc0, 0x06, 0x07, 0x03, 0xc0, 0x06, 0x24, 0x0d, 0xc0, 0x06,
+    0x60, 0x0e, 0xc0, 0x06, 0x6e, 0x0a, 0xc0, 0x06, 0x7e, 0x05, 0xc0, 0x06,
+    0x9a, 0x10, 0xc0, 0x06, 0xaf, 0x11, 0xc0, 0x06, 0xbf, 0x42, 0x00, 0xe3,
+    0xc0, 0x06, 0xf1, 0x1b, 0xc0, 0x06, 0xfb, 0x12, 0xc0, 0x07, 0x0f, 0x17,
+    0xc0, 0x07, 0x2e, 0x0f, 0xc0, 0x07, 0x5a, 0x19, 0xc0, 0x07, 0x68, 0xcc,
+    0x85, 0x35, 0x01, 0x4e, 0x60, 0x14, 0xc0, 0x07, 0x78, 0x0e, 0xc0, 0x07,
+    0x8a, 0x0b, 0xc0, 0x07, 0x92, 0x03, 0xc0, 0x07, 0xbb, 0x11, 0xc0, 0x07,
+    0xef, 0x07, 0xc0, 0x08, 0x1d, 0x17, 0xc0, 0x08, 0x3f, 0x4f, 0x62, 0x1f,
+    0xc0, 0x08, 0x5b, 0x0a, 0x40, 0x08, 0x79, 0x07, 0xc0, 0x08, 0x87, 0x0b,
+    0xc0, 0x08, 0xbb, 0x14, 0xc0, 0x08, 0xf9, 0x11, 0xc0, 0x09, 0x13, 0x17,
+    0xc0, 0x09, 0x5f, 0x03, 0xc0, 0x09, 0x71, 0xc2, 0xe6, 0x9f, 0x0f, 0xa6,
+    0x01, 0xcf, 0x60, 0xb7, 0x0f, 0xcf, 0x60, 0x07, 0xc0, 0x09, 0x96, 0x0b,
+    0xc0, 0x09, 0xd2, 0x11, 0xc0, 0x0a, 0x02, 0x03, 0xc0, 0x0a, 0x44, 0x17,
+    0xc0, 0x0a, 0x6c, 0xc9, 0xa9, 0x51, 0x0f, 0xcc, 0x78, 0x03, 0xc0, 0x0a,
+    0x94, 0x07, 0xc0, 0x0a, 0xa6, 0x0b, 0xc0, 0x0a, 0xbc, 0x11, 0xc0, 0x0a,
+    0xe4, 0x42, 0x03, 0x66, 0x40, 0x0a, 0xee, 0x03, 0xc0, 0x0a, 0xfa, 0x02,
+    0xc0, 0x0b, 0x34, 0x17, 0xc0, 0x0b, 0x40, 0x0a, 0xc0, 0x0b, 0x56, 0x11,
+    0xc0, 0x0b, 0x72, 0x14, 0xc0, 0x0b, 0x9e, 0x07, 0xc0, 0x0b, 0xae, 0x0b,
+    0xc0, 0x0b, 0xcc, 0x19, 0x40, 0x0c, 0x04, 0x14, 0xc0, 0x0c, 0x14, 0xc2,
+    0x24, 0xe2, 0x0f, 0xd4, 0x99, 0x06, 0xc0, 0x0c, 0x36, 0x0e, 0xc0, 0x0c,
+    0x58, 0x17, 0xc0, 0x0c, 0x80, 0xc7, 0x2e, 0x21, 0x01, 0x38, 0x43, 0x00,
+    0x0c, 0x92, 0x10, 0xc0, 0x0c, 0x96, 0x15, 0xc0, 0x0c, 0xb9, 0x16, 0xc0,
+    0x0c, 0xcd, 0xc7, 0xc0, 0xa5, 0x01, 0x32, 0x91, 0x44, 0xdf, 0xff, 0xc0,
+    0x0c, 0xd9, 0x05, 0xc0, 0x0c, 0xfb, 0x12, 0xc0, 0x0d, 0x19, 0xcb, 0x91,
+    0xe6, 0x01, 0x0a, 0x69, 0x18, 0xc0, 0x0d, 0x27, 0x0f, 0xc0, 0x0d, 0x33,
+    0xcb, 0x90, 0xff, 0x00, 0x30, 0x59, 0x07, 0xc0, 0x0d, 0x49, 0xc5, 0xd8,
+    0x44, 0x0f, 0xcf, 0x70, 0x11, 0xc0, 0x0d, 0x55, 0x0e, 0xc0, 0x0d, 0x95,
+    0x03, 0xc0, 0x0d, 0xa3, 0x0b, 0xc0, 0x0d, 0xd5, 0x07, 0xc0, 0x0e, 0x01,
+    0x17, 0xc0, 0x0e, 0x2a, 0x14, 0xc0, 0x0e, 0x65, 0x1b, 0xc0, 0x0e, 0x75,
+    0x49, 0xb4, 0xc7, 0x40, 0x0e, 0x81, 0x11, 0xc0, 0x0e, 0xaf, 0x07, 0xc0,
+    0x0e, 0xed, 0x0b, 0xc0, 0x0f, 0x22, 0x1b, 0xc0, 0x0f, 0x5b, 0x03, 0xc0,
+    0x0f, 0x6d, 0xcd, 0x7f, 0x73, 0x01, 0x08, 0xa1, 0xc4, 0x0f, 0x0c, 0x0f,
+    0xcc, 0xc9, 0x17, 0x40, 0x0f, 0x9a, 0x12, 0xc0, 0x0f, 0xa6, 0x10, 0xc0,
+    0x0f, 0xc2, 0xc7, 0x57, 0x8b, 0x01, 0x30, 0x13, 0x00, 0x0f, 0xdc, 0xc5,
+    0x19, 0xdd, 0x01, 0x32, 0x29, 0x48, 0xbe, 0x5a, 0x40, 0x0f, 0xe0, 0x07,
+    0xc0, 0x0f, 0xec, 0x11, 0xc0, 0x10, 0x10, 0x03, 0xc0, 0x10, 0x3e, 0x0b,
+    0xc0, 0x10, 0x68, 0x1b, 0xc0, 0x10, 0x92, 0xcb, 0x96, 0x3d, 0x01, 0x05,
+    0xa1, 0x17, 0x40, 0x10, 0xa2, 0x10, 0xc0, 0x10, 0xb8, 0x42, 0x00, 0x06,
+    0xc0, 0x10, 0xe4, 0x43, 0x00, 0x89, 0xc0, 0x10, 0xf0, 0x0f, 0xc0, 0x11,
+    0x00, 0xce, 0x72, 0xc6, 0x0f, 0x9f, 0x71, 0xd3, 0x42, 0xc7, 0x0f, 0xc8,
+    0xf8, 0x11, 0xc0, 0x11, 0x10, 0x0a, 0xc0, 0x11, 0x2a, 0x0b, 0xc0, 0x11,
+    0x3f, 0x03, 0xc0, 0x11, 0x5b, 0x07, 0xc0, 0x11, 0x7d, 0x14, 0x40, 0x11,
+    0x91, 0x0e, 0xc0, 0x11, 0xa1, 0x11, 0xc0, 0x11, 0xba, 0x03, 0xc0, 0x11,
+    0xe4, 0x14, 0xc0, 0x12, 0x0a, 0x17, 0xc0, 0x12, 0x1c, 0x07, 0xc0, 0x12,
+    0x32, 0x0b, 0x40, 0x12, 0x46, 0x0b, 0xc0, 0x12, 0x6a, 0x07, 0xc0, 0x12,
+    0x8b, 0x11, 0xc0, 0x12, 0xbd, 0x03, 0xc0, 0x12, 0xec, 0x17, 0xc0, 0x13,
+    0x2d, 0x43, 0x15, 0xe9, 0xc0, 0x13, 0x3d, 0x47, 0xca, 0x45, 0x40, 0x13,
+    0x47, 0x10, 0xc0, 0x13, 0x6b, 0x07, 0xc0, 0x13, 0x77, 0x03, 0xc0, 0x13,
+    0x84, 0x0a, 0xc0, 0x13, 0xa0, 0x0b, 0xc0, 0x13, 0xbe, 0x11, 0xc0, 0x13,
+    0xdf, 0xc5, 0xd4, 0x02, 0x01, 0x5f, 0x18, 0x07, 0xc0, 0x13, 0xeb, 0x03,
+    0xc0, 0x14, 0x20, 0x11, 0xc0, 0x14, 0x4f, 0x56, 0x30, 0x4e, 0xc0, 0x14,
+    0x74, 0x17, 0xc0, 0x14, 0x8e, 0x45, 0x60, 0x4f, 0xc0, 0x14, 0xa4, 0x43,
+    0xc2, 0x7e, 0xc0, 0x14, 0xd3, 0x0b, 0x40, 0x14, 0xf9, 0x47, 0xc0, 0xb3,
+    0xc0, 0x15, 0x05, 0xd3, 0x46, 0x6a, 0x01, 0x19, 0x39, 0xc2, 0x00, 0xbf,
+    0x01, 0x15, 0xd9, 0xc4, 0xe4, 0x5b, 0x0f, 0xd3, 0xd8, 0x0f, 0xc0, 0x15,
+    0x11, 0x03, 0xc0, 0x15, 0x1f, 0x09, 0xc0, 0x15, 0x32, 0x1a, 0xc0, 0x15,
+    0x3c, 0x48, 0xbd, 0x72, 0xc0, 0x15, 0x4a, 0x0e, 0xc0, 0x15, 0x7c, 0x44,
+    0x00, 0x2d, 0xc0, 0x15, 0x90, 0x10, 0xc0, 0x15, 0x9a, 0xcb, 0x8f, 0xcb,
+    0x01, 0x1e, 0x79, 0x14, 0xc0, 0x15, 0xb9, 0x42, 0x00, 0xe3, 0xc0, 0x15,
+    0xcb, 0x15, 0xc0, 0x15, 0xd5, 0x17, 0xc0, 0x15, 0xe1, 0xcc, 0x81, 0xbd,
+    0x0f, 0xa7, 0x39, 0xcd, 0x76, 0x5c, 0x0f, 0x99, 0x91, 0xc2, 0x0c, 0x43,
+    0x0f, 0xa2, 0x0b, 0x00, 0x15, 0xed, 0xd0, 0x57, 0xb2, 0x01, 0x70, 0x70,
+    0x17, 0xc0, 0x15, 0xf7, 0x11, 0xc0, 0x16, 0x13, 0x14, 0xc0, 0x16, 0x2f,
+    0x07, 0xc0, 0x16, 0x3f, 0x0b, 0xc0, 0x16, 0x62, 0xc4, 0xe0, 0x07, 0x0f,
+    0xa3, 0xd9, 0x03, 0xc0, 0x16, 0x6c, 0x0e, 0x40, 0x16, 0x78, 0xc5, 0xc8,
+    0x6f, 0x0f, 0xcd, 0x51, 0x14, 0xc0, 0x16, 0x86, 0x42, 0x02, 0x10, 0xc0,
+    0x16, 0xa2, 0xc2, 0x09, 0x66, 0x0f, 0xcc, 0x49, 0xc7, 0xc7, 0xf9, 0x0f,
+    0xb7, 0x11, 0x10, 0xc0, 0x16, 0xae, 0x12, 0xc0, 0x16, 0xc4, 0x0e, 0xc0,
+    0x16, 0xda, 0x17, 0xc0, 0x16, 0xea, 0x05, 0xc0, 0x16, 0xf4, 0x04, 0xc0,
+    0x16, 0xfe, 0xc7, 0xb5, 0x83, 0x01, 0x09, 0x31, 0x43, 0x00, 0x5f, 0xc0,
+    0x17, 0x10, 0x09, 0xc0, 0x17, 0x1a, 0xc8, 0xad, 0x5d, 0x0f, 0xaa, 0x49,
+    0xce, 0x71, 0x76, 0x0f, 0x9f, 0x11, 0xc3, 0x02, 0x3b, 0x0f, 0x9b, 0x11,
+    0x9a, 0x0f, 0xa0, 0x11, 0x15, 0xc0, 0x17, 0x26, 0xcb, 0x8a, 0xd6, 0x0f,
+    0xa2, 0x60, 0xd0, 0x5c, 0x12, 0x0f, 0xc8, 0x81, 0x48, 0xb8, 0x6a, 0xc0,
+    0x17, 0x32, 0x50, 0x58, 0x72, 0xc0, 0x17, 0x44, 0x4a, 0x17, 0xa1, 0xc0,
+    0x17, 0x6c, 0x07, 0xc0, 0x17, 0x8c, 0xc5, 0xdc, 0x1d, 0x0f, 0xce, 0xf8,
+    0x03, 0xc0, 0x17, 0x9e, 0x17, 0xc0, 0x17, 0xb4, 0x11, 0xc0, 0x17, 0xc6,
+    0xc4, 0xe2, 0x9b, 0x0f, 0xa2, 0xb1, 0xd2, 0x4d, 0x45, 0x0f, 0xcf, 0x48,
+    0xc6, 0xd1, 0x75, 0x01, 0x35, 0xd9, 0x03, 0xc0, 0x17, 0xd2, 0x46, 0x2c,
+    0xb4, 0xc0, 0x17, 0xe4, 0xcc, 0x01, 0xbb, 0x00, 0x01, 0x10, 0x0b, 0xc0,
+    0x17, 0xee, 0x07, 0xc0, 0x17, 0xf8, 0xcb, 0x94, 0xa6, 0x0f, 0xcb, 0x89,
+    0xc4, 0xe4, 0x2f, 0x0f, 0xd4, 0x00, 0x10, 0xc0, 0x18, 0x0a, 0xc4, 0x26,
+    0xba, 0x01, 0x37, 0x59, 0x14, 0xc0, 0x18, 0x26, 0x12, 0xc0, 0x18, 0x48,
+    0x06, 0xc0, 0x18, 0x54, 0x17, 0xc0, 0x18, 0x60, 0x0f, 0xc0, 0x18, 0x6c,
+    0x0e, 0xc0, 0x18, 0x7b, 0xc4, 0xc7, 0xcb, 0x0f, 0x99, 0xa9, 0x96, 0x0f,
+    0xa0, 0x42, 0x00, 0x18, 0x87, 0x58, 0x25, 0x43, 0xc0, 0x18, 0x90, 0x48,
+    0x91, 0xff, 0xc0, 0x18, 0x9a, 0x47, 0x08, 0x5b, 0x40, 0x18, 0xe8, 0x07,
+    0xc0, 0x19, 0x22, 0x03, 0xc0, 0x19, 0x3c, 0xc4, 0xcc, 0x07, 0x01, 0x37,
+    0x51, 0x0b, 0xc0, 0x19, 0x50, 0x11, 0xc0, 0x19, 0x71, 0xcc, 0x85, 0x11,
+    0x0f, 0x9c, 0x20, 0x17, 0xc0, 0x19, 0x83, 0xc2, 0x00, 0x03, 0x0f, 0xcc,
+    0x01, 0x1b, 0xc0, 0x19, 0x8f, 0x11, 0xc0, 0x19, 0x9b, 0x07, 0xc0, 0x19,
+    0xb3, 0xc5, 0x72, 0xa4, 0x0f, 0xcc, 0xba, 0x00, 0x19, 0xbf, 0x05, 0xc0,
+    0x19, 0xc5, 0x0f, 0xc0, 0x19, 0xcf, 0x17, 0xc0, 0x19, 0xe3, 0xc4, 0xe0,
+    0x13, 0x01, 0x35, 0x81, 0x10, 0xc0, 0x19, 0xf5, 0x14, 0xc0, 0x1a, 0x1b,
+    0x0e, 0xc0, 0x1a, 0x2d, 0x42, 0x01, 0x25, 0xc0, 0x1a, 0x3c, 0x99, 0x0f,
+    0xa0, 0x23, 0x00, 0x1a, 0x46, 0x12, 0xc0, 0x1a, 0x4c, 0xc2, 0x00, 0xfe,
+    0x0f, 0xcf, 0x29, 0xc2, 0x00, 0x74, 0x0f, 0xd4, 0xc8, 0x0b, 0xc0, 0x1a,
+    0x56, 0x11, 0xc0, 0x1a, 0x62, 0xd1, 0x50, 0xac, 0x01, 0x1c, 0xd1, 0x03,
+    0x40, 0x1a, 0x7d, 0x42, 0x02, 0xd3, 0xc0, 0x1a, 0x8f, 0xc7, 0xc8, 0xc4,
+    0x0f, 0x9e, 0xcb, 0x00, 0x1a, 0x99, 0xc4, 0x78, 0xfe, 0x0f, 0x9d, 0x30,
+    0x42, 0x00, 0x15, 0xc0, 0x1a, 0x9f, 0x48, 0xb9, 0x0a, 0xc0, 0x1a, 0xab,
+    0x14, 0xc0, 0x1a, 0xbd, 0x12, 0xc0, 0x1a, 0xcb, 0xc7, 0xb3, 0x73, 0x01,
+    0x10, 0xd9, 0xc6, 0xcc, 0x53, 0x0f, 0xca, 0x91, 0xc9, 0xab, 0x52, 0x0f,
+    0xcb, 0x48, 0xca, 0xa3, 0x8c, 0x0f, 0xaa, 0x41, 0xc3, 0x20, 0xac, 0x01,
+    0x35, 0x99, 0x42, 0x00, 0x84, 0xc0, 0x1a, 0xdb, 0x42, 0x01, 0xdd, 0x40,
+    0x1a, 0xe7, 0x42, 0x05, 0xc0, 0xc0, 0x1a, 0xf3, 0xca, 0xa5, 0x62, 0x01,
+    0x19, 0x69, 0x47, 0xba, 0x9b, 0xc0, 0x1a, 0xff, 0xc5, 0xdd, 0xfd, 0x0f,
+    0x98, 0x00, 0x42, 0x00, 0x30, 0xc0, 0x1b, 0x23, 0xc5, 0x65, 0x68, 0x01,
+    0x18, 0x9b, 0x00, 0x1b, 0x2f, 0xcb, 0x91, 0x20, 0x0f, 0xd5, 0x09, 0x03,
+    0xc0, 0x1b, 0x35, 0x15, 0xc0, 0x1b, 0x3d, 0x42, 0x02, 0x2f, 0xc0, 0x1b,
+    0x49, 0xc5, 0xc5, 0x38, 0x01, 0x35, 0xc9, 0x05, 0xc0, 0x1b, 0x59, 0x14,
+    0xc0, 0x1b, 0x63, 0x07, 0xc0, 0x1b, 0x6f, 0xc3, 0x92, 0x91, 0x01, 0x5f,
+    0x91, 0xce, 0x6b, 0xaa, 0x01, 0x5f, 0xd9, 0xc4, 0xe0, 0xff, 0x0f, 0xc9,
+    0x98, 0x10, 0xc0, 0x1b, 0x7b, 0x42, 0x00, 0xbc, 0xc0, 0x1b, 0x8d, 0x1a,
+    0xc0, 0x1b, 0x99, 0x06, 0xc0, 0x1b, 0xab, 0xd1, 0x51, 0xde, 0x0f, 0xaf,
+    0xf1, 0x46, 0xc7, 0x36, 0x40, 0x1b, 0xb7, 0x07, 0xc0, 0x1b, 0xc9, 0x03,
+    0xc0, 0x1b, 0xdb, 0x14, 0xc0, 0x1b, 0xfb, 0x11, 0xc0, 0x1c, 0x09, 0x17,
+    0xc0, 0x1c, 0x15, 0xca, 0xa1, 0x0c, 0x0f, 0xde, 0x2a, 0x00, 0x1c, 0x27,
+    0x0e, 0xc0, 0x1c, 0x2b, 0x42, 0x00, 0x33, 0xc0, 0x1c, 0x35, 0x10, 0xc0,
+    0x1c, 0x41, 0xc6, 0xd0, 0x7f, 0x01, 0x37, 0xa9, 0xc9, 0xb1, 0xe5, 0x01,
+    0x32, 0x81, 0x16, 0xc0, 0x1c, 0x4d, 0x48, 0x69, 0x46, 0xc0, 0x1c, 0x5c,
+    0xc7, 0xc6, 0x01, 0x0f, 0x9d, 0xb9, 0xd1, 0x50, 0xdf, 0x0f, 0x9b, 0xb1,
+    0xc2, 0x00, 0x2c, 0x0f, 0xcb, 0xd9, 0x45, 0x73, 0xa7, 0x40, 0x1c, 0x78,
+    0x17, 0xc0, 0x1c, 0x84, 0x0b, 0xc0, 0x1c, 0x93, 0xc8, 0xbc, 0xe2, 0x0f,
+    0xb7, 0xc8, 0x11, 0xc0, 0x1c, 0x9f, 0x07, 0xc0, 0x1c, 0xa7, 0x0b, 0xc0,
+    0x1c, 0xb7, 0x03, 0x40, 0x1c, 0xc3, 0x14, 0xc0, 0x1c, 0xcf, 0x03, 0xc0,
+    0x1c, 0xdb, 0x11, 0xc0, 0x1c, 0xf5, 0x0b, 0xc0, 0x1d, 0x19, 0xcd, 0x7f,
+    0xa7, 0x01, 0x4f, 0x11, 0xc3, 0x2d, 0xa5, 0x0f, 0xa0, 0x88, 0x11, 0xc0,
+    0x1d, 0x2f, 0x03, 0xc0, 0x1d, 0x3b, 0x14, 0xc0, 0x1d, 0x47, 0xc4, 0xdc,
+    0xf0, 0x0f, 0x9f, 0x5a, 0x00, 0x1d, 0x5d, 0xcb, 0x90, 0x18, 0x0f, 0xc9,
+    0x39, 0x42, 0x00, 0x27, 0xc0, 0x1d, 0x63, 0x03, 0x40, 0x1d, 0x7e, 0x17,
+    0xc0, 0x1d, 0x8a, 0x43, 0x1c, 0x85, 0xc0, 0x1d, 0x96, 0xde, 0x0f, 0x40,
+    0x0f, 0xa8, 0xe1, 0x46, 0xcf, 0xdd, 0xc0, 0x1d, 0xa8, 0x05, 0xc0, 0x1d,
+    0xdf, 0x42, 0x00, 0x4b, 0xc0, 0x1d, 0xeb, 0xc6, 0x55, 0xf6, 0x01, 0x06,
+    0x01, 0x4b, 0x9a, 0x47, 0xc0, 0x1d, 0xfb, 0x46, 0xc9, 0x58, 0x40, 0x1e,
+    0x07, 0x03, 0xc0, 0x1e, 0x25, 0xc2, 0x02, 0xfb, 0x0f, 0xcc, 0x88, 0x0f,
+    0xc0, 0x1e, 0x31, 0x10, 0xc0, 0x1e, 0x3d, 0x42, 0x00, 0x2c, 0xc0, 0x1e,
+    0x49, 0x4b, 0x90, 0xb2, 0x40, 0x1e, 0x55, 0x07, 0xc0, 0x1e, 0x6d, 0x03,
+    0xc0, 0x1e, 0x7d, 0xcd, 0x77, 0x7a, 0x01, 0x11, 0x13, 0x00, 0x1e, 0x8f,
+    0x0b, 0xc0, 0x1e, 0x95, 0xd4, 0x3e, 0x58, 0x0f, 0xa5, 0x31, 0x11, 0x40,
+    0x1e, 0xa4, 0x43, 0x00, 0x67, 0xc0, 0x1e, 0xba, 0x90, 0x01, 0x30, 0x4b,
+    0x00, 0x1e, 0xca, 0x48, 0xb9, 0xa2, 0xc0, 0x1e, 0xe9, 0xc6, 0xb7, 0x74,
+    0x01, 0x13, 0xdb, 0x00, 0x1e, 0xfb, 0x42, 0x0e, 0xa6, 0xc0, 0x1e, 0xff,
+    0x42, 0x15, 0x13, 0xc0, 0x1f, 0x11, 0x15, 0x40, 0x1f, 0x1d, 0x0b, 0xc0,
+    0x1f, 0x29, 0x03, 0xc0, 0x1f, 0x33, 0xcc, 0x71, 0x94, 0x0f, 0xb5, 0x60,
+    0xc8, 0xb9, 0x52, 0x01, 0x02, 0x99, 0x03, 0xc0, 0x1f, 0x3f, 0xc5, 0xd4,
+    0x2a, 0x0f, 0x9e, 0x50, 0x0b, 0xc0, 0x1f, 0x49, 0x11, 0xc0, 0x1f, 0x59,
+    0x07, 0xc0, 0x1f, 0x75, 0xca, 0x9b, 0xbc, 0x0f, 0xa7, 0xf8, 0x03, 0xc0,
+    0x1f, 0x94, 0x17, 0x40, 0x1f, 0xa5, 0x10, 0xc0, 0x1f, 0xb8, 0xc2, 0x00,
+    0x3b, 0x01, 0x36, 0x7b, 0x00, 0x1f, 0xce, 0x15, 0xc0, 0x1f, 0xd4, 0xc7,
+    0xc7, 0xba, 0x01, 0x16, 0xa3, 0x00, 0x1f, 0xe0, 0x0e, 0xc0, 0x1f, 0xe6,
+    0x89, 0x0f, 0xa0, 0xb3, 0x00, 0x1f, 0xf6, 0x87, 0x0f, 0xcb, 0x38, 0x42,
+    0x00, 0xcc, 0xc0, 0x1f, 0xfa, 0x09, 0xc0, 0x20, 0x0a, 0x14, 0xc0, 0x20,
+    0x17, 0x4a, 0xa6, 0x5c, 0xc0, 0x20, 0x2b, 0x0e, 0xc0, 0x20, 0x50, 0x4b,
+    0x8e, 0x55, 0xc0, 0x20, 0x5a, 0xc5, 0xdd, 0xda, 0x0f, 0xa7, 0x31, 0xc7,
+    0x7b, 0xdd, 0x0f, 0xa6, 0x71, 0xc8, 0xb9, 0xba, 0x0f, 0xa1, 0xf1, 0x10,
+    0x40, 0x20, 0x7c, 0x16, 0xc0, 0x20, 0x88, 0x17, 0xc0, 0x20, 0x98, 0x44,
+    0x00, 0x28, 0xc0, 0x20, 0xb6, 0x15, 0xc0, 0x20, 0xc0, 0x12, 0xc0, 0x20,
+    0xd0, 0xcf, 0x66, 0xfc, 0x0f, 0xad, 0x49, 0xcd, 0x79, 0xf7, 0x0f, 0xa7,
+    0xf1, 0x45, 0x9f, 0x92, 0xc0, 0x20, 0xdc, 0xc4, 0xe4, 0x23, 0x0f, 0xa1,
+    0x48, 0x14, 0xc0, 0x20, 0xeb, 0x10, 0xc0, 0x21, 0x0e, 0x03, 0xc0, 0x21,
+    0x2c, 0x15, 0xc0, 0x21, 0x3a, 0xc8, 0xa2, 0x57, 0x0f, 0xb5, 0xb1, 0xc8,
+    0xbe, 0x6a, 0x0f, 0xcf, 0x59, 0xcc, 0x8a, 0x75, 0x0f, 0xd6, 0x10, 0x44,
+    0x05, 0x1e, 0xc0, 0x21, 0x46, 0xd8, 0x21, 0xcb, 0x0f, 0xa7, 0x11, 0xc5,
+    0xc1, 0x02, 0x0f, 0xa6, 0x61, 0x14, 0xc0, 0x21, 0x52, 0xdc, 0x12, 0x71,
+    0x0f, 0xb5, 0x70, 0x47, 0x34, 0x2f, 0xc0, 0x21, 0x5e, 0x4f, 0x63, 0x87,
+    0xc0, 0x21, 0x71, 0xd3, 0x45, 0x86, 0x08, 0x5c, 0xd1, 0xcc, 0x45, 0x8d,
+    0x08, 0x5c, 0xc9, 0x47, 0x02, 0x0e, 0x40, 0x21, 0x7d, 0x49, 0xae, 0x34,
+    0xc0, 0x21, 0xd8, 0x11, 0xc0, 0x21, 0xe4, 0x03, 0x40, 0x21, 0xf0, 0x18,
+    0xc0, 0x21, 0xfc, 0xc2, 0x00, 0x29, 0x0f, 0xcc, 0x61, 0x15, 0xc0, 0x22,
+    0x08, 0x05, 0xc0, 0x22, 0x1a, 0x55, 0x38, 0x15, 0xc0, 0x22, 0x24, 0x0e,
+    0xc0, 0x22, 0x3c, 0x45, 0x9e, 0xa0, 0xc0, 0x22, 0x4e, 0xce, 0x6b, 0xc6,
+    0x0f, 0x9f, 0x61, 0xd5, 0x37, 0x82, 0x0f, 0x9e, 0xd1, 0xc9, 0xb3, 0xb9,
+    0x0f, 0xce, 0x78, 0xc7, 0xc9, 0xc7, 0x0f, 0xd4, 0xa1, 0x44, 0xde, 0xdf,
+    0xc0, 0x22, 0x60, 0x09, 0xc0, 0x22, 0x6c, 0x18, 0xc0, 0x22, 0x78, 0x46,
+    0xce, 0x09, 0xc0, 0x22, 0x88, 0x15, 0xc0, 0x22, 0x94, 0x07, 0xc0, 0x22,
+    0xa4, 0x45, 0x05, 0xbb, 0xc0, 0x22, 0xb0, 0xce, 0x74, 0x40, 0x01, 0x19,
+    0x89, 0x03, 0xc0, 0x22, 0xbc, 0xd0, 0x5f, 0xe2, 0x01, 0x12, 0x79, 0xc8,
+    0xb6, 0x42, 0x01, 0x80, 0x18, 0x11, 0xc0, 0x22, 0xc6, 0x03, 0xc0, 0x22,
+    0xd6, 0xcd, 0x77, 0x39, 0x01, 0x36, 0xd1, 0xc3, 0x00, 0xcb, 0x0f, 0xa2,
+    0xb9, 0xd2, 0x47, 0x4b, 0x0f, 0xca, 0x08, 0xc2, 0x00, 0x58, 0x0f, 0xcd,
+    0x21, 0x42, 0x01, 0x48, 0xc0, 0x22, 0xeb, 0x4a, 0xa7, 0x42, 0xc0, 0x22,
+    0xfb, 0x17, 0xc0, 0x23, 0x07, 0x16, 0xc0, 0x23, 0x13, 0x89, 0x0f, 0xa0,
+    0xab, 0x00, 0x23, 0x1d, 0x47, 0x73, 0x7e, 0xc0, 0x23, 0x29, 0xc7, 0xae,
+    0xcf, 0x01, 0x05, 0x59, 0xc6, 0xb9, 0xb4, 0x0f, 0xae, 0x73, 0x00, 0x23,
+    0x4d, 0xcb, 0x95, 0x14, 0x0f, 0xaa, 0x51, 0x0e, 0xc0, 0x23, 0x53, 0xc2,
+    0x00, 0xbf, 0x0f, 0xb5, 0x51, 0xd2, 0x49, 0x8b, 0x0f, 0xb5, 0x78, 0x47,
+    0xc6, 0xe1, 0xc0, 0x23, 0x5f, 0xc6, 0xcb, 0xab, 0x0f, 0xca, 0xf9, 0xc2,
+    0x00, 0x3b, 0x0f, 0xcc, 0x30, 0x42, 0x01, 0xe2, 0xc0, 0x23, 0x83, 0x44,
+    0x39, 0x86, 0xc0, 0x23, 0x8d, 0xca, 0xa5, 0x44, 0x01, 0x09, 0xc1, 0xc4,
+    0xce, 0x23, 0x01, 0x01, 0x03, 0x00, 0x23, 0x99, 0x10, 0xc0, 0x23, 0x9d,
+    0xce, 0x61, 0x03, 0x00, 0x00, 0x80, 0x18, 0xc0, 0x23, 0xa9, 0x15, 0xc0,
+    0x23, 0xb5, 0x05, 0xc0, 0x23, 0xc1, 0x45, 0x75, 0x61, 0xc0, 0x23, 0xd9,
+    0xcc, 0x86, 0xd9, 0x01, 0x01, 0xd9, 0xcd, 0x7c, 0x74, 0x0f, 0x9c, 0xb9,
+    0x42, 0x00, 0xa9, 0xc0, 0x23, 0xeb, 0x42, 0x04, 0x2b, 0xc0, 0x23, 0xf7,
+    0x45, 0xdc, 0xc7, 0xc0, 0x24, 0x03, 0xcb, 0x4f, 0x1a, 0x0f, 0xb0, 0x61,
+    0xd3, 0x1c, 0x59, 0x07, 0xff, 0xe8, 0x43, 0x00, 0x2e, 0xc0, 0x24, 0x19,
+    0xc2, 0x00, 0x75, 0x0f, 0xa4, 0x6b, 0x00, 0x24, 0x2d, 0xc4, 0x7c, 0x7d,
+    0x0f, 0x9c, 0x03, 0x00, 0x24, 0x3d, 0x43, 0x00, 0x89, 0xc0, 0x24, 0x43,
+    0x57, 0x27, 0x2f, 0xc0, 0x24, 0x4f, 0xc7, 0x44, 0xfa, 0x07, 0xef, 0xe1,
+    0xc3, 0x01, 0x09, 0x0f, 0xca, 0x30, 0xc2, 0x00, 0x3b, 0x0f, 0xd5, 0x43,
+    0x00, 0x24, 0x5b, 0x42, 0x02, 0xa7, 0xc0, 0x24, 0x61, 0xc8, 0xb6, 0xba,
+    0x0f, 0xc8, 0xb1, 0x43, 0x0d, 0x05, 0xc0, 0x24, 0x71, 0x46, 0x1c, 0xa1,
+    0xc0, 0x24, 0x7b, 0x44, 0x12, 0xb8, 0xc0, 0x24, 0x99, 0xd2, 0x49, 0x1f,
+    0x0f, 0x9b, 0x01, 0xc2, 0x00, 0x40, 0x0f, 0x99, 0xcb, 0x00, 0x24, 0xbf,
+    0xc5, 0xde, 0x39, 0x0f, 0xa0, 0x99, 0xc5, 0xd9, 0x2a, 0x0f, 0xb5, 0x18,
+    0xc3, 0xe5, 0x57, 0x0f, 0xd4, 0x91, 0x0b, 0xc0, 0x24, 0xc5, 0x42, 0x01,
+    0xdd, 0xc0, 0x24, 0xd8, 0x96, 0x0f, 0xa0, 0x03, 0x00, 0x24, 0xe5, 0x05,
+    0xc0, 0x24, 0xeb, 0xc4, 0xb0, 0x4f, 0x0f, 0xa0, 0x3b, 0x00, 0x24, 0xf7,
+    0x8f, 0x0f, 0xa0, 0x78, 0xc8, 0xbe, 0xb2, 0x01, 0x05, 0xe9, 0xc8, 0x76,
+    0x54, 0x01, 0x05, 0x41, 0x43, 0x5d, 0xc0, 0xc0, 0x24, 0xfd, 0x10, 0xc0,
+    0x25, 0x0f, 0xcc, 0x89, 0x49, 0x0f, 0x9e, 0x49, 0xca, 0xa7, 0xba, 0x01,
+    0x4f, 0xa1, 0x5a, 0x19, 0xae, 0x40, 0x25, 0x19, 0x51, 0x50, 0x8a, 0xc0,
+    0x25, 0x3d, 0x42, 0x02, 0x32, 0xc0, 0x25, 0x7c, 0xc5, 0xda, 0x74, 0x0f,
+    0xce, 0xd8, 0x14, 0xc0, 0x25, 0x9a, 0xc3, 0x0e, 0x6a, 0x01, 0x35, 0xb1,
+    0x44, 0x02, 0x27, 0xc0, 0x25, 0xac, 0xd5, 0x34, 0x10, 0x01, 0x51, 0x78,
+    0x07, 0xc0, 0x25, 0xb8, 0xca, 0x89, 0x7b, 0x01, 0x38, 0x61, 0xc3, 0x14,
+    0x45, 0x01, 0x32, 0x69, 0x43, 0x1c, 0x87, 0xc0, 0x25, 0xc4, 0xcc, 0x86,
+    0x79, 0x0f, 0xa7, 0x99, 0xc4, 0x87, 0x8b, 0x0f, 0x9d, 0xd9, 0x47, 0xc1,
+    0xe0, 0x40, 0x25, 0xce, 0x0e, 0xc0, 0x25, 0xda, 0xd0, 0x59, 0xb2, 0x0f,
+    0xdd, 0xd8, 0x4d, 0x7b, 0x70, 0xc0, 0x25, 0xec, 0xc5, 0xdc, 0x63, 0x01,
+    0x5f, 0x30, 0x09, 0xc0, 0x26, 0x06, 0xc2, 0x07, 0x49, 0x0f, 0xb4, 0xa9,
+    0x49, 0xa7, 0x9d, 0xc0, 0x26, 0x16, 0x10, 0xc0, 0x26, 0x22, 0x0f, 0xc0,
+    0x26, 0x2c, 0x43, 0x26, 0x1e, 0xc0, 0x26, 0x38, 0xc4, 0xde, 0xd3, 0x01,
+    0x32, 0x49, 0x0d, 0xc0, 0x26, 0x44, 0x42, 0x02, 0x32, 0xc0, 0x26, 0x50,
+    0xda, 0x1b, 0x82, 0x0f, 0x9e, 0x99, 0xc2, 0x00, 0x99, 0x0f, 0x99, 0x70,
+    0xc3, 0xe5, 0x18, 0x0f, 0xcc, 0xb1, 0xc5, 0x46, 0xcd, 0x0f, 0xa2, 0xa8,
+    0x14, 0xc0, 0x26, 0x62, 0xc9, 0xb2, 0x90, 0x01, 0x05, 0x71, 0xc3, 0x17,
+    0x93, 0x0f, 0x99, 0xb9, 0xcb, 0x8e, 0xb8, 0x0f, 0xca, 0x18, 0x43, 0x02,
+    0xdf, 0xc0, 0x26, 0x72, 0x0b, 0xc0, 0x26, 0x7a, 0x11, 0xc0, 0x26, 0x84,
+    0x17, 0xc0, 0x26, 0x90, 0x42, 0x00, 0x29, 0xc0, 0x26, 0x9c, 0x03, 0x40,
+    0x26, 0xa6, 0xc4, 0xbc, 0xf7, 0x0f, 0xb5, 0xe9, 0x42, 0x00, 0x7f, 0xc0,
+    0x26, 0xb2, 0x16, 0xc0, 0x26, 0xe8, 0xc9, 0xac, 0x60, 0x0f, 0xaf, 0xe1,
+    0x57, 0x29, 0x12, 0xc0, 0x26, 0xf4, 0xc4, 0x32, 0xd0, 0x0f, 0x9a, 0x29,
+    0xc4, 0x5a, 0xfe, 0x0f, 0xa2, 0x29, 0x11, 0x40, 0x27, 0x00, 0x03, 0xc0,
+    0x27, 0x0f, 0x0b, 0xc0, 0x27, 0x2c, 0x17, 0xc0, 0x27, 0x4a, 0x11, 0x40,
+    0x27, 0x57, 0x4c, 0x89, 0xf1, 0xc0, 0x27, 0x64, 0x03, 0xc0, 0x27, 0xc4,
+    0x0e, 0xc0, 0x27, 0xd4, 0x10, 0xc0, 0x27, 0xde, 0xc7, 0xc9, 0x81, 0x0f,
+    0xcf, 0x51, 0xc8, 0xb9, 0x22, 0x0f, 0xcf, 0xc0, 0x09, 0xc0, 0x27, 0xee,
+    0x42, 0x00, 0x4e, 0xc0, 0x27, 0xfd, 0xc3, 0x18, 0xb3, 0x00, 0x03, 0xf3,
+    0x00, 0x28, 0x09, 0x14, 0xc0, 0x28, 0x0d, 0xc2, 0x16, 0x59, 0x01, 0x4f,
+    0xf3, 0x00, 0x28, 0x1f, 0xc4, 0x00, 0x3b, 0x0f, 0x9d, 0x59, 0xcf, 0x65,
+    0x3a, 0x01, 0x4e, 0xe9, 0x46, 0xce, 0x3f, 0xc0, 0x28, 0x25, 0x47, 0xc6,
+    0x39, 0x40, 0x28, 0x54, 0xd7, 0x22, 0x44, 0x01, 0x39, 0xc9, 0x11, 0xc0,
+    0x28, 0x6c, 0xd7, 0x27, 0x18, 0x0f, 0xa8, 0x00, 0x43, 0x01, 0xa4, 0xc0,
+    0x28, 0x76, 0xc3, 0x91, 0xe8, 0x01, 0x32, 0x41, 0x85, 0x01, 0x18, 0x91,
+    0x44, 0x02, 0x8b, 0xc0, 0x28, 0x82, 0x47, 0x2d, 0x4e, 0xc0, 0x28, 0x8c,
+    0x42, 0x00, 0x43, 0x40, 0x28, 0xbc, 0xce, 0x75, 0x4a, 0x0f, 0xd3, 0xc9,
+    0xc8, 0xbf, 0x9a, 0x01, 0x31, 0x61, 0xd6, 0x2f, 0x46, 0x01, 0x08, 0x09,
+    0x0f, 0xc0, 0x28, 0xc8, 0xc3, 0x1f, 0x19, 0x0f, 0xce, 0x89, 0x44, 0x0d,
+    0xff, 0x40, 0x28, 0xd4, 0x54, 0x3e, 0x94, 0xc0, 0x29, 0x06, 0x46, 0x0c,
+    0x8e, 0xc0, 0x29, 0x6a, 0x07, 0xc0, 0x29, 0x76, 0xc9, 0xb3, 0x44, 0x01,
+    0x1f, 0x81, 0x42, 0x00, 0xe6, 0xc0, 0x29, 0x88, 0x4b, 0x66, 0xd0, 0xc0,
+    0x29, 0x94, 0xcb, 0x91, 0xaf, 0x0f, 0xa3, 0xf0, 0x42, 0x00, 0xf1, 0xc0,
+    0x29, 0xa3, 0xca, 0x9c, 0xca, 0x01, 0x05, 0x99, 0xc7, 0xc6, 0xb0, 0x0f,
+    0x9a, 0x30, 0x00, 0x40, 0x29, 0xad, 0x43, 0x10, 0x73, 0xc0, 0x29, 0xb9,
+    0x96, 0x0f, 0xa0, 0xe3, 0x00, 0x29, 0xc5, 0xca, 0xa4, 0xc2, 0x01, 0x3e,
+    0x89, 0xc4, 0xca, 0xcf, 0x01, 0x34, 0x99, 0xc2, 0x06, 0x46, 0x01, 0x31,
+    0x29, 0x09, 0x40, 0x29, 0xd1, 0x16, 0xc0, 0x29, 0xf2, 0x05, 0xc0, 0x2a,
+    0x02, 0xc7, 0x5a, 0x55, 0x01, 0x15, 0x31, 0xd5, 0x2b, 0xc1, 0x01, 0x12,
+    0x18, 0xc9, 0xad, 0x5c, 0x01, 0x34, 0xd9, 0xcb, 0x8f, 0x26, 0x0f, 0xa2,
+    0xf8, 0x47, 0x02, 0x0e, 0xc0, 0x2a, 0x0e, 0x15, 0xc0, 0x2a, 0x55, 0x48,
+    0xa3, 0x64, 0xc0, 0x2a, 0x61, 0x46, 0x09, 0x97, 0xc0, 0x2a, 0x6d, 0x4b,
+    0x6f, 0xc7, 0xc0, 0x2a, 0x91, 0x56, 0x30, 0x90, 0x40, 0x2a, 0xae, 0xc8,
+    0xbc, 0xb2, 0x01, 0x1f, 0x31, 0x42, 0x00, 0x99, 0xc0, 0x2a, 0xb8, 0x47,
+    0xc2, 0xd5, 0xc0, 0x2a, 0xc4, 0xc9, 0x49, 0x4c, 0x00, 0x00, 0x31, 0x45,
+    0x31, 0xf0, 0x40, 0x2a, 0xd0, 0x54, 0x3e, 0x80, 0xc0, 0x2a, 0xdc, 0x12,
+    0xc0, 0x2b, 0x38, 0x11, 0x40, 0x2b, 0x44, 0x46, 0xd0, 0x6d, 0xc0, 0x2b,
+    0x50, 0xc5, 0xdd, 0x8f, 0x0f, 0xca, 0x88, 0xcf, 0x65, 0xb2, 0x0f, 0x9e,
+    0x41, 0xd7, 0x26, 0x49, 0x01, 0x51, 0xf9, 0x12, 0xc0, 0x2b, 0x5c, 0xc7,
+    0xc5, 0x67, 0x0f, 0xb4, 0x88, 0xcc, 0x88, 0x35, 0x0f, 0xb5, 0x09, 0x45,
+    0xd7, 0x72, 0x40, 0x2b, 0x68, 0x1a, 0xc0, 0x2b, 0x8a, 0x43, 0x1d, 0xbb,
+    0xc0, 0x2b, 0x96, 0x42, 0x02, 0x10, 0xc0, 0x2b, 0xb2, 0x19, 0xc0, 0x2b,
+    0xbe, 0x9b, 0x0f, 0xa3, 0x33, 0x00, 0x2b, 0xd1, 0x11, 0xc0, 0x2b, 0xd7,
+    0xc2, 0x00, 0x50, 0x0f, 0xa5, 0x19, 0xc5, 0xdc, 0x8b, 0x0f, 0xa4, 0x83,
+    0x00, 0x2b, 0xe4, 0xc2, 0x00, 0xb1, 0x0f, 0xa0, 0xb9, 0xc2, 0x02, 0x6f,
+    0x0f, 0xcd, 0xa1, 0x47, 0xc9, 0xdc, 0x40, 0x2b, 0xea, 0x11, 0xc0, 0x2b,
+    0xf6, 0x03, 0xc0, 0x2c, 0x08, 0x42, 0x0f, 0xe1, 0x40, 0x2c, 0x14, 0x10,
+    0xc0, 0x2c, 0x1e, 0x0e, 0xc0, 0x2c, 0x31, 0x15, 0xc0, 0x2c, 0x3b, 0x06,
+    0xc0, 0x2c, 0x50, 0xc2, 0x07, 0xb8, 0x0f, 0xa3, 0xb3, 0x00, 0x2c, 0x5c,
+    0x44, 0x82, 0x11, 0xc0, 0x2c, 0x60, 0x05, 0xc0, 0x2c, 0x84, 0x96, 0x0f,
+    0xcc, 0x3b, 0x00, 0x2c, 0x94, 0x14, 0xc0, 0x2c, 0xa7, 0x09, 0x40, 0x2c,
+    0xb1, 0xc3, 0x18, 0x91, 0x0f, 0xcd, 0x61, 0xcc, 0x8a, 0x81, 0x01, 0x31,
+    0x19, 0x16, 0xc0, 0x2c, 0xc3, 0xc4, 0x56, 0x1d, 0x0f, 0xa2, 0xc9, 0x42,
+    0x02, 0xa7, 0xc0, 0x2c, 0xcf, 0x14, 0xc0, 0x2c, 0xdb, 0x42, 0x00, 0x76,
+    0xc0, 0x2c, 0xe5, 0x44, 0x1f, 0x3c, 0x40, 0x2c, 0xf1, 0x03, 0xc0, 0x2c,
+    0xfb, 0x10, 0xc0, 0x2d, 0x1d, 0xc2, 0x02, 0xa7, 0x0f, 0xa8, 0xa3, 0x00,
+    0x2d, 0x30, 0x16, 0xc0, 0x2d, 0x3a, 0xc5, 0xdc, 0x95, 0x01, 0x11, 0xa9,
+    0x07, 0xc0, 0x2d, 0x46, 0x86, 0x0f, 0xb6, 0x79, 0xca, 0x9e, 0x1e, 0x0f,
+    0xce, 0x18, 0xc4, 0x02, 0x10, 0x0f, 0xce, 0x43, 0x00, 0x2d, 0x52, 0x95,
+    0x0f, 0xb4, 0x63, 0x00, 0x2d, 0x58, 0x42, 0x02, 0xa7, 0xc0, 0x2d, 0x62,
+    0x89, 0x0f, 0xa0, 0xdb, 0x00, 0x2d, 0x7a, 0x44, 0xdf, 0xb3, 0xc0, 0x2d,
+    0x80, 0xd3, 0x46, 0x1e, 0x0f, 0x9e, 0xb9, 0x44, 0x6f, 0xbf, 0xc0, 0x2d,
+    0x8c, 0xc4, 0x00, 0x3b, 0x0f, 0xd5, 0x19, 0xc5, 0xdc, 0x4f, 0x0f, 0x99,
+    0x78, 0x0b, 0xc0, 0x2d, 0x96, 0x03, 0xc0, 0x2d, 0xa6, 0x11, 0xc0, 0x2d,
+    0xb0, 0x07, 0x40, 0x2d, 0xc8, 0x57, 0x2a, 0x54, 0xc0, 0x2d, 0xd2, 0xcd,
+    0x7c, 0xe9, 0x07, 0xf7, 0xf8, 0xd2, 0x4b, 0x4d, 0x08, 0xe3, 0x61, 0x47,
+    0x34, 0x2f, 0xc0, 0x2e, 0x26, 0x06, 0xc0, 0x2e, 0x4a, 0x4b, 0x93, 0x30,
+    0xc0, 0x2e, 0x5c, 0xce, 0x73, 0x1a, 0x08, 0xe2, 0x19, 0x45, 0x00, 0xba,
+    0xc0, 0x2e, 0x64, 0x4b, 0x6f, 0xc7, 0xc0, 0x2e, 0x74, 0x47, 0x02, 0x0e,
+    0x40, 0x2e, 0x94, 0x19, 0xc0, 0x2e, 0xfb, 0x43, 0x00, 0x75, 0xc0, 0x2f,
+    0x05, 0xc5, 0x0a, 0xe2, 0x01, 0x2e, 0x53, 0x00, 0x2f, 0x15, 0x46, 0x19,
+    0xbb, 0xc0, 0x2f, 0x1b, 0xc2, 0x00, 0x3b, 0x0f, 0xa8, 0x93, 0x00, 0x2f,
+    0x2d, 0x43, 0x00, 0xc7, 0xc0, 0x2f, 0x39, 0xc6, 0xcf, 0xbf, 0x0f, 0x9b,
+    0x69, 0xd0, 0x5c, 0xb2, 0x0f, 0xb1, 0x69, 0xc5, 0xd5, 0x01, 0x0f, 0xcc,
+    0xf1, 0x16, 0x40, 0x2f, 0x45, 0x42, 0x00, 0x4b, 0xc0, 0x2f, 0x51, 0x42,
+    0x0f, 0x9b, 0xc0, 0x2f, 0x5f, 0x91, 0x01, 0x32, 0x63, 0x00, 0x2f, 0x6b,
+    0x48, 0x00, 0xcc, 0xc0, 0x2f, 0x71, 0x45, 0xd4, 0x43, 0xc0, 0x2f, 0x9a,
+    0xc4, 0xe2, 0xa3, 0x0f, 0xa6, 0x91, 0xca, 0x9a, 0xae, 0x0f, 0x9c, 0xd1,
+    0xc3, 0x13, 0x35, 0x0f, 0x9a, 0x59, 0x89, 0x0f, 0xcd, 0xa8, 0xc7, 0xca,
+    0x3e, 0x0f, 0xcc, 0x09, 0x09, 0xc0, 0x2f, 0xbc, 0x43, 0x1b, 0x67, 0xc0,
+    0x2f, 0xc8, 0xc3, 0x00, 0x38, 0x01, 0x32, 0x71, 0xd1, 0x52, 0xee, 0x01,
+    0x05, 0xb1, 0xc7, 0x77, 0xc1, 0x01, 0x05, 0x21, 0x10, 0xc0, 0x2f, 0xd4,
+    0x0f, 0xc0, 0x2f, 0xdc, 0xc2, 0x10, 0x3f, 0x0f, 0xaf, 0x13, 0x00, 0x2f,
+    0xe8, 0xc4, 0x8a, 0x84, 0x0f, 0xcc, 0x70, 0xc8, 0x21, 0xfb, 0x0f, 0xc9,
+    0x29, 0x45, 0x5b, 0x53, 0xc0, 0x2f, 0xee, 0x4c, 0x8c, 0x61, 0x40, 0x2f,
+    0xfa, 0x14, 0xc0, 0x30, 0x63, 0x44, 0x0b, 0x13, 0xc0, 0x30, 0x6f, 0xca,
+    0xa4, 0x54, 0x70, 0x00, 0x09, 0xcf, 0x68, 0xfa, 0x01, 0x31, 0xf3, 0x00,
+    0x30, 0x83, 0x04, 0xc0, 0x30, 0x87, 0x06, 0xc0, 0x30, 0x93, 0xd5, 0x34,
+    0x4f, 0x0f, 0xca, 0x69, 0x42, 0x01, 0x7c, 0x40, 0x30, 0x9f, 0xc5, 0xcf,
+    0x36, 0x0f, 0xcf, 0x99, 0xc3, 0x0c, 0xa5, 0x0f, 0xd6, 0x08, 0x44, 0x00,
+    0x67, 0xc0, 0x30, 0xd9, 0x46, 0x01, 0x4a, 0xc0, 0x31, 0x0d, 0x4a, 0x01,
+    0xa9, 0xc0, 0x31, 0x4b, 0xce, 0x72, 0xb8, 0x0f, 0xb2, 0x19, 0x00, 0x40,
+    0x31, 0x69, 0x0b, 0xc0, 0x31, 0x90, 0xda, 0x1c, 0x6c, 0x01, 0x35, 0x79,
+    0x06, 0xc0, 0x31, 0xa9, 0xcb, 0x96, 0x1c, 0x0f, 0xb0, 0x91, 0xce, 0x6e,
+    0xc8, 0x01, 0x5e, 0x88, 0x00, 0x40, 0x31, 0xb5, 0x47, 0x02, 0x0e, 0xc0,
+    0x31, 0xc1, 0xcc, 0x1d, 0xc7, 0x08, 0x1c, 0xf8, 0x03, 0xc0, 0x32, 0x24,
+    0x0e, 0xc0, 0x32, 0x32, 0x50, 0x5b, 0xb2, 0xc0, 0x32, 0x42, 0x14, 0xc0,
+    0x32, 0x84, 0x45, 0xd4, 0x0c, 0xc0, 0x32, 0x8e, 0xc6, 0xcb, 0x57, 0x0f,
+    0xcc, 0xa1, 0x4b, 0x8d, 0x8f, 0x40, 0x32, 0xa8, 0x14, 0xc0, 0x33, 0x00,
+    0x16, 0xc0, 0x33, 0x0f, 0x17, 0xc0, 0x33, 0x19, 0xc8, 0x6b, 0xf0, 0x01,
+    0x11, 0xd9, 0x0e, 0xc0, 0x33, 0x2b, 0xc3, 0x6b, 0x12, 0x0f, 0xa9, 0x51,
+    0xc6, 0xd1, 0x6f, 0x0f, 0x9f, 0x29, 0x43, 0x6e, 0xfe, 0xc0, 0x33, 0x38,
+    0xc2, 0x01, 0x25, 0x0f, 0xd4, 0xe8, 0x0f, 0xc0, 0x33, 0x44, 0x10, 0xc0,
+    0x33, 0x57, 0x42, 0x01, 0x29, 0xc0, 0x33, 0x6b, 0xc7, 0xc4, 0xcd, 0x0f,
+    0xad, 0xa1, 0x16, 0xc0, 0x33, 0x77, 0xdb, 0x18, 0x8a, 0x0f, 0xb2, 0x59,
+    0xc3, 0x23, 0x1b, 0x01, 0x5f, 0x09, 0x48, 0xbc, 0x42, 0x40, 0x33, 0x83,
+    0x42, 0x00, 0x09, 0xc0, 0x33, 0xbf, 0x47, 0x0d, 0xdb, 0xc0, 0x33, 0xc7,
+    0xcb, 0x93, 0x46, 0x01, 0x37, 0x61, 0xc6, 0xcd, 0x5b, 0x0f, 0x99, 0xd1,
+    0xca, 0xa4, 0x2c, 0x0f, 0xb6, 0xa9, 0xc9, 0xac, 0xf9, 0x0f, 0xcb, 0xf1,
+    0xca, 0x9f, 0x40, 0x0f, 0xcc, 0xd8, 0xcf, 0x68, 0xdc, 0x01, 0x1c, 0x71,
+    0x12, 0xc0, 0x33, 0xdf, 0xc4, 0xe0, 0x5b, 0x01, 0x5e, 0xd0, 0xd3, 0x40,
+    0x67, 0x0f, 0xa5, 0x79, 0xc9, 0x8c, 0x04, 0x0f, 0xb1, 0x79, 0x96, 0x0f,
+    0xb6, 0xb1, 0xca, 0x9e, 0xdc, 0x0f, 0xc8, 0xb8, 0x18, 0xc0, 0x33, 0xee,
+    0x4f, 0x61, 0x20, 0xc0, 0x33, 0xfa, 0x42, 0x00, 0xac, 0xc0, 0x34, 0x0c,
+    0x15, 0xc0, 0x34, 0x19, 0x08, 0xc0, 0x34, 0x25, 0x05, 0xc0, 0x34, 0x34,
+    0x06, 0xc0, 0x34, 0x40, 0x46, 0xd2, 0x65, 0xc0, 0x34, 0x4d, 0xc8, 0xb6,
+    0x1a, 0x0f, 0xa7, 0x28, 0x43, 0x01, 0xad, 0xc0, 0x34, 0x59, 0x49, 0x1c,
+    0x89, 0x40, 0x34, 0x65, 0xc5, 0xdb, 0x41, 0x01, 0x37, 0xc1, 0xd5, 0x33,
+    0xbc, 0x0f, 0x9e, 0x91, 0x05, 0x40, 0x34, 0xaf, 0xc6, 0x3c, 0x52, 0x01,
+    0x15, 0xbb, 0x00, 0x34, 0xbb, 0x92, 0x0f, 0xa3, 0xfa, 0x00, 0x34, 0xc1,
+    0x14, 0xc0, 0x34, 0xc7, 0xc6, 0x08, 0xea, 0x01, 0x05, 0x49, 0x0f, 0xc0,
+    0x34, 0xdd, 0xc7, 0xbf, 0xe8, 0x0f, 0xa1, 0xd1, 0xc2, 0x00, 0x6c, 0x0f,
+    0xd5, 0xa8, 0x43, 0x01, 0xfe, 0xc0, 0x34, 0xec, 0xc3, 0x0e, 0x66, 0x0f,
+    0xb6, 0xf3, 0x00, 0x34, 0xf6, 0xc3, 0x04, 0x85, 0x0f, 0xa0, 0x58, 0x4a,
+    0x15, 0x7c, 0xc0, 0x35, 0x02, 0xcc, 0x87, 0xb1, 0x0f, 0xad, 0x71, 0x10,
+    0xc0, 0x35, 0x26, 0xcb, 0x91, 0xd0, 0x0f, 0xca, 0x01, 0xd2, 0x47, 0x39,
+    0x01, 0x71, 0xf0, 0x16, 0xc0, 0x35, 0x36, 0x10, 0xc0, 0x35, 0x42, 0x14,
+    0xc0, 0x35, 0x4e, 0x18, 0xc0, 0x35, 0x5a, 0xc9, 0xac, 0x72, 0x0f, 0xae,
+    0x89, 0x45, 0xd7, 0x90, 0xc0, 0x35, 0x6c, 0xc4, 0x7f, 0xa8, 0x0f, 0xce,
+    0x38, 0x06, 0xc0, 0x35, 0x78, 0xcf, 0x68, 0xeb, 0x01, 0x33, 0x81, 0x0b,
+    0xc0, 0x35, 0x84, 0x44, 0x14, 0x97, 0x40, 0x35, 0x90, 0xca, 0x93, 0xd6,
+    0x01, 0x38, 0x69, 0x07, 0xc0, 0x35, 0x9c, 0xcd, 0x75, 0x72, 0x0f, 0x9c,
+    0x08, 0x9b, 0x0f, 0xd5, 0x83, 0x00, 0x35, 0xae, 0x03, 0xc0, 0x35, 0xb4,
+    0x11, 0xc0, 0x35, 0xc4, 0x07, 0xc0, 0x35, 0xd9, 0xca, 0xa0, 0xc6, 0x0f,
+    0xb1, 0x98, 0xc6, 0xd1, 0x7b, 0x0f, 0xcc, 0x51, 0x17, 0xc0, 0x35, 0xe5,
+    0x14, 0xc0, 0x35, 0xef, 0xc2, 0x01, 0xbb, 0x0f, 0xcd, 0xb3, 0x00, 0x36,
+    0x0b, 0xc4, 0x18, 0xb3, 0x0f, 0xae, 0x01, 0x89, 0x0f, 0x99, 0x5b, 0x00,
+    0x36, 0x11, 0xc4, 0xe3, 0xc3, 0x0f, 0xd6, 0xa8, 0x05, 0xc0, 0x36, 0x17,
+    0x42, 0x01, 0x0c, 0xc0, 0x36, 0x29, 0x0e, 0xc0, 0x36, 0x35, 0xca, 0x9c,
+    0x0c, 0x01, 0x31, 0x59, 0xce, 0x73, 0xd0, 0x0f, 0x9c, 0x29, 0xc3, 0xd3,
+    0x0e, 0x0f, 0xce, 0xd1, 0xc4, 0xd2, 0xb5, 0x0f, 0xa3, 0x50, 0x07, 0xc0,
+    0x36, 0x3f, 0x11, 0xc0, 0x36, 0x4b, 0x03, 0xc0, 0x36, 0x60, 0xca, 0x9f,
+    0x54, 0x0f, 0x9b, 0x20, 0x42, 0x02, 0xa7, 0xc0, 0x36, 0x6c, 0xc7, 0xc0,
+    0x20, 0x01, 0x37, 0xe9, 0x10, 0xc0, 0x36, 0x76, 0xc2, 0x00, 0x40, 0x01,
+    0x1e, 0xd8, 0x42, 0x01, 0xa3, 0xc0, 0x36, 0x82, 0x0f, 0xc0, 0x36, 0x8c,
+    0x03, 0xc0, 0x36, 0x98, 0xc4, 0xe3, 0x9b, 0x0f, 0xc9, 0xd0, 0x14, 0xc0,
+    0x36, 0xa4, 0x15, 0xc0, 0x36, 0xb1, 0x47, 0xc0, 0x0b, 0xc0, 0x36, 0xbe,
+    0x45, 0xd5, 0xd3, 0xc0, 0x36, 0xca, 0x0e, 0xc0, 0x36, 0xd6, 0xd9, 0x1e,
+    0xe6, 0x0f, 0x9e, 0x89, 0xd2, 0x4b, 0xb9, 0x01, 0x50, 0x68, 0xc4, 0xde,
+    0x8b, 0x0f, 0xd4, 0xf3, 0x00, 0x36, 0xe2, 0x0e, 0xc0, 0x36, 0xe8, 0x43,
+    0x6c, 0xc3, 0xc0, 0x36, 0xfa, 0x42, 0x07, 0x2f, 0xc0, 0x37, 0x12, 0x06,
+    0xc0, 0x37, 0x1a, 0x10, 0x40, 0x37, 0x26, 0x49, 0xb3, 0x68, 0xc0, 0x37,
+    0x34, 0x06, 0xc0, 0x37, 0x40, 0x42, 0x01, 0x1b, 0xc0, 0x37, 0x4a, 0x10,
+    0xc0, 0x37, 0x54, 0x14, 0xc0, 0x37, 0x66, 0x03, 0xc0, 0x37, 0x78, 0x4b,
+    0x93, 0x72, 0xc0, 0x37, 0x84, 0xc2, 0x00, 0xa2, 0x0f, 0xa6, 0xe9, 0x0e,
+    0xc0, 0x37, 0xa8, 0xcd, 0x78, 0x3d, 0x00, 0x04, 0xa8, 0x16, 0xc0, 0x37,
+    0xb4, 0x17, 0xc0, 0x37, 0xc0, 0x10, 0xc0, 0x37, 0xd5, 0x06, 0xc0, 0x37,
+    0xee, 0xc3, 0x87, 0x43, 0x0f, 0xaf, 0xf9, 0x11, 0xc0, 0x37, 0xfc, 0x43,
+    0x0b, 0x09, 0xc0, 0x38, 0x08, 0xca, 0x46, 0x99, 0x0f, 0xa7, 0x8b, 0x00,
+    0x38, 0x12, 0xca, 0xa0, 0xd0, 0x0f, 0x9d, 0x28, 0x16, 0xc0, 0x38, 0x16,
+    0x4c, 0x86, 0xb5, 0xc0, 0x38, 0x22, 0x46, 0xce, 0x93, 0xc0, 0x38, 0x47,
+    0x15, 0xc0, 0x38, 0x65, 0x14, 0xc0, 0x38, 0x7d, 0x0e, 0xc0, 0x38, 0x8f,
+    0x12, 0xc0, 0x38, 0xa1, 0x90, 0x0f, 0xa3, 0x43, 0x00, 0x38, 0xad, 0x0a,
+    0xc0, 0x38, 0xdb, 0xc6, 0xd1, 0x87, 0x0f, 0xae, 0xb1, 0xc4, 0x60, 0xb3,
+    0x00, 0x05, 0x79, 0xc5, 0xdb, 0x28, 0x0f, 0xcd, 0x19, 0x09, 0x40, 0x38,
+    0xe7, 0x15, 0xc0, 0x38, 0xf7, 0x42, 0x00, 0x72, 0xc0, 0x39, 0x03, 0x43,
+    0x1c, 0xe7, 0x40, 0x39, 0x0d, 0x06, 0xc0, 0x39, 0x19, 0x47, 0x02, 0x0e,
+    0x40, 0x39, 0x2b, 0x15, 0xc0, 0x39, 0x8b, 0x0e, 0xc0, 0x39, 0x9d, 0x50,
+    0x0f, 0x5e, 0xc0, 0x39, 0xa9, 0x16, 0xc0, 0x39, 0xb5, 0x4b, 0x6f, 0xc7,
+    0xc0, 0x39, 0xc1, 0x4f, 0x30, 0x90, 0xc0, 0x3a, 0x02, 0x46, 0x09, 0x97,
+    0x40, 0x3a, 0x0c, 0xc2, 0x01, 0xbb, 0x0f, 0xd5, 0x11, 0xcd, 0x7d, 0x37,
+    0x0f, 0xce, 0x70, 0x9b, 0x0f, 0xa8, 0x8b, 0x00, 0x3a, 0x30, 0xc9, 0xa9,
+    0xcf, 0x01, 0x09, 0x50, 0x46, 0x5c, 0x02, 0xc0, 0x3a, 0x3f, 0x45, 0xde,
+    0x2a, 0xc0, 0x3a, 0x49, 0xc3, 0x4d, 0xd4, 0x0f, 0xaa, 0x59, 0x47, 0xc9,
+    0xff, 0xc0, 0x3a, 0x72, 0x10, 0x40, 0x3a, 0x90, 0x52, 0x4c, 0xeb, 0xc0,
+    0x3a, 0x9a, 0x48, 0xbb, 0xb2, 0xc0, 0x3a, 0xa6, 0x45, 0xdd, 0xf3, 0xc0,
+    0x3a, 0xbe, 0x44, 0x2f, 0x1e, 0xc0, 0x3a, 0xde, 0x49, 0xb3, 0x4d, 0x40,
+    0x3b, 0x00, 0xc6, 0x00, 0xf3, 0x01, 0x05, 0x69, 0xc2, 0x00, 0xcc, 0x0f,
+    0xa4, 0x7b, 0x00, 0x3b, 0x28, 0xc4, 0x13, 0x35, 0x0f, 0xa2, 0xc1, 0xc7,
+    0xc5, 0xe5, 0x0f, 0xca, 0xe9, 0xc2, 0x00, 0xac, 0x0f, 0xd4, 0x08, 0xc3,
+    0x14, 0x6b, 0x0f, 0xa1, 0x41, 0xd4, 0x3d, 0xe0, 0x01, 0x93, 0xf8, 0x15,
+    0xc0, 0x3b, 0x34, 0x42, 0x00, 0xa4, 0xc0, 0x3b, 0x3e, 0x19, 0xc0, 0x3b,
+    0x4a, 0x43, 0x11, 0x7f, 0xc0, 0x3b, 0x60, 0xc5, 0xd8, 0x99, 0x01, 0x32,
+    0x33, 0x00, 0x3b, 0x6c, 0x43, 0x5c, 0xeb, 0xc0, 0x3b, 0x72, 0x46, 0xd3,
+    0x13, 0xc0, 0x3b, 0x7e, 0xc5, 0xde, 0x70, 0x0f, 0xa2, 0xa1, 0xc7, 0xc4,
+    0xd4, 0x0f, 0xc8, 0x98, 0xcc, 0x86, 0x55, 0x0f, 0xc9, 0x11, 0xc2, 0x02,
+    0x35, 0x01, 0x15, 0xe3, 0x00, 0x3b, 0x8e, 0x04, 0xc0, 0x3b, 0x94, 0x0b,
+    0xc0, 0x3b, 0xa0, 0x47, 0x34, 0xa6, 0xc0, 0x3b, 0xac, 0xd3, 0x40, 0x7a,
+    0x01, 0x01, 0x79, 0xc8, 0xba, 0x42, 0x0f, 0xa6, 0xd9, 0xca, 0xa4, 0x22,
+    0x0f, 0xcf, 0xf8, 0x10, 0xc0, 0x3b, 0xb8, 0x94, 0x01, 0x15, 0xeb, 0x00,
+    0x3b, 0xc2, 0x16, 0xc0, 0x3b, 0xd7, 0x00, 0xc0, 0x3b, 0xe8, 0x42, 0x02,
+    0x2f, 0xc0, 0x3c, 0x0b, 0xc2, 0x00, 0x40, 0x0f, 0xa2, 0x19, 0xcc, 0x40,
+    0x81, 0x00, 0x05, 0x00, 0xca, 0xa7, 0x06, 0x0f, 0x0a, 0x79, 0x0e, 0xc0,
+    0x3c, 0x17, 0x46, 0x09, 0x97, 0xc0, 0x3c, 0x23, 0x15, 0xc0, 0x3c, 0x47,
+    0x45, 0x28, 0xb1, 0x40, 0x3c, 0x53, 0x44, 0x75, 0x34, 0xc0, 0x3c, 0x6f,
+    0x0f, 0xc0, 0x3c, 0x7b, 0xca, 0x9d, 0x92, 0x0f, 0xa9, 0x49, 0xc2, 0x02,
+    0xa7, 0x00, 0x00, 0x00, 0xc5, 0x13, 0x84, 0x01, 0x16, 0x1b, 0x00, 0x3c,
+    0x87, 0xcc, 0x06, 0xbb, 0x01, 0x16, 0x11, 0x48, 0x19, 0xb9, 0xc0, 0x3c,
+    0x8d, 0x15, 0xc0, 0x3c, 0x99, 0x05, 0xc0, 0x3c, 0xa5, 0xc7, 0x05, 0xc0,
+    0x01, 0x10, 0x79, 0xce, 0x72, 0xd4, 0x01, 0x50, 0x49, 0xd2, 0x48, 0x6b,
+    0x01, 0x57, 0xf8, 0xca, 0xa0, 0x76, 0x00, 0x3f, 0xf9, 0x06, 0xc0, 0x3c,
+    0xb1, 0x0e, 0xc0, 0x3c, 0xc3, 0xd0, 0x0f, 0x09, 0x00, 0x3f, 0xc9, 0x43,
+    0x0a, 0x8a, 0xc0, 0x3c, 0xd5, 0x47, 0x10, 0x78, 0xc0, 0x3c, 0xe1, 0xd4,
+    0x3d, 0x18, 0x00, 0x3f, 0xa0, 0xc3, 0x83, 0x55, 0x0f, 0xcb, 0xb9, 0xce,
+    0x73, 0x8a, 0x0f, 0x98, 0x18, 0x46, 0x04, 0x8f, 0xc0, 0x3c, 0xed, 0x44,
+    0x0b, 0x0d, 0x40, 0x3d, 0x0f, 0x44, 0xe4, 0x3b, 0xc0, 0x3d, 0x31, 0x12,
+    0xc0, 0x3d, 0x3d, 0x00, 0x40, 0x3d, 0x49, 0xc3, 0x01, 0x97, 0x0f, 0xcc,
+    0x29, 0xcf, 0x68, 0xeb, 0x01, 0x33, 0x89, 0x94, 0x0f, 0xa2, 0x12, 0x00,
+    0x3d, 0x5b, 0x89, 0x0f, 0xca, 0xd1, 0x52, 0x4d, 0xb1, 0x40, 0x3d, 0x68,
+    0x16, 0xc0, 0x3d, 0xee, 0x05, 0xc0, 0x3d, 0xf8, 0xd1, 0x50, 0x24, 0x0f,
+    0xb0, 0x88, 0x15, 0xc0, 0x3e, 0x04, 0x42, 0x00, 0x99, 0xc0, 0x3e, 0x0e,
+    0xc9, 0xa9, 0x3f, 0x00, 0x9b, 0x09, 0xc9, 0x11, 0xf6, 0x00, 0x9b, 0x11,
+    0x12, 0xc0, 0x3e, 0x18, 0xcd, 0x2c, 0xb2, 0x00, 0x9b, 0x39, 0x46, 0x09,
+    0x97, 0xc0, 0x3e, 0x24, 0x47, 0x34, 0x2f, 0xc0, 0x3e, 0x42, 0x4b, 0x8f,
+    0x68, 0x40, 0x3e, 0x60, 0x07, 0xc0, 0x3e, 0x86, 0x47, 0xc5, 0x60, 0xc0,
+    0x3e, 0xa1, 0x88, 0x0f, 0xce, 0xe9, 0x4d, 0x7c, 0x67, 0x40, 0x3e, 0xad,
+    0x00, 0xc0, 0x3f, 0x26, 0xc6, 0x59, 0xd6, 0x01, 0x33, 0x50, 0xc6, 0x31,
+    0x92, 0x01, 0x38, 0x4b, 0x00, 0x3f, 0x36, 0xca, 0x3a, 0x52, 0x01, 0x1c,
+    0x31, 0x42, 0x00, 0xa9, 0xc0, 0x3f, 0x3c, 0x00, 0xc0, 0x3f, 0x48, 0xc5,
+    0xd6, 0x0f, 0x00, 0x00, 0x28, 0x4b, 0x98, 0x4d, 0xc0, 0x3f, 0x5a, 0x4b,
+    0x97, 0x45, 0xc0, 0x3f, 0x66, 0x48, 0xb6, 0x9a, 0x40, 0x3f, 0x72, 0x42,
+    0x00, 0x65, 0xc0, 0x3f, 0x7e, 0x0b, 0x40, 0x3f, 0x88, 0x46, 0xd2, 0x05,
+    0xc0, 0x3f, 0x94, 0xc4, 0x61, 0x0d, 0x00, 0x00, 0xd8, 0xcc, 0x83, 0x9d,
+    0x01, 0x08, 0x39, 0x42, 0x00, 0x79, 0x40, 0x3f, 0x9e, 0x95, 0x0f, 0xa2,
+    0x01, 0xc7, 0xb4, 0xd2, 0x0f, 0xa2, 0x98, 0x0b, 0xc0, 0x3f, 0xb0, 0x4c,
+    0x83, 0x55, 0xc0, 0x3f, 0xbc, 0x42, 0x00, 0xb1, 0xc0, 0x3f, 0xd8, 0x47,
+    0xc7, 0x12, 0xc0, 0x3f, 0xe4, 0x47, 0xc7, 0xb3, 0x40, 0x40, 0x18, 0xc5,
+    0xd8, 0x30, 0x0f, 0xcc, 0x69, 0xc4, 0xe0, 0xfb, 0x0f, 0x9e, 0x61, 0x03,
+    0xc0, 0x40, 0x42, 0xc5, 0xd0, 0x38, 0x0f, 0xcb, 0xe9, 0x4c, 0x89, 0xe5,
+    0x40, 0x40, 0x4c, 0x07, 0xc0, 0x40, 0xc0, 0x03, 0xc0, 0x40, 0xca, 0x0b,
+    0xc0, 0x40, 0xe2, 0x11, 0x40, 0x40, 0xee, 0xc2, 0x00, 0xb1, 0x01, 0x34,
+    0xcb, 0x00, 0x40, 0xfa, 0x0f, 0xc0, 0x41, 0x00, 0x11, 0xc0, 0x41, 0x0c,
+    0xcf, 0x63, 0x4b, 0x01, 0x05, 0x81, 0xc3, 0x73, 0xfc, 0x0f, 0xce, 0xf1,
+    0xc7, 0xc8, 0x23, 0x01, 0x80, 0x98, 0xca, 0xa5, 0xee, 0x01, 0x09, 0xb9,
+    0x14, 0x40, 0x41, 0x18, 0xc6, 0xd2, 0xef, 0x0f, 0x9d, 0x91, 0xc4, 0xbc,
+    0x5c, 0x0f, 0xce, 0x20, 0x11, 0xc0, 0x41, 0x25, 0xca, 0xa4, 0xae, 0x01,
+    0x4f, 0x31, 0x03, 0x40, 0x41, 0x37, 0x43, 0x01, 0x95, 0xc0, 0x41, 0x43,
+    0xd0, 0x5f, 0xc2, 0x01, 0x3e, 0x39, 0xcc, 0x89, 0xc1, 0x01, 0x31, 0x31,
+    0x0b, 0xc0, 0x41, 0x4f, 0x45, 0x0c, 0x91, 0x40, 0x41, 0x5b, 0xc2, 0x00,
+    0x29, 0x0f, 0xcd, 0x31, 0x4b, 0x96, 0xd7, 0x40, 0x41, 0x67, 0x47, 0xc0,
+    0xc1, 0xc0, 0x41, 0x7f, 0x07, 0xc0, 0x41, 0x9d, 0x52, 0x28, 0xce, 0xc0,
+    0x41, 0xa7, 0xc3, 0x00, 0x44, 0x0f, 0xce, 0x28, 0x07, 0xc0, 0x41, 0xad,
+    0xc7, 0xc4, 0x10, 0x01, 0x36, 0x71, 0xc8, 0x12, 0x47, 0x01, 0x30, 0x69,
+    0x42, 0x00, 0x43, 0x40, 0x41, 0xb7, 0x06, 0xc0, 0x41, 0xc6, 0x47, 0xc0,
+    0x89, 0xc0, 0x41, 0xd0, 0xc3, 0x0d, 0x14, 0x0f, 0xd6, 0x90, 0x16, 0xc0,
+    0x41, 0xf8, 0xc8, 0xb8, 0x4a, 0x01, 0x09, 0x28, 0x42, 0x00, 0x2a, 0xc0,
+    0x42, 0x04, 0x16, 0x40, 0x42, 0x28, 0xd1, 0x53, 0xdc, 0x01, 0x1f, 0xf9,
+    0x46, 0x38, 0xe8, 0xc0, 0x42, 0x34, 0xda, 0x1c, 0x52, 0x07, 0xff, 0xe0,
+    0x0e, 0xc0, 0x42, 0x40, 0xcb, 0x8e, 0x34, 0x0f, 0xcb, 0xa8, 0x44, 0x78,
+    0xf3, 0xc0, 0x42, 0x4f, 0xc4, 0xcc, 0x91, 0x00, 0x16, 0xd8, 0x46, 0xd1,
+    0xbd, 0xc0, 0x42, 0x67, 0x44, 0x3c, 0x52, 0x40, 0x42, 0x73, 0x46, 0xcd,
+    0x37, 0xc0, 0x42, 0x7f, 0x51, 0x50, 0x35, 0xc0, 0x42, 0xc2, 0x4a, 0x51,
+    0x89, 0x40, 0x42, 0xda, 0x15, 0xc0, 0x42, 0xf2, 0x42, 0x01, 0x0e, 0xc0,
+    0x42, 0xfe, 0x48, 0x10, 0xb4, 0xc0, 0x43, 0x0a, 0x45, 0x01, 0xc3, 0xc0,
+    0x43, 0x16, 0xd4, 0x3b, 0xd8, 0x08, 0xd1, 0x99, 0x47, 0x02, 0x0e, 0xc0,
+    0x43, 0x2e, 0x46, 0x34, 0x6f, 0x40, 0x43, 0x8a, 0xce, 0x6d, 0xcc, 0x01,
+    0x17, 0xf9, 0x14, 0xc0, 0x43, 0x96, 0x15, 0xc0, 0x43, 0xa8, 0x45, 0x00,
+    0x49, 0xc0, 0x43, 0xb4, 0xca, 0x9c, 0xe8, 0x01, 0x4c, 0x11, 0xd6, 0x2c,
+    0x02, 0x01, 0x53, 0x20, 0x49, 0xaf, 0xe4, 0xc0, 0x43, 0xc0, 0xc2, 0x11,
+    0xa5, 0x01, 0x5f, 0x11, 0xc8, 0xb6, 0x3a, 0x0f, 0xcc, 0x98, 0x47, 0xca,
+    0x14, 0xc0, 0x43, 0xd2, 0x47, 0xc0, 0xf2, 0xc0, 0x44, 0x02, 0xcc, 0x8b,
+    0x41, 0x0f, 0x9c, 0x19, 0x94, 0x0f, 0xd6, 0xc8, 0xc2, 0x00, 0x10, 0x01,
+    0x35, 0xa9, 0xc5, 0xd7, 0xe5, 0x01, 0x32, 0x19, 0xc6, 0xd1, 0x2d, 0x0f,
+    0xc9, 0xc8, 0xc6, 0xd1, 0x09, 0x0f, 0xab, 0xc9, 0xc2, 0x00, 0x74, 0x01,
+    0x50, 0xe8, 0xc9, 0x48, 0xa4, 0x01, 0x33, 0x49, 0x42, 0x02, 0xbc, 0xc0,
+    0x44, 0x32, 0xd9, 0x1e, 0x37, 0x01, 0x50, 0xb0, 0xcb, 0x5a, 0x97, 0x01,
+    0x12, 0xf9, 0x00, 0x40, 0x44, 0x3e, 0xc6, 0xcb, 0xb7, 0x01, 0x31, 0x79,
+    0x00, 0x40, 0x44, 0x4a, 0x45, 0xd4, 0x89, 0xc0, 0x44, 0x56, 0xca, 0xa4,
+    0x7c, 0x0f, 0xa4, 0xd9, 0xc6, 0x08, 0xea, 0x00, 0x05, 0x28, 0x42, 0x00,
+    0x89, 0xc0, 0x44, 0x68, 0xc8, 0xb9, 0x1a, 0x0f, 0xcb, 0x59, 0xc2, 0x49,
+    0x0c, 0x0f, 0xb7, 0xb1, 0x50, 0x5b, 0x52, 0xc0, 0x44, 0x73, 0x06, 0x40,
+    0x44, 0xf5, 0xc8, 0xb9, 0x32, 0x01, 0x36, 0x81, 0x07, 0xc0, 0x44, 0xff,
+    0x42, 0x00, 0xa9, 0xc0, 0x45, 0x0c, 0x11, 0xc0, 0x45, 0x1b, 0x12, 0xc0,
+    0x45, 0x25, 0x14, 0xc0, 0x45, 0x31, 0x4b, 0x8c, 0x62, 0x40, 0x45, 0x3d,
+    0xc6, 0xcb, 0x75, 0x01, 0x32, 0x89, 0xc6, 0xd2, 0x53, 0x01, 0x71, 0xf8,
+    0xc5, 0xd1, 0xee, 0x01, 0x31, 0x21, 0xc5, 0xda, 0x47, 0x01, 0x08, 0x30,
+    0xc9, 0x08, 0xe7, 0x01, 0x31, 0x09, 0x50, 0x59, 0x12, 0x40, 0x45, 0xb5,
+    0xc3, 0x03, 0xd9, 0x0f, 0xa7, 0xbb, 0x00, 0x45, 0xc1, 0xc4, 0x2a, 0xa0,
+    0x0f, 0x9e, 0xa8, 0xc5, 0x79, 0x8a, 0x0f, 0xa6, 0x29, 0xc9, 0xac, 0x57,
+    0x0f, 0xc8, 0xc8, 0xc5, 0x11, 0x55, 0x0f, 0xa1, 0x8a, 0x00, 0x45, 0xc7,
+    0x42, 0xbe, 0x99, 0xc0, 0x45, 0xcd, 0x08, 0x40, 0x45, 0xd9, 0x14, 0xc0,
+    0x45, 0xe1, 0x05, 0xc0, 0x45, 0xeb, 0x15, 0xc0, 0x46, 0x05, 0x12, 0xc0,
+    0x46, 0x29, 0x04, 0xc0, 0x46, 0x35, 0x16, 0xc0, 0x46, 0x4b, 0x46, 0xd0,
+    0x31, 0xc0, 0x46, 0x63, 0x06, 0xc0, 0x46, 0x6f, 0x0e, 0xc0, 0x46, 0x81,
+    0x0a, 0xc0, 0x46, 0x8d, 0x0f, 0xc0, 0x46, 0x9f, 0x19, 0xc0, 0x46, 0xa7,
+    0x08, 0xc0, 0x46, 0xb1, 0x0c, 0xc0, 0x46, 0xbd, 0x07, 0xc0, 0x46, 0xc9,
+    0x44, 0xe3, 0xb7, 0xc0, 0x46, 0xdb, 0xc3, 0x1a, 0x7c, 0x01, 0x75, 0xc9,
+    0x09, 0x40, 0x46, 0xeb, 0x96, 0x01, 0x8e, 0x03, 0x00, 0x46, 0xf7, 0xc2,
+    0x47, 0xa4, 0x01, 0x8e, 0x09, 0xc2, 0xe5, 0x85, 0x01, 0x8e, 0x11, 0xc3,
+    0xe5, 0x84, 0x01, 0x8e, 0x19, 0x95, 0x01, 0x8e, 0x8b, 0x00, 0x46, 0xfb,
+    0x8a, 0x01, 0x8e, 0x83, 0x00, 0x47, 0x15, 0x90, 0x01, 0x8e, 0x79, 0x92,
+    0x01, 0x8e, 0x93, 0x00, 0x47, 0x2d, 0x86, 0x01, 0x8e, 0xa1, 0x93, 0x01,
+    0x8f, 0x18, 0x42, 0x00, 0x3b, 0xc0, 0x47, 0x39, 0x07, 0xc0, 0x47, 0x48,
+    0x14, 0xc0, 0x47, 0x54, 0xcb, 0x94, 0xc7, 0x0f, 0x9e, 0x09, 0xc5, 0xdc,
+    0x45, 0x0f, 0x99, 0x80, 0x0b, 0xc0, 0x47, 0x5e, 0x14, 0xc0, 0x47, 0x68,
+    0x44, 0xe0, 0xa7, 0xc0, 0x47, 0x74, 0x42, 0x00, 0x47, 0x40, 0x47, 0x9e,
+    0xc3, 0x01, 0xe7, 0x01, 0x35, 0xb9, 0xc4, 0x79, 0xe6, 0x01, 0x31, 0x39,
+    0xc5, 0xd7, 0x2c, 0x0f, 0xa1, 0xf9, 0xc4, 0xe3, 0x6f, 0x0f, 0xa0, 0xa1,
+    0xc2, 0x18, 0xb3, 0x0f, 0xce, 0x92, 0x00, 0x47, 0xbc, 0x48, 0xbe, 0x52,
+    0xc0, 0x47, 0xc2, 0xca, 0xa7, 0x56, 0x0f, 0x9b, 0x59, 0xc7, 0xc0, 0x6d,
+    0x0f, 0xcb, 0x10, 0xc3, 0x1c, 0xe6, 0x0f, 0xd3, 0xe1, 0xca, 0xa6, 0xf2,
+    0x01, 0x05, 0x10, 0x44, 0x00, 0x74, 0xc0, 0x47, 0xce, 0xc9, 0xad, 0x89,
+    0x0f, 0xa9, 0x70, 0x42, 0x00, 0xcc, 0xc0, 0x47, 0xda, 0xc2, 0x01, 0x48,
+    0x0f, 0xa2, 0x89, 0xc6, 0xcc, 0xc5, 0x0f, 0xa0, 0x51, 0xc6, 0xd2, 0xd7,
+    0x0f, 0xca, 0x80, 0xc8, 0xb9, 0x92, 0x0f, 0xa5, 0x99, 0xca, 0x39, 0x0b,
+    0x0f, 0x98, 0xc8, 0xcd, 0x7b, 0x7d, 0x0f, 0x9e, 0x78, 0xc4, 0x9e, 0x3a,
+    0x0f, 0xcb, 0x29, 0x0d, 0x40, 0x47, 0xea, 0x47, 0x1d, 0xd4, 0xc0, 0x47,
+    0xf6, 0xc2, 0x00, 0x3d, 0x01, 0x30, 0x21, 0x12, 0xc0, 0x48, 0x5c, 0x0f,
+    0x40, 0x48, 0x74, 0x42, 0x00, 0x84, 0xc0, 0x48, 0x7e, 0xce, 0x6e, 0x58,
+    0x0f, 0xa4, 0x89, 0xcb, 0x96, 0xab, 0x0f, 0xb6, 0x58, 0xc8, 0xb7, 0x4a,
+    0x01, 0x30, 0x61, 0x16, 0xc0, 0x48, 0x8a, 0xca, 0xa0, 0xe4, 0x01, 0x19,
+    0x91, 0x4a, 0x9c, 0x3e, 0xc0, 0x48, 0xa2, 0xce, 0x73, 0xfa, 0x0f, 0x9f,
+    0x51, 0x08, 0xc0, 0x48, 0xae, 0xd5, 0x33, 0xa7, 0x01, 0x53, 0x68, 0xcb,
+    0x99, 0x29, 0x01, 0x12, 0xc1, 0xc2, 0x00, 0x65, 0x0f, 0xd5, 0xc1, 0xd2,
+    0x4b, 0xa7, 0x01, 0x72, 0x78, 0xc2, 0x00, 0x45, 0x00, 0x01, 0xd3, 0x00,
+    0x48, 0xc0, 0xcd, 0x76, 0x9d, 0x0f, 0xa5, 0x28, 0x0b, 0xc0, 0x48, 0xc4,
+    0xc7, 0xc5, 0x28, 0x0f, 0x9a, 0xd0, 0xc5, 0x11, 0x55, 0x0f, 0xa1, 0x70,
+    0x1b, 0xc0, 0x48, 0xce, 0x44, 0x1b, 0xaa, 0x40, 0x48, 0xda, 0x46, 0x83,
+    0x27, 0xc0, 0x48, 0xf8, 0xc6, 0xca, 0x97, 0x0f, 0xa6, 0x58, 0xc7, 0x72,
+    0xbf, 0x0f, 0xc9, 0x09, 0x42, 0x00, 0x40, 0xc0, 0x49, 0x04, 0x42, 0x00,
+    0x3b, 0xc0, 0x49, 0x10, 0xc2, 0x04, 0x3d, 0x01, 0x30, 0x0a, 0x00, 0x49,
+    0x1c, 0xd3, 0x46, 0x90, 0x0f, 0xac, 0x09, 0x42, 0x02, 0xaf, 0xc0, 0x49,
+    0x22, 0xcf, 0x69, 0x09, 0x0f, 0x9e, 0xd8, 0x42, 0x00, 0x49, 0xc0, 0x49,
+    0x2e, 0x17, 0x40, 0x49, 0x38, 0xc8, 0xbe, 0x8a, 0x0f, 0x98, 0x30, 0xc3,
+    0xe5, 0x15, 0x0f, 0xb6, 0x19, 0xc3, 0x01, 0x4b, 0x0f, 0x9b, 0x70, 0x45,
+    0x00, 0xba, 0xc0, 0x49, 0x4a, 0x51, 0x4e, 0xf2, 0xc0, 0x49, 0x9a, 0x4d,
+    0x77, 0xc8, 0x40, 0x49, 0xac, 0x0e, 0xc0, 0x49, 0xc6, 0xe0, 0x00, 0xa7,
+    0x01, 0x3b, 0x09, 0x14, 0x40, 0x49, 0xd2, 0x00, 0xc0, 0x49, 0xde, 0xc3,
+    0x2e, 0xab, 0x01, 0x5f, 0x01, 0xc4, 0x2a, 0x3e, 0x0f, 0xce, 0x08, 0x42,
+    0x01, 0x19, 0xc0, 0x49, 0xea, 0xc5, 0x00, 0xb9, 0x00, 0x05, 0x10, 0xc5,
+    0x00, 0xb9, 0x01, 0x05, 0xa9, 0xc3, 0x12, 0xad, 0x00, 0x05, 0xc0, 0x50,
+    0x5b, 0x72, 0xc0, 0x49, 0xf6, 0x4d, 0x76, 0xde, 0x40, 0x4a, 0x04, 0x47,
+    0x02, 0x0e, 0xc0, 0x4a, 0x48, 0x47, 0x0a, 0xda, 0xc0, 0x4a, 0x5a, 0x49,
+    0x0b, 0x17, 0xc0, 0x4a, 0x66, 0xce, 0x74, 0xb0, 0x00, 0x24, 0x11, 0xc6,
+    0x4a, 0x9f, 0x05, 0x33, 0xf1, 0xc7, 0xc7, 0x27, 0x05, 0x33, 0xf8, 0xce,
+    0x74, 0xf6, 0x00, 0x04, 0x99, 0xc5, 0x1d, 0x1d, 0x01, 0x10, 0xb0, 0x49,
+    0xb0, 0x2c, 0x40, 0x4a, 0x72, 0x8e, 0x0f, 0xcd, 0x69, 0x96, 0x0f, 0xa5,
+    0xd0, 0xcb, 0x94, 0xd2, 0x01, 0x35, 0xe1, 0xc7, 0xb3, 0x85, 0x07, 0xf2,
+    0x28, 0xc7, 0xc5, 0x36, 0x01, 0x35, 0xd1, 0x06, 0xc0, 0x4a, 0x96, 0xc5,
+    0x33, 0x24, 0x00, 0x01, 0xd8, 0x16, 0xc0, 0x4a, 0x9c, 0xcf, 0x62, 0xc4,
+    0x0f, 0xca, 0x40, 0xc9, 0xb2, 0x7e, 0x01, 0x09, 0x01, 0x45, 0x29, 0x7c,
+    0x40, 0x4a, 0xa8, 0xc5, 0xda, 0xce, 0x0f, 0x99, 0x89, 0xcf, 0x6b, 0x34,
+    0x0f, 0xb2, 0x40, 0x43, 0x01, 0x97, 0xc0, 0x4a, 0xae, 0xc6, 0xd2, 0x41,
+    0x01, 0x11, 0xf9, 0x45, 0xd6, 0x7d, 0x40, 0x4a, 0xb8, 0x48, 0xbe, 0x22,
+    0xc0, 0x4a, 0xd4, 0xcd, 0x75, 0x65, 0x0f, 0xc8, 0xc0, 0x42, 0x00, 0xaf,
+    0xc0, 0x4b, 0x26, 0xd5, 0x34, 0x3a, 0x01, 0x39, 0xd1, 0xcd, 0x79, 0x41,
+    0x01, 0x00, 0x30, 0x45, 0xdb, 0xa0, 0xc0, 0x4b, 0x32, 0x46, 0x39, 0xfb,
+    0x40, 0x4b, 0x52, 0xcd, 0x7d, 0xd3, 0x01, 0x53, 0x61, 0x43, 0x05, 0xb2,
+    0xc0, 0x4b, 0x5e, 0x46, 0x00, 0xd4, 0x40, 0x4b, 0x6a, 0xc8, 0xbc, 0xea,
+    0x0f, 0xd3, 0xd1, 0x42, 0x00, 0xc2, 0xc0, 0x4b, 0x76, 0xd3, 0x41, 0x84,
+    0x01, 0x71, 0xe0, 0x16, 0xc0, 0x4b, 0x82, 0x14, 0xc0, 0x4b, 0x8e, 0x46,
+    0xd2, 0xf5, 0xc0, 0x4b, 0x98, 0xcd, 0x31, 0x8b, 0x0f, 0xac, 0x19, 0xc4,
+    0x01, 0xdd, 0x0f, 0x9e, 0xf9, 0xcc, 0x83, 0x85, 0x0f, 0xce, 0x68, 0xd7,
+    0x28, 0xb6, 0x01, 0x39, 0x49, 0x03, 0xc0, 0x4b, 0xa4, 0x0b, 0x40, 0x4b,
+    0xb0, 0xc6, 0xcc, 0xf5, 0x01, 0x1f, 0x89, 0xc8, 0xb5, 0x72, 0x0f, 0xaf,
+    0x00, 0xce, 0x73, 0x60, 0x0f, 0x9c, 0xc9, 0xc2, 0x00, 0xb0, 0x0f, 0xb6,
+    0x99, 0xce, 0x71, 0x68, 0x0f, 0xca, 0xc8, 0x00, 0x40, 0x4b, 0xbc, 0x16,
+    0xc0, 0x4b, 0xc8, 0xca, 0x85, 0xc7, 0x0f, 0xd7, 0x08, 0xc4, 0xba, 0xe0,
+    0x0f, 0xcc, 0xa9, 0x47, 0xc2, 0xea, 0x40, 0x4b, 0xd4, 0x48, 0x10, 0xc1,
+    0xc0, 0x4b, 0xf0, 0xc5, 0xdb, 0x0f, 0x0f, 0xcb, 0x50, 0xc3, 0x05, 0x9f,
+    0x01, 0x32, 0x21, 0xc6, 0xce, 0x6f, 0x0f, 0xb7, 0x82, 0x00, 0x4b, 0xfc,
+    0x4c, 0x11, 0xe2, 0xc0, 0x4c, 0x02, 0xd1, 0x48, 0x11, 0x00, 0x41, 0xb1,
+    0x0f, 0xc0, 0x4c, 0x2c, 0x4b, 0x6f, 0xc7, 0xc0, 0x4c, 0x38, 0x47, 0x02,
+    0x0e, 0x40, 0x4c, 0x5c, 0xc4, 0xde, 0xd7, 0x0f, 0xcd, 0xd1, 0xc3, 0x0e,
+    0x61, 0x0f, 0xcf, 0xb8, 0xc2, 0x1e, 0xd5, 0x0f, 0xcd, 0x41, 0xc2, 0x02,
+    0xa7, 0x0f, 0xa4, 0x02, 0x00, 0x4c, 0xb4, 0xc2, 0x00, 0x29, 0x01, 0x37,
+    0xb9, 0xcd, 0x77, 0x46, 0x0f, 0x9d, 0xf8, 0x16, 0xc0, 0x4c, 0xba, 0x12,
+    0x40, 0x4c, 0xc4, 0x86, 0x0f, 0xb7, 0xb9, 0xca, 0x9e, 0x3c, 0x0f, 0xab,
+    0xa9, 0x42, 0x02, 0x37, 0x40, 0x4c, 0xce, 0x46, 0x70, 0xd0, 0xc0, 0x4c,
+    0xda, 0xcb, 0x96, 0xcc, 0x0f, 0x9a, 0xa8, 0x45, 0x00, 0xdd, 0xc0, 0x4c,
+    0xe6, 0xce, 0x70, 0x96, 0x05, 0x33, 0x98, 0xc3, 0x15, 0x0f, 0x0f, 0xcc,
+    0x81, 0xc2, 0x0b, 0x47, 0x0f, 0xc9, 0xb8, 0x14, 0xc0, 0x4c, 0xf2, 0x4c,
+    0x01, 0xf6, 0xc0, 0x4c, 0xfc, 0xc5, 0xda, 0x6a, 0x01, 0x30, 0xc1, 0x18,
+    0xc0, 0x4d, 0x0e, 0xd0, 0x5b, 0xf2, 0x0f, 0xca, 0xc0, 0xc3, 0x00, 0x28,
+    0x0f, 0xb5, 0xf9, 0x42, 0x00, 0x61, 0xc0, 0x4d, 0x1a, 0xd0, 0x5e, 0x42,
+    0x01, 0x1b, 0xe9, 0xca, 0x9a, 0x72, 0x0f, 0x99, 0x01, 0x46, 0x2a, 0x9f,
+    0xc0, 0x4d, 0x2e, 0xdd, 0x11, 0x51, 0x0f, 0xc9, 0x78, 0xca, 0xa2, 0x10,
+    0x01, 0x37, 0x49, 0x43, 0x00, 0x4b, 0xc0, 0x4d, 0x3a, 0x92, 0x0f, 0xb5,
+    0x11, 0xc3, 0x19, 0x78, 0x0f, 0xb7, 0x08, 0x43, 0xc4, 0x20, 0xc0, 0x4d,
+    0x46, 0xc4, 0xc0, 0x85, 0x0f, 0xb7, 0xa0, 0xc3, 0x00, 0xca, 0x01, 0x34,
+    0xb1, 0xc2, 0x15, 0x13, 0x0f, 0xcf, 0x18, 0x44, 0x07, 0x31, 0xc0, 0x4d,
+    0x52, 0xc4, 0x44, 0xba, 0x01, 0x08, 0x41, 0x07, 0xc0, 0x4d, 0x64, 0xc3,
+    0x1f, 0x48, 0x0f, 0xa6, 0xe0, 0xc8, 0xbb, 0xba, 0x0f, 0x9c, 0x90, 0xc5,
+    0x2a, 0x94, 0x01, 0x3a, 0x21, 0xc3, 0x12, 0xb8, 0x01, 0x30, 0x1b, 0x00,
+    0x4d, 0x70, 0xd0, 0x5f, 0xf2, 0x0f, 0x9e, 0xa1, 0xc7, 0xca, 0x61, 0x0f,
+    0x9e, 0x10, 0xc2, 0x00, 0x71, 0x0f, 0xa0, 0x61, 0xc2, 0x00, 0x3c, 0x0f,
+    0xa0, 0x68, 0x43, 0x00, 0x8e, 0xc0, 0x4d, 0x76, 0xd6, 0x2c, 0x18, 0x01,
+    0x08, 0xb8, 0xd6, 0x1f, 0x7f, 0x0f, 0xb3, 0x53, 0x00, 0x4d, 0x82, 0xc2,
+    0x11, 0xa5, 0x00, 0x01, 0x7a, 0x00, 0x4d, 0x88, 0x4e, 0x6d, 0x16, 0xc0,
+    0x4d, 0x8e, 0xdb, 0x15, 0xcc, 0x08, 0xd5, 0x03, 0x00, 0x4d, 0x96, 0x45,
+    0x01, 0xc3, 0xc0, 0x4d, 0x9c, 0x15, 0xc0, 0x4d, 0xb4, 0xcf, 0x63, 0xff,
+    0x08, 0xd4, 0xc1, 0x55, 0x34, 0x79, 0xc0, 0x4d, 0xc0, 0x57, 0x26, 0xd3,
+    0xc0, 0x4d, 0xf0, 0x47, 0x02, 0x0e, 0xc0, 0x4e, 0x00, 0x46, 0x34, 0x6f,
+    0x40, 0x4e, 0x5a, 0xc8, 0xb7, 0x5a, 0x01, 0x35, 0xe9, 0xc2, 0x01, 0x26,
+    0x0f, 0xcf, 0x30, 0xd4, 0x3e, 0x44, 0x01, 0x1c, 0xa1, 0x00, 0xc0, 0x4e,
+    0x66, 0xc4, 0x15, 0x2e, 0x0f, 0xca, 0x70, 0x46, 0x09, 0x97, 0xc0, 0x4e,
+    0x78, 0x47, 0x02, 0x0e, 0x40, 0x4e, 0x9c, 0x4c, 0x11, 0xe2, 0xc0, 0x4f,
+    0x16, 0x47, 0x34, 0x2f, 0xc0, 0x4f, 0x28, 0x4a, 0x51, 0x89, 0xc0, 0x4f,
+    0x35, 0xd0, 0x59, 0xf2, 0x08, 0x7a, 0x29, 0x47, 0x02, 0x0e, 0x40, 0x4f,
+    0x5f, 0x42, 0x01, 0x19, 0xc0, 0x4f, 0xbc, 0xd8, 0x24, 0x6b, 0x01, 0x3d,
+    0x38, 0x48, 0x19, 0xd4, 0xc0, 0x4f, 0xc6, 0xc5, 0xda, 0xc9, 0x01, 0x19,
+    0x78, 0xc6, 0xd2, 0xdd, 0x0f, 0xaa, 0x69, 0xcd, 0x6a, 0x0a, 0x00, 0x00,
+    0xb0, 0x43, 0x68, 0xf2, 0xc0, 0x50, 0x1a, 0xc3, 0x09, 0x3a, 0x0f, 0xa4,
+    0x48, 0x47, 0x02, 0x0e, 0xc0, 0x50, 0x72, 0x45, 0x00, 0xba, 0xc0, 0x50,
+    0xc8, 0x4b, 0x6f, 0xc7, 0xc0, 0x50, 0xd8, 0x4c, 0x85, 0xa1, 0x40, 0x50,
+    0xee, 0x07, 0xc0, 0x50, 0xfe, 0xca, 0xa4, 0xe0, 0x01, 0x05, 0xb9, 0x42,
+    0x06, 0x4e, 0x40, 0x51, 0x0a, 0x43, 0x1b, 0x32, 0xc0, 0x51, 0x1f, 0xc6,
+    0xce, 0xff, 0x0f, 0x9a, 0xe9, 0xc2, 0x00, 0x89, 0x00, 0x01, 0x00, 0x49,
+    0x6e, 0x41, 0x40, 0x51, 0x2c, 0x44, 0x03, 0xda, 0xc0, 0x51, 0x38, 0xc3,
+    0x01, 0xe5, 0x0f, 0xab, 0xba, 0x00, 0x51, 0x4a, 0xc9, 0xac, 0xde, 0x0f,
+    0x9e, 0x29, 0xcb, 0x94, 0x01, 0x0f, 0xa1, 0x99, 0x11, 0xc0, 0x51, 0x50,
+    0xc3, 0x09, 0x3a, 0x0f, 0xcf, 0xe8, 0x15, 0xc0, 0x51, 0x5a, 0xc4, 0xdf,
+    0x9b, 0x0f, 0xcd, 0xc1, 0xc7, 0xc8, 0xb6, 0x0f, 0xcd, 0xc8, 0x00, 0xc0,
+    0x51, 0x66, 0x47, 0xc3, 0xed, 0xc0, 0x51, 0x72, 0xc6, 0x91, 0xd5, 0x0f,
+    0x99, 0xd9, 0xc4, 0xaf, 0x8f, 0x0f, 0x98, 0x2b, 0x00, 0x51, 0x9c, 0xd2,
+    0x4a, 0xf3, 0x0f, 0x98, 0x38, 0xc6, 0x07, 0x9a, 0x01, 0x1d, 0x99, 0xc3,
+    0x00, 0xf1, 0x01, 0x1d, 0x91, 0xcd, 0x7b, 0x97, 0x01, 0x50, 0x58, 0x00,
+    0x40, 0x51, 0xa2, 0x43, 0x00, 0x3d, 0xc0, 0x51, 0xba, 0x46, 0x07, 0x2f,
+    0xc0, 0x51, 0xcf, 0xc6, 0xb0, 0xf5, 0x00, 0x00, 0xd0, 0xcc, 0x81, 0x5d,
+    0x01, 0x11, 0x79, 0xc2, 0x00, 0x29, 0x0f, 0x9e, 0x20, 0xc2, 0x00, 0x0a,
+    0x0f, 0x9b, 0x19, 0xcf, 0x61, 0x7a, 0x0f, 0xb4, 0xf8, 0x0e, 0xc0, 0x52,
+    0x09, 0xca, 0xa1, 0x3e, 0x0f, 0xb0, 0x78, 0x42, 0x02, 0xa7, 0xc0, 0x52,
+    0x13, 0xca, 0x4a, 0x11, 0x01, 0x51, 0x98, 0xd5, 0x36, 0x1d, 0x0f, 0xb3,
+    0xa9, 0x90, 0x0f, 0xcd, 0x10, 0x42, 0x02, 0x41, 0xc0, 0x52, 0x20, 0x10,
+    0xc0, 0x52, 0x2c, 0xc2, 0x00, 0x4e, 0x01, 0x01, 0x90, 0xc9, 0xb2, 0x87,
+    0x0f, 0xcd, 0x79, 0xc7, 0xc7, 0xcf, 0x01, 0x18, 0x29, 0x12, 0xc0, 0x52,
+    0x39, 0xc7, 0xc4, 0x1e, 0x01, 0x5e, 0xc1, 0xcc, 0x88, 0xb9, 0x0f, 0xb6,
+    0x38, 0xca, 0x9b, 0xb2, 0x01, 0x1c, 0xb9, 0xc5, 0xbf, 0x4d, 0x01, 0x13,
+    0xd3, 0x00, 0x52, 0x48, 0x15, 0xc0, 0x52, 0x4c, 0x46, 0xcf, 0xd1, 0xc0,
+    0x52, 0x58, 0xc4, 0xde, 0xe3, 0x0f, 0xcb, 0x40, 0x05, 0xc0, 0x52, 0x6a,
+    0xcc, 0x83, 0xb5, 0x01, 0x08, 0x73, 0x00, 0x52, 0x76, 0x1b, 0x40, 0x52,
+    0x7c, 0xc2, 0x00, 0xf1, 0x01, 0x32, 0x3b, 0x00, 0x52, 0x88, 0x15, 0xc0,
+    0x52, 0x8e, 0xc4, 0x09, 0x3a, 0x0f, 0xd5, 0x00, 0x42, 0x11, 0xee, 0xc0,
+    0x52, 0x9d, 0xca, 0x0e, 0x64, 0x01, 0x39, 0x79, 0x07, 0xc0, 0x52, 0xa9,
+    0xc3, 0x13, 0x4e, 0x0f, 0xd4, 0x28, 0xc8, 0xbb, 0x9a, 0x0f, 0xb7, 0xd8,
+    0xc3, 0x4c, 0xa1, 0x01, 0x32, 0x99, 0xc3, 0x1a, 0x2e, 0x0f, 0xa9, 0x58,
+    0xcd, 0x7d, 0x44, 0x01, 0x56, 0xd0, 0xc8, 0xb8, 0xf2, 0x0f, 0xa5, 0x49,
+    0x8e, 0x0f, 0xa4, 0x51, 0xc9, 0x92, 0xda, 0x00, 0x05, 0xb0, 0x00, 0x40,
+    0x52, 0xb5, 0xcc, 0x85, 0xe9, 0x0f, 0xb6, 0x11, 0x49, 0xab, 0xa3, 0xc0,
+    0x52, 0xc1, 0x07, 0x40, 0x52, 0xcd, 0x87, 0x0f, 0xae, 0x7b, 0x00, 0x52,
+    0xd9, 0xc3, 0x7f, 0x6c, 0x0f, 0xb6, 0xa0, 0x16, 0xc0, 0x52, 0xe5, 0x4b,
+    0x8d, 0x9a, 0xc0, 0x52, 0xfd, 0x03, 0xc0, 0x53, 0x21, 0xc3, 0x2a, 0xf6,
+    0x0f, 0xcc, 0xe0, 0xcc, 0x23, 0x33, 0x08, 0xd7, 0xab, 0x00, 0x53, 0x33,
+    0x0e, 0xc0, 0x53, 0x37, 0xce, 0x75, 0x3c, 0x08, 0xd7, 0x7b, 0x00, 0x53,
+    0x46, 0x47, 0xc1, 0x07, 0xc0, 0x53, 0x4a, 0xcb, 0x5a, 0x32, 0x08, 0xd7,
+    0x32, 0x00, 0x53, 0x5c, 0xc3, 0x03, 0x03, 0x01, 0x35, 0xa1, 0x0f, 0x40,
+    0x53, 0x60, 0x05, 0xc0, 0x53, 0x70, 0x45, 0x00, 0xba, 0xc0, 0x53, 0x7c,
+    0x47, 0x34, 0x2f, 0xc0, 0x53, 0xb4, 0x46, 0x09, 0x97, 0xc0, 0x53, 0xc4,
+    0x49, 0xaa, 0x7a, 0xc0, 0x53, 0xe8, 0x47, 0xc1, 0xd2, 0x40, 0x53, 0xfa,
+    0xc7, 0xc4, 0x3a, 0x0f, 0xa1, 0xe1, 0xc5, 0xdd, 0x44, 0x0f, 0xca, 0xf0,
+    0x03, 0xc0, 0x54, 0x12, 0xc8, 0x5b, 0xfa, 0x0f, 0x9b, 0x91, 0xc9, 0xad,
+    0xfe, 0x0f, 0xd5, 0xa0, 0x45, 0x00, 0x73, 0xc0, 0x54, 0x1e, 0xc8, 0xb8,
+    0x2a, 0x0f, 0x9a, 0xb9, 0xc7, 0x42, 0xd3, 0x00, 0x05, 0x19, 0xcb, 0x95,
+    0xb9, 0x0f, 0xd6, 0xb9, 0xc2, 0x11, 0xee, 0x0f, 0xa2, 0xe8, 0x15, 0xc0,
+    0x54, 0x2a, 0x42, 0x00, 0x45, 0x40, 0x54, 0x36, 0xcf, 0x5f, 0x33, 0x01,
+    0x18, 0xb1, 0x16, 0xc0, 0x54, 0x42, 0xc5, 0xd9, 0x66, 0x01, 0x5f, 0x38,
+    0x4d, 0x7e, 0xe4, 0xc0, 0x54, 0x4e, 0xc4, 0x13, 0x66, 0x0f, 0x9b, 0xf8,
+    0xc3, 0x63, 0x7e, 0x0f, 0xb4, 0x9b, 0x00, 0x54, 0x5a, 0xc7, 0xc9, 0x7a,
+    0x0f, 0xa3, 0x70, 0xca, 0x8b, 0x2b, 0x01, 0x3e, 0x13, 0x00, 0x54, 0x60,
+    0x15, 0xc0, 0x54, 0x66, 0xd1, 0x51, 0xef, 0x01, 0x33, 0xf1, 0x00, 0xc0,
+    0x54, 0x78, 0xcc, 0x85, 0x89, 0x0f, 0x9d, 0x69, 0xc9, 0x8e, 0x15, 0x00,
+    0x01, 0x28, 0xc3, 0xb3, 0xd0, 0x01, 0x38, 0x79, 0xc6, 0x16, 0x32, 0x01,
+    0x37, 0x21, 0xd6, 0x31, 0x82, 0x0f, 0xac, 0x31, 0xc9, 0xaa, 0xd4, 0x0f,
+    0xb0, 0xa1, 0xc4, 0xe0, 0x73, 0x0f, 0xa1, 0x38, 0x05, 0xc0, 0x54, 0x8a,
+    0x94, 0x0f, 0x9a, 0x81, 0xc4, 0xe4, 0x6b, 0x0f, 0xca, 0xe0, 0xc6, 0xa4,
+    0xe4, 0x01, 0x05, 0x89, 0xc8, 0xb5, 0x6a, 0x01, 0x05, 0x38, 0xcb, 0x9a,
+    0x31, 0x01, 0x00, 0x41, 0xcf, 0x62, 0x79, 0x01, 0x72, 0x70, 0xc9, 0xad,
+    0x92, 0x0f, 0xa4, 0xe1, 0xc2, 0x00, 0x40, 0x0f, 0xa2, 0xd8, 0x16, 0xc0,
+    0x54, 0x9a, 0xc3, 0x05, 0x14, 0x08, 0x5d, 0x4b, 0x00, 0x54, 0xaa, 0xc4,
+    0x09, 0x9d, 0x08, 0x5d, 0x60, 0xc3, 0x02, 0xa3, 0x08, 0x5c, 0xe1, 0xc5,
+    0x0d, 0x20, 0x08, 0x5c, 0xd8, 0xc3, 0xb5, 0x3e, 0x08, 0x5c, 0x89, 0x15,
+    0xc0, 0x54, 0xb0, 0xc2, 0x00, 0x67, 0x08, 0x5c, 0x71, 0xc3, 0x20, 0x18,
+    0x08, 0x5c, 0x61, 0xc8, 0xb9, 0x7a, 0x08, 0x5c, 0x59, 0xc6, 0xcf, 0xd7,
+    0x08, 0x5c, 0x51, 0xc4, 0xe0, 0xe7, 0x08, 0x5c, 0x49, 0xc4, 0x4a, 0xb9,
+    0x08, 0x5c, 0x41, 0xc2, 0x01, 0x7f, 0x08, 0x5c, 0x23, 0x00, 0x54, 0xba,
+    0xc5, 0x4a, 0xb3, 0x08, 0x5c, 0x31, 0xcd, 0x7e, 0x89, 0x08, 0x5c, 0x29,
+    0xc6, 0x40, 0x9a, 0x08, 0x5c, 0x19, 0xc5, 0x9c, 0xa2, 0x08, 0x5c, 0x11,
+    0xc4, 0xe3, 0x27, 0x08, 0x5c, 0x09, 0xc5, 0xa5, 0xfd, 0x08, 0x5c, 0x00,
+    0xd2, 0x48, 0xd7, 0x00, 0xb9, 0xb1, 0xd2, 0x4c, 0xa3, 0x00, 0xb9, 0xa8,
+    0x48, 0xba, 0xd2, 0xc0, 0x54, 0xc0, 0xc3, 0x25, 0xd6, 0x01, 0x5e, 0xd8,
+    0x46, 0xd3, 0x79, 0xc0, 0x54, 0xd2, 0x50, 0x5c, 0x52, 0x40, 0x54, 0xe8,
+    0x4c, 0x7e, 0xd8, 0xc0, 0x55, 0x3c, 0x48, 0xb4, 0x80, 0x40, 0x55, 0x52,
+    0xcc, 0x8b, 0x05, 0x01, 0x30, 0x59, 0x45, 0x74, 0xd9, 0xc0, 0x55, 0x86,
+    0x42, 0x00, 0x29, 0x40, 0x55, 0x92, 0x0b, 0xc0, 0x55, 0x9f, 0xd6, 0x31,
+    0xae, 0x0f, 0xae, 0xd8, 0x49, 0x07, 0xbb, 0xc0, 0x55, 0xab, 0xd1, 0x54,
+    0x42, 0x01, 0x1e, 0x53, 0x00, 0x55, 0xb7, 0xd3, 0x45, 0xd2, 0x01, 0x1e,
+    0x4a, 0x00, 0x55, 0xbd, 0xcb, 0x91, 0x0a, 0x01, 0x12, 0xe1, 0xc3, 0x1e,
+    0x36, 0x00, 0x03, 0xf9, 0xcb, 0x91, 0x57, 0x0f, 0xb4, 0xd0, 0xca, 0x9a,
+    0x90, 0x01, 0x08, 0x49, 0xc7, 0xc5, 0xec, 0x01, 0x08, 0x19, 0xc4, 0x00,
+    0xba, 0x00, 0x05, 0x80, 0xc4, 0x00, 0x87, 0x0f, 0xb1, 0xa9, 0xc6, 0x00,
+    0x91, 0x0f, 0xa5, 0x58, 0x48, 0x89, 0xf5, 0xc0, 0x55, 0xc3, 0x43, 0x09,
+    0x9a, 0x40, 0x55, 0xdc, 0x49, 0xb3, 0x95, 0xc0, 0x56, 0x0c, 0xcb, 0x96,
+    0x27, 0x01, 0x35, 0x71, 0x0b, 0x40, 0x56, 0x3e, 0x51, 0x53, 0xfe, 0xc0,
+    0x56, 0x50, 0x53, 0x43, 0x4c, 0x40, 0x56, 0x62, 0x03, 0xc0, 0x56, 0x6e,
+    0xdb, 0x16, 0xbf, 0x01, 0x1c, 0x11, 0xcb, 0x8f, 0x5d, 0x0f, 0xcb, 0xc0,
+    0x46, 0x8d, 0x69, 0xc0, 0x56, 0x7a, 0xce, 0x6c, 0x28, 0x0f, 0xb7, 0x90,
+    0xd7, 0x2a, 0xde, 0x01, 0x1c, 0x99, 0xc3, 0x01, 0xfd, 0x0f, 0x9d, 0x78,
+    0x0f, 0xc0, 0x56, 0x92, 0xc6, 0x20, 0xab, 0x00, 0x05, 0x40, 0x12, 0xc0,
+    0x56, 0x9e, 0xca, 0xa6, 0xa2, 0x0f, 0xc9, 0x21, 0xcc, 0x81, 0x45, 0x0f,
+    0xa1, 0x50, 0xdc, 0x12, 0x55, 0x01, 0x3c, 0xd9, 0xc9, 0x9a, 0x28, 0x01,
+    0x05, 0x79, 0xc3, 0x1c, 0xd9, 0x0f, 0xa0, 0x4a, 0x00, 0x56, 0xaa, 0x44,
+    0x01, 0x4a, 0xc0, 0x56, 0xb0, 0x00, 0xc0, 0x56, 0xbc, 0x4a, 0x01, 0xa9,
+    0x40, 0x56, 0xd7, 0x4a, 0x01, 0x68, 0xc0, 0x56, 0xe9, 0x48, 0x00, 0x5f,
+    0x40, 0x56, 0xf5, 0x43, 0x00, 0x5b, 0xc0, 0x57, 0x01, 0xc5, 0xd8, 0xb7,
+    0x0f, 0x9b, 0x48, 0x44, 0x00, 0xde, 0xc0, 0x57, 0x0f, 0x00, 0x40, 0x57,
+    0x35, 0x43, 0x06, 0x64, 0xc0, 0x57, 0x4d, 0xc5, 0x11, 0x55, 0x0f, 0xa1,
+    0xb0, 0x4b, 0x97, 0x24, 0xc0, 0x57, 0x65, 0xc7, 0xb7, 0x72, 0x01, 0x14,
+    0x0b, 0x00, 0x57, 0x74, 0x42, 0x05, 0xc0, 0xc0, 0x57, 0x7a, 0xc5, 0xd4,
+    0xfc, 0x01, 0x15, 0x71, 0xc6, 0x07, 0xb0, 0x01, 0x11, 0x22, 0x00, 0x57,
+    0x89, 0x46, 0x00, 0x8b, 0x40, 0x57, 0x8f, 0xc4, 0xe4, 0x07, 0x0f, 0xa1,
+    0x61, 0xc8, 0x02, 0xe7, 0x00, 0x01, 0x20, 0xdd, 0x11, 0xe2, 0x0d, 0xe4,
+    0xf9, 0xcb, 0x99, 0x81, 0x0d, 0xe4, 0xf1, 0xd5, 0x33, 0xfb, 0x0d, 0xe4,
+    0xe9, 0xd1, 0x4f, 0xcf, 0x0d, 0xe4, 0xe1, 0x46, 0xd2, 0x95, 0xc0, 0x57,
+    0x9e, 0x47, 0x02, 0x0e, 0x40, 0x57, 0xba, 0x43, 0x00, 0xa8, 0xc0, 0x58,
+    0x57, 0x00, 0x40, 0x58, 0x69, 0xc4, 0x01, 0xe3, 0x01, 0x2c, 0x99, 0xc9,
+    0xb4, 0xd0, 0x0f, 0xab, 0xb0, 0x00, 0x40, 0x58, 0x75, 0xc3, 0x3e, 0xe1,
+    0x0f, 0xa4, 0x19, 0xc2, 0x0f, 0x7b, 0x0f, 0x9b, 0x08, 0x44, 0x01, 0xd6,
+    0xc0, 0x58, 0x81, 0xcd, 0x78, 0x71, 0x0f, 0xa4, 0xf0, 0x42, 0x01, 0x1b,
+    0xc0, 0x58, 0x8b, 0xc5, 0xd7, 0x7c, 0x01, 0x08, 0xf8, 0x43, 0x1f, 0x3d,
+    0xc0, 0x58, 0x97, 0xcd, 0x5e, 0x85, 0x00, 0x00, 0xf1, 0xd1, 0x51, 0x34,
+    0x0f, 0xb4, 0xc9, 0xc4, 0xe2, 0xeb, 0x0f, 0xcf, 0xf0, 0xc6, 0x00, 0x91,
+    0x01, 0x1e, 0x71, 0xc4, 0x00, 0x49, 0x01, 0x5c, 0x81, 0xc5, 0x00, 0x2c,
+    0x01, 0x5c, 0x88, 0xc5, 0xd7, 0x1d, 0x0f, 0x9a, 0x71, 0xcd, 0x7c, 0xf6,
+    0x0f, 0xcf, 0x38, 0x5d, 0x10, 0x69, 0xc0, 0x58, 0xa3, 0xcb, 0x8f, 0x1b,
+    0x00, 0x05, 0x70, 0xcc, 0x45, 0x8d, 0x05, 0x4a, 0xf9, 0x18, 0xc0, 0x59,
+    0x0b, 0x4f, 0x30, 0x90, 0xc0, 0x59, 0x17, 0x47, 0x02, 0x0e, 0x40, 0x59,
+    0x26, 0x00, 0xc0, 0x59, 0x86, 0x46, 0x01, 0x4a, 0xc0, 0x59, 0xd5, 0x02,
+    0xc0, 0x5a, 0x1c, 0xd5, 0x33, 0x29, 0x01, 0x51, 0xe8, 0x00, 0xc0, 0x5a,
+    0x38, 0xc8, 0xbf, 0xa2, 0x0f, 0xab, 0x69, 0xc9, 0xb0, 0xaa, 0x0f, 0xd4,
+    0x80, 0x47, 0x02, 0x5b, 0x40, 0x5a, 0x5c, 0xc4, 0x15, 0x2e, 0x0f, 0x9a,
+    0xc9, 0xc7, 0xc1, 0x0e, 0x0f, 0x9a, 0xc0, 0xd0, 0x5f, 0xb2, 0x01, 0x49,
+    0x59, 0xd0, 0x3c, 0x90, 0x01, 0x49, 0x80, 0xc2, 0x00, 0x3d, 0x0f, 0xb4,
+    0x00, 0xd9, 0x20, 0xda, 0x0f, 0xc9, 0x19, 0x07, 0xc0, 0x5a, 0x74, 0xc9,
+    0xad, 0x38, 0x0f, 0xcf, 0xd8, 0x00, 0xc0, 0x5a, 0x80, 0x4e, 0x6e, 0x90,
+    0x40, 0x5a, 0x8c, 0xd3, 0x1c, 0xa7, 0x01, 0x3b, 0x39, 0xd8, 0x25, 0x13,
+    0x01, 0x3b, 0x29, 0xc9, 0xb1, 0xa6, 0x01, 0x09, 0xd1, 0xdd, 0x11, 0x8b,
+    0x01, 0x5e, 0x69, 0xd7, 0x28, 0x71, 0x01, 0x5e, 0x78, 0x48, 0x56, 0x9a,
+    0xc0, 0x5a, 0xaa, 0x15, 0xc0, 0x5a, 0xcf, 0xca, 0x9a, 0x06, 0x08, 0x0c,
+    0x89, 0x06, 0xc0, 0x5a, 0xd9, 0xce, 0x74, 0x08, 0x08, 0x0c, 0xb9, 0xc7,
+    0xc2, 0x3b, 0x08, 0x0c, 0xd1, 0xce, 0x6f, 0x70, 0x08, 0x0c, 0xd8, 0xc3,
+    0x02, 0x10, 0x0f, 0x9f, 0xa8, 0x45, 0xdb, 0x3c, 0xc0, 0x5a, 0xeb, 0x44,
+    0x0b, 0xe6, 0xc0, 0x5a, 0xf7, 0x90, 0x01, 0x36, 0x32, 0x00, 0x5b, 0x2b,
+    0x91, 0x0f, 0xa7, 0xdb, 0x00, 0x5b, 0x31, 0xd1, 0x52, 0x77, 0x01, 0x1d,
+    0xb8, 0xc2, 0x00, 0x44, 0x01, 0x11, 0xb0, 0x44, 0x00, 0x74, 0xc0, 0x5b,
+    0x3d, 0xc4, 0xe3, 0x7b, 0x0f, 0xcc, 0xe8, 0xc5, 0x11, 0x55, 0x0f, 0xa1,
+    0x80, 0x49, 0x53, 0xa9, 0xc0, 0x5b, 0x49, 0x47, 0x34, 0x2f, 0xc0, 0x5b,
+    0x55, 0x46, 0x09, 0x97, 0x40, 0x5b, 0x73, 0x43, 0x00, 0xed, 0xc0, 0x5b,
+    0x91, 0x10, 0x40, 0x5b, 0xbb, 0xc9, 0xb0, 0xe0, 0x01, 0x5f, 0x99, 0xc6,
+    0xbc, 0xf4, 0x01, 0x5f, 0xa1, 0xc8, 0xbd, 0xb2, 0x01, 0x5f, 0xa9, 0xc8,
+    0xbc, 0xf2, 0x01, 0x5f, 0xb1, 0xc8, 0xbb, 0xca, 0x01, 0x5f, 0xb9, 0xc9,
+    0xb3, 0xcb, 0x01, 0x5f, 0xc0, 0x9e, 0x07, 0xf0, 0x03, 0x00, 0x5b, 0xc7,
+    0x9f, 0x07, 0xf0, 0x0b, 0x00, 0x5c, 0x0d, 0xa6, 0x07, 0xf0, 0x43, 0x00,
+    0x5c, 0x47, 0xa5, 0x07, 0xf0, 0x3b, 0x00, 0x5c, 0x6f, 0xa4, 0x07, 0xf0,
+    0x33, 0x00, 0x5c, 0x97, 0xa3, 0x07, 0xf0, 0x2b, 0x00, 0x5c, 0xbf, 0xa2,
+    0x07, 0xf0, 0x23, 0x00, 0x5c, 0xe7, 0xa1, 0x07, 0xf0, 0x1b, 0x00, 0x5d,
+    0x0f, 0xa0, 0x07, 0xf0, 0x12, 0x00, 0x5d, 0x37, 0x42, 0x00, 0x91, 0xc0,
+    0x5d, 0x5f, 0xc5, 0x0a, 0x8a, 0x05, 0x30, 0x69, 0xc9, 0x11, 0xf6, 0x05,
+    0x30, 0x71, 0xcd, 0x2c, 0xb2, 0x05, 0x30, 0x79, 0x46, 0x09, 0x97, 0x40,
+    0x5d, 0x6b, 0x46, 0x05, 0x87, 0xc0, 0x5d, 0x8f, 0x42, 0x00, 0x36, 0xc0,
+    0x5d, 0xd2, 0xc5, 0xda, 0xdd, 0x01, 0x09, 0x18, 0x45, 0x00, 0xba, 0xc0,
+    0x5d, 0xe4, 0x45, 0x2b, 0x5f, 0x40, 0x5e, 0x22, 0x5f, 0x0c, 0x84, 0xc0,
+    0x5e, 0x56, 0xcc, 0x82, 0x7d, 0x01, 0x18, 0xb8, 0xc8, 0xb7, 0x0a, 0x0f,
+    0xa7, 0xe1, 0x00, 0x40, 0x5e, 0x62, 0x4f, 0x0b, 0x17, 0xc0, 0x5e, 0x6e,
+    0x4d, 0x29, 0xb9, 0x40, 0x5e, 0xee, 0xcc, 0x81, 0xc9, 0x01, 0x11, 0x81,
+    0xc7, 0xc2, 0x0a, 0x0f, 0x9e, 0x81, 0xc4, 0xe3, 0x0b, 0x0f, 0x98, 0x58,
+    0xcb, 0x96, 0x69, 0x01, 0x0c, 0x49, 0xcd, 0x3f, 0xe2, 0x01, 0x0a, 0xf1,
+    0x08, 0xc0, 0x5f, 0x6e, 0x16, 0xc0, 0x5f, 0x7a, 0x44, 0x05, 0x14, 0x40,
+    0x5f, 0x86, 0x00, 0xc0, 0x5f, 0xac, 0x46, 0xcc, 0xa1, 0xc0, 0x5f, 0xf6,
+    0x45, 0xdd, 0x6c, 0x40, 0x60, 0x02, 0xc4, 0x0d, 0x13, 0x0e, 0x9b, 0xc1,
+    0xc3, 0x05, 0x14, 0x0e, 0x9b, 0xb8, 0x09, 0xc0, 0x60, 0x14, 0xca, 0xa4,
+    0xb8, 0x0f, 0x9c, 0x58, 0x43, 0x5c, 0x89, 0xc0, 0x60, 0x26, 0xc3, 0x04,
+    0x85, 0x0f, 0xd6, 0xa0, 0xc5, 0xc4, 0xa4, 0x01, 0x38, 0x39, 0xc9, 0xb1,
+    0xf7, 0x0f, 0xad, 0x68, 0x43, 0x02, 0x31, 0xc0, 0x60, 0x7a, 0xc8, 0xba,
+    0xa2, 0x0f, 0xcb, 0x08, 0x45, 0x92, 0x80, 0xc0, 0x60, 0x98, 0x4a, 0xa7,
+    0xa6, 0xc0, 0x60, 0xbc, 0x45, 0xd8, 0xb2, 0x40, 0x61, 0x22, 0x0d, 0xc0,
+    0x61, 0x40, 0x44, 0x06, 0xb2, 0xc0, 0x61, 0x4c, 0xc3, 0x0f, 0xed, 0x0f,
+    0xa1, 0x10, 0x00, 0xc0, 0x61, 0x7a, 0x02, 0x40, 0x61, 0xa4, 0x10, 0xc0,
+    0x61, 0xb6, 0xce, 0x72, 0xfe, 0x0f, 0xca, 0x48, 0xcc, 0x84, 0x2d, 0x0f,
+    0xa5, 0x69, 0xc9, 0xa8, 0xc1, 0x0f, 0xd3, 0xa0, 0x44, 0x16, 0xcb, 0xc0,
+    0x61, 0xc0, 0x44, 0x83, 0x63, 0x40, 0x61, 0xcc, 0x07, 0xc0, 0x61, 0xd8,
+    0x42, 0x00, 0xa2, 0x40, 0x61, 0xe2, 0x44, 0x0d, 0xde, 0xc0, 0x61, 0xee,
+    0x42, 0x02, 0x32, 0x40, 0x62, 0x12, 0xd8, 0x22, 0xa3, 0x0f, 0xa8, 0xe9,
+    0xd6, 0x08, 0x88, 0x01, 0x1f, 0x01, 0xcd, 0x00, 0x32, 0x01, 0x1e, 0xf1,
+    0xcb, 0x1a, 0x50, 0x01, 0x1e, 0xe1, 0xce, 0x25, 0xad, 0x01, 0x1d, 0xa1,
+    0x42, 0x00, 0xd0, 0xc0, 0x62, 0x1c, 0x46, 0x00, 0x2c, 0xc0, 0x62, 0x26,
+    0x45, 0x00, 0x49, 0xc0, 0x62, 0x30, 0x44, 0x13, 0x1d, 0x40, 0x62, 0x3a,
+    0x42, 0x01, 0x7c, 0xc0, 0x62, 0x49, 0xc9, 0xb0, 0xce, 0x01, 0x19, 0x80,
+    0x56, 0x30, 0x22, 0xc0, 0x62, 0x55, 0xd6, 0x2c, 0x70, 0x0f, 0x89, 0x50,
+    0xc2, 0x00, 0x8e, 0x0f, 0xcd, 0xbb, 0x00, 0x62, 0x67, 0xc4, 0x7f, 0x35,
+    0x0f, 0xcf, 0x80, 0x8f, 0x0f, 0xb4, 0x53, 0x00, 0x62, 0x6d, 0xc2, 0x00,
+    0x74, 0x0f, 0xb4, 0x31, 0xcc, 0x84, 0xd5, 0x01, 0x09, 0x11, 0x05, 0xc0,
+    0x62, 0x73, 0x42, 0x05, 0x26, 0x40, 0x62, 0x7f, 0x43, 0x01, 0x95, 0xc0,
+    0x62, 0x8b, 0x49, 0x89, 0xf4, 0xc0, 0x62, 0x97, 0x44, 0x0b, 0x26, 0xc0,
+    0x62, 0xbf, 0xc5, 0x33, 0x24, 0x01, 0x02, 0xe9, 0xcb, 0x95, 0x1f, 0x0f,
+    0xa9, 0x88, 0x87, 0x01, 0x15, 0x43, 0x00, 0x62, 0xf3, 0xc4, 0xe3, 0xd3,
+    0x0f, 0x9d, 0xd0, 0x12, 0xc0, 0x62, 0xf9, 0xc2, 0x02, 0xa7, 0x0f, 0xce,
+    0x62, 0x00, 0x63, 0x05, 0x08, 0xc0, 0x63, 0x0b, 0x0e, 0xc0, 0x63, 0x21,
+    0x06, 0xc0, 0x63, 0x2b, 0x11, 0xc0, 0x63, 0x45, 0x05, 0xc0, 0x63, 0x51,
+    0x03, 0xc0, 0x63, 0x67, 0x0a, 0xc0, 0x63, 0x7f, 0x15, 0xc0, 0x63, 0x8b,
+    0x07, 0xc0, 0x63, 0x9b, 0x42, 0x00, 0x74, 0xc0, 0x63, 0xb7, 0x42, 0x01,
+    0x4a, 0xc0, 0x63, 0xc3, 0x0f, 0xc0, 0x63, 0xcf, 0x09, 0xc0, 0x63, 0xe1,
+    0xc5, 0xdb, 0xb9, 0x0e, 0x99, 0xd9, 0xd3, 0x40, 0x2e, 0x0e, 0x99, 0xb9,
+    0x14, 0xc0, 0x63, 0xfc, 0x12, 0xc0, 0x64, 0x06, 0x0d, 0xc0, 0x64, 0x16,
+    0x04, 0xc0, 0x64, 0x22, 0xc3, 0x85, 0x26, 0x0e, 0x98, 0xe9, 0xcc, 0x8a,
+    0xb1, 0x0e, 0x98, 0x88, 0x14, 0xc0, 0x64, 0x34, 0xd2, 0x4b, 0x17, 0x0f,
+    0x9b, 0xa9, 0xc3, 0x3a, 0x48, 0x0f, 0xd6, 0xb0, 0x07, 0xc0, 0x64, 0x40,
+    0x44, 0xcd, 0xca, 0x40, 0x64, 0x52, 0x96, 0x01, 0x37, 0xd1, 0xc7, 0x80,
+    0xa2, 0x01, 0x05, 0xc1, 0xd4, 0x3b, 0x60, 0x0f, 0x9d, 0xf0, 0xd7, 0x2a,
+    0x82, 0x01, 0x3a, 0x29, 0xc2, 0x00, 0x29, 0x0f, 0xa0, 0x2a, 0x00, 0x64,
+    0x76, 0xc7, 0x17, 0x6b, 0x01, 0x1f, 0x91, 0x47, 0x50, 0x5d, 0x40, 0x64,
+    0x7c, 0x00, 0x40, 0x64, 0x88, 0x45, 0xd8, 0x17, 0xc0, 0x64, 0x97, 0x4b,
+    0x96, 0x8a, 0xc0, 0x64, 0xbf, 0xc7, 0x11, 0x53, 0x0f, 0xb1, 0x58, 0x42,
+    0x00, 0x6f, 0x40, 0x64, 0xcb, 0x15, 0xc0, 0x64, 0xd1, 0x45, 0x01, 0xc3,
+    0xc0, 0x64, 0xe1, 0x0e, 0xc0, 0x65, 0x2d, 0x52, 0x47, 0xb7, 0xc0, 0x65,
+    0x39, 0x46, 0x09, 0x97, 0xc0, 0x65, 0x43, 0x4b, 0x6f, 0xc7, 0xc0, 0x65,
+    0x6d, 0xc9, 0xac, 0x96, 0x00, 0x7d, 0xf3, 0x00, 0x65, 0x9e, 0x52, 0x4c,
+    0x13, 0x40, 0x65, 0xa4, 0x47, 0x02, 0x0e, 0xc0, 0x65, 0xbc, 0x42, 0x00,
+    0xa2, 0xc0, 0x65, 0xce, 0xce, 0x6c, 0x6e, 0x01, 0x6b, 0x81, 0xd0, 0x57,
+    0xe2, 0x01, 0x6b, 0xf8, 0x00, 0xc0, 0x65, 0xd4, 0xc8, 0xbc, 0x32, 0x01,
+    0x71, 0xd0, 0xd3, 0x46, 0x31, 0x0f, 0xdd, 0x81, 0x4a, 0x03, 0x3d, 0x40,
+    0x66, 0x16, 0x00, 0xc0, 0x66, 0x28, 0x47, 0x09, 0x90, 0x40, 0x66, 0x8f,
+    0x47, 0x0a, 0xda, 0xc0, 0x66, 0xa7, 0xc9, 0xb4, 0xbe, 0x00, 0x2c, 0x79,
+    0xc6, 0x59, 0x92, 0x00, 0x2c, 0x51, 0xc9, 0x11, 0xf6, 0x00, 0x2c, 0x49,
+    0x03, 0xc0, 0x66, 0xb3, 0xcd, 0x2c, 0xb2, 0x00, 0x2a, 0xf1, 0x05, 0xc0,
+    0x66, 0xbf, 0x07, 0xc0, 0x66, 0xcb, 0xde, 0x0f, 0x5e, 0x00, 0x2a, 0xc8,
+    0xca, 0xa6, 0x84, 0x0f, 0x9d, 0x41, 0xcd, 0x75, 0xc0, 0x0f, 0xb4, 0xd8,
+    0xce, 0x72, 0x9c, 0x0f, 0x9c, 0xf9, 0xc4, 0x7a, 0xfe, 0x01, 0x5f, 0x28,
+    0x05, 0xc0, 0x66, 0xd7, 0x4d, 0x29, 0xb9, 0xc0, 0x66, 0xe3, 0xcf, 0x6b,
+    0x52, 0x0f, 0x4a, 0x21, 0xd0, 0x58, 0x92, 0x0f, 0x4a, 0x29, 0x47, 0x63,
+    0xff, 0xc0, 0x67, 0x63, 0xc5, 0x08, 0x09, 0x0f, 0x4a, 0x39, 0x10, 0xc0,
+    0x67, 0x6f, 0x46, 0x09, 0x97, 0xc0, 0x67, 0x7b, 0x48, 0x10, 0xb4, 0x40,
+    0x67, 0x9f, 0x04, 0xc0, 0x67, 0xab, 0x05, 0xc0, 0x67, 0xcc, 0x06, 0xc0,
+    0x67, 0xe0, 0x12, 0xc0, 0x67, 0xec, 0x16, 0xc0, 0x68, 0x00, 0x14, 0xc0,
+    0x68, 0x1b, 0x18, 0xc0, 0x68, 0x28, 0x15, 0xc0, 0x68, 0x32, 0x03, 0xc0,
+    0x68, 0x58, 0x0e, 0xc0, 0x68, 0x86, 0x42, 0x00, 0xec, 0xc0, 0x68, 0x92,
+    0x0f, 0xc0, 0x68, 0x9e, 0x42, 0x01, 0x4a, 0xc0, 0x68, 0xb3, 0xc5, 0x61,
+    0xc0, 0x0f, 0xb8, 0x19, 0x43, 0x03, 0xd3, 0xc0, 0x68, 0xbd, 0xc4, 0x83,
+    0x39, 0x0f, 0xb8, 0x11, 0x09, 0xc0, 0x68, 0xc9, 0x44, 0x1a, 0x05, 0xc0,
+    0x68, 0xd5, 0xc3, 0xdd, 0x05, 0x0f, 0xba, 0x31, 0xc5, 0xdd, 0xe4, 0x0f,
+    0xba, 0xa9, 0x0a, 0x40, 0x68, 0xe4, 0xda, 0x1a, 0xcc, 0x01, 0x36, 0xa9,
+    0xce, 0x72, 0x72, 0x01, 0x1c, 0x38, 0xc4, 0xd9, 0x17, 0x01, 0x34, 0xb9,
+    0xc8, 0x8d, 0x71, 0x01, 0x09, 0xa9, 0xc2, 0x00, 0x61, 0x00, 0x00, 0x38,
+    0xce, 0x73, 0xde, 0x01, 0x19, 0x71, 0xc8, 0x07, 0x5f, 0x01, 0x12, 0x60,
+    0xcb, 0x23, 0xa0, 0x01, 0x12, 0x51, 0xc2, 0x00, 0xf1, 0x01, 0x12, 0x42,
+    0x00, 0x68, 0xee, 0xc9, 0xae, 0x07, 0x0f, 0xb7, 0xd1, 0x0f, 0x40, 0x68,
+    0xf4, 0xc8, 0xbf, 0xca, 0x0f, 0xb7, 0x61, 0xc9, 0xb1, 0x1f, 0x0f, 0xb7,
+    0x58, 0x51, 0x52, 0x22, 0xc0, 0x69, 0x00, 0xcb, 0x99, 0xa2, 0x0f, 0xd6,
+    0x00, 0x4b, 0x05, 0xf7, 0xc0, 0x69, 0x18, 0xce, 0x6f, 0x54, 0x0f, 0xa7,
+    0xb0, 0xc2, 0x00, 0x49, 0x01, 0x11, 0x03, 0x00, 0x69, 0x38, 0xca, 0x9d,
+    0x24, 0x01, 0x09, 0x59, 0xc9, 0x25, 0xca, 0x0f, 0xa5, 0x11, 0xc7, 0xca,
+    0x84, 0x0f, 0xb1, 0x01, 0xcb, 0x90, 0x7b, 0x0f, 0xb1, 0x38, 0x14, 0xc0,
+    0x69, 0x3e, 0x44, 0x0b, 0x02, 0xc0, 0x69, 0x4a, 0xcc, 0x8c, 0x01, 0x0f,
+    0xb1, 0x90, 0xcb, 0x8b, 0x06, 0x01, 0x30, 0x51, 0xc9, 0xa8, 0x43, 0x08,
+    0x0c, 0xe0, 0x0e, 0xc0, 0x69, 0x55, 0x10, 0xc0, 0x69, 0x5f, 0x06, 0xc0,
+    0x69, 0x75, 0x16, 0xc0, 0x69, 0x83, 0x05, 0xc0, 0x69, 0x91, 0x83, 0x08,
+    0xb8, 0x93, 0x00, 0x69, 0x9b, 0x0c, 0xc0, 0x69, 0xa1, 0x04, 0xc0, 0x69,
+    0xab, 0x09, 0xc0, 0x69, 0xb5, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0x89, 0xc2,
+    0x0d, 0xf6, 0x08, 0xb8, 0x79, 0xc2, 0x00, 0x39, 0x08, 0xb8, 0x69, 0xc2,
+    0x01, 0xc3, 0x08, 0xb8, 0x49, 0x12, 0xc0, 0x69, 0xbf, 0x0d, 0x40, 0x69,
+    0xc9, 0xc8, 0x91, 0x9a, 0x08, 0xb9, 0xf9, 0x44, 0x00, 0xbb, 0x40, 0x69,
+    0xd3, 0xc5, 0x28, 0xee, 0x08, 0xb9, 0xd9, 0xc2, 0x00, 0xc4, 0x08, 0xb9,
+    0xd0, 0xc4, 0x26, 0x78, 0x08, 0xb9, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0xb9,
+    0xc1, 0x15, 0xc0, 0x69, 0xe3, 0x08, 0xc0, 0x69, 0xef, 0x16, 0xc0, 0x69,
+    0xfb, 0xc3, 0x05, 0x14, 0x08, 0xb9, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0xb9,
+    0x80, 0x83, 0x08, 0xb9, 0x03, 0x00, 0x6a, 0x07, 0x91, 0x08, 0xb9, 0x41,
+    0x87, 0x08, 0xb9, 0x31, 0x97, 0x08, 0xb9, 0x23, 0x00, 0x6a, 0x17, 0x8b,
+    0x08, 0xb9, 0x12, 0x00, 0x6a, 0x1b, 0x0e, 0xc0, 0x6a, 0x1f, 0xc2, 0x00,
+    0x39, 0x08, 0xb8, 0xf0, 0xc6, 0x6a, 0xfb, 0x01, 0x08, 0x01, 0xc5, 0xd6,
+    0xdc, 0x0f, 0xd4, 0xb8, 0xd3, 0x46, 0x0b, 0x01, 0x03, 0x69, 0xd2, 0x4d,
+    0x69, 0x01, 0x03, 0x58, 0xc4, 0x01, 0x96, 0x01, 0x4c, 0xf9, 0xc5, 0x09,
+    0x02, 0x00, 0x05, 0xa0, 0x42, 0x00, 0xe3, 0xc0, 0x6a, 0x29, 0xc5, 0xde,
+    0x3e, 0x01, 0x1b, 0xd3, 0x00, 0x6a, 0x38, 0xc5, 0x9b, 0xd5, 0x01, 0x1b,
+    0xab, 0x00, 0x6a, 0x3e, 0x0b, 0xc0, 0x6a, 0x44, 0xd0, 0x5c, 0xa2, 0x01,
+    0x1b, 0xb9, 0x14, 0xc0, 0x6a, 0x53, 0x42, 0x02, 0xae, 0xc0, 0x6a, 0x5f,
+    0x06, 0xc0, 0x6a, 0x69, 0x15, 0xc0, 0x6a, 0x7b, 0xc5, 0xd7, 0x8b, 0x01,
+    0x1b, 0x61, 0x05, 0xc0, 0x6a, 0x91, 0xd6, 0x31, 0x14, 0x01, 0x1b, 0x49,
+    0xcf, 0x64, 0x86, 0x01, 0x1b, 0x41, 0x44, 0x00, 0x49, 0xc0, 0x6a, 0x9d,
+    0x44, 0xe1, 0x43, 0xc0, 0x6a, 0xa9, 0xcd, 0x7d, 0xed, 0x01, 0x1a, 0x00,
+    0x42, 0x00, 0x79, 0xc0, 0x6a, 0xb5, 0xd8, 0x23, 0x63, 0x00, 0x04, 0xf8,
+    0xc7, 0x2d, 0x87, 0x00, 0x01, 0x39, 0xc4, 0x66, 0x29, 0x01, 0x5f, 0x20,
+    0xd1, 0x48, 0x11, 0x08, 0x59, 0xc9, 0x47, 0x02, 0x0e, 0x40, 0x6a, 0xc1,
+    0xc4, 0x3d, 0xd8, 0x0f, 0x9f, 0xd1, 0xc6, 0x36, 0x23, 0x00, 0x01, 0x30,
+    0xca, 0xa7, 0xc4, 0x08, 0x08, 0x11, 0x47, 0x34, 0x2f, 0xc0, 0x6b, 0x42,
+    0x19, 0xc0, 0x6b, 0x69, 0xd9, 0x20, 0xc1, 0x08, 0x09, 0xe1, 0xdc, 0x14,
+    0xbd, 0x08, 0x09, 0xe9, 0x48, 0x14, 0xc4, 0x40, 0x6b, 0x75, 0x4a, 0x9f,
+    0x0e, 0xc0, 0x6b, 0x81, 0xc9, 0xb0, 0x23, 0x0f, 0xca, 0x50, 0xd4, 0x3c,
+    0xb4, 0x0f, 0xbd, 0x89, 0xcb, 0x58, 0xc7, 0x0f, 0xbd, 0x21, 0x46, 0x01,
+    0xfc, 0xc0, 0x6b, 0xa3, 0x15, 0xc0, 0x6b, 0xaf, 0xd5, 0x34, 0x8e, 0x0f,
+    0xbd, 0xe8, 0x43, 0x00, 0x7a, 0xc0, 0x6b, 0xbb, 0xd4, 0x3e, 0x30, 0x0f,
+    0x9b, 0xf0, 0xc3, 0x1e, 0x19, 0x01, 0x16, 0x43, 0x00, 0x6b, 0xee, 0x0e,
+    0xc0, 0x6b, 0xf4, 0xca, 0x9b, 0xc6, 0x0f, 0x9f, 0xc8, 0xc8, 0x2f, 0x03,
+    0x0f, 0xb6, 0x48, 0x8d, 0x0f, 0xab, 0x73, 0x00, 0x6b, 0xfe, 0xc6, 0xc9,
+    0xcf, 0x0f, 0xd4, 0x18, 0xcb, 0x95, 0xfb, 0x0f, 0x9c, 0xa8, 0x47, 0x02,
+    0x0e, 0xc0, 0x6c, 0x0b, 0x4d, 0x7f, 0x25, 0x40, 0x6c, 0x95, 0x4b, 0x96,
+    0x48, 0xc0, 0x6c, 0xa9, 0xc4, 0xae, 0x42, 0x0f, 0x99, 0xe1, 0xc5, 0xd9,
+    0x98, 0x0f, 0xa1, 0x08, 0x42, 0x00, 0x3b, 0xc0, 0x6c, 0xd0, 0xc9, 0x95,
+    0x84, 0x01, 0x21, 0x10, 0x00, 0xc0, 0x6c, 0xd8, 0xc7, 0xc6, 0xa2, 0x0f,
+    0xd6, 0x80, 0xc2, 0x00, 0x81, 0x0f, 0xd4, 0xa9, 0x8d, 0x0f, 0x9f, 0x33,
+    0x00, 0x6c, 0xe4, 0xc3, 0x09, 0xe5, 0x0f, 0x9a, 0x60, 0x0e, 0xc0, 0x6c,
+    0xea, 0x46, 0x77, 0x20, 0x40, 0x6c, 0xfa, 0xc3, 0x00, 0x3c, 0x0f, 0xcf,
+    0xd3, 0x00, 0x6d, 0x30, 0xc5, 0xdb, 0x46, 0x01, 0x35, 0xf1, 0x47, 0xc1,
+    0x9a, 0x40, 0x6d, 0x36, 0xc3, 0x09, 0x3b, 0x0f, 0xcd, 0x09, 0xde, 0x0f,
+    0xd6, 0x0f, 0x9f, 0xc0, 0x00, 0x40, 0x6d, 0x48, 0x47, 0x02, 0x0e, 0xc0,
+    0x6d, 0x60, 0x42, 0x00, 0x99, 0xc0, 0x6d, 0xa5, 0xc7, 0xc0, 0x3c, 0x05,
+    0x37, 0x91, 0xc9, 0x11, 0xf6, 0x05, 0x37, 0x99, 0xc9, 0xa8, 0x55, 0x05,
+    0x37, 0xb1, 0xcd, 0x2c, 0xb2, 0x05, 0x37, 0xb8, 0x0d, 0xc0, 0x6d, 0xaf,
+    0xcb, 0x93, 0x25, 0x0f, 0xa1, 0x59, 0xc2, 0x00, 0x45, 0x0f, 0xca, 0x98,
+    0x43, 0x40, 0x85, 0xc0, 0x6d, 0xbd, 0xc4, 0xcd, 0x51, 0x0f, 0xa8, 0x59,
+    0x8a, 0x0f, 0xb6, 0x02, 0x00, 0x6d, 0xd9, 0x00, 0xc0, 0x6d, 0xdf, 0xc8,
+    0xbd, 0xc2, 0x0f, 0xa4, 0x40, 0xca, 0x9e, 0xc8, 0x0f, 0xb6, 0x21, 0xcb,
+    0x90, 0xc8, 0x0f, 0xca, 0xb1, 0xc2, 0x05, 0x03, 0x0f, 0xcb, 0x78, 0xc9,
+    0xb3, 0x0e, 0x01, 0x05, 0xf9, 0xc7, 0x82, 0x99, 0x0f, 0xd7, 0x30, 0xc5,
+    0xd8, 0xc6, 0x0f, 0x9d, 0x89, 0xc6, 0xd3, 0x97, 0x0f, 0xcf, 0x10, 0xca,
+    0xa0, 0x94, 0x0f, 0x9c, 0x11, 0x86, 0x0f, 0xa1, 0x30, 0xcf, 0x61, 0xd4,
+    0x01, 0x4f, 0xc9, 0xc7, 0x27, 0x5d, 0x01, 0x4f, 0xc0, 0x87, 0x0f, 0xb5,
+    0x91, 0xc3, 0x1d, 0xb1, 0x0f, 0xb5, 0xa0, 0xc3, 0x00, 0x5f, 0x0f, 0xcd,
+    0x59, 0x44, 0x7c, 0x59, 0xc0, 0x6d, 0xeb, 0xca, 0x9d, 0xba, 0x0f, 0xa4,
+    0x99, 0xd0, 0x57, 0x82, 0x0f, 0x9e, 0xb1, 0x14, 0xc0, 0x6e, 0x03, 0xc2,
+    0x05, 0x26, 0x0f, 0xd6, 0xc0, 0xc9, 0xac, 0x45, 0x01, 0x19, 0x63, 0x00,
+    0x6e, 0x0f, 0x45, 0xb1, 0x74, 0xc0, 0x6e, 0x15, 0x16, 0x40, 0x6e, 0x47,
+    0x00, 0xc0, 0x6e, 0x53, 0xc8, 0xbd, 0xaa, 0x0f, 0xb6, 0x70, 0xc4, 0x0b,
+    0xcb, 0x01, 0x13, 0x61, 0xc7, 0x00, 0x90, 0x01, 0x09, 0xb0, 0xc5, 0xb2,
+    0x39, 0x0f, 0x9b, 0xd1, 0xc3, 0x0f, 0xed, 0x0f, 0xd5, 0x90, 0xc3, 0xe6,
+    0x11, 0x0f, 0xcc, 0x58, 0xc5, 0x00, 0xef, 0x0f, 0xb4, 0x79, 0x16, 0x40,
+    0x6e, 0x65, 0xc4, 0xdf, 0x87, 0x01, 0x2e, 0x71, 0xc2, 0x00, 0x3d, 0x01,
+    0x01, 0x13, 0x00, 0x6e, 0x71, 0xc4, 0x2a, 0xcc, 0x0f, 0xab, 0x5a, 0x00,
+    0x6e, 0x77, 0x46, 0x77, 0x20, 0x40, 0x6e, 0x7d, 0x4b, 0x6f, 0xc7, 0xc0,
+    0x6e, 0x95, 0x47, 0x02, 0x0e, 0x40, 0x6e, 0x9d, 0xc4, 0x4c, 0x31, 0x0f,
+    0xce, 0x59, 0x95, 0x0f, 0xd7, 0x38, 0x06, 0xc0, 0x6e, 0xfb, 0x42, 0x00,
+    0x07, 0xc0, 0x6f, 0x07, 0xc2, 0x00, 0x3b, 0x0f, 0xcf, 0x88, 0x0b, 0xc0,
+    0x6f, 0x11, 0x44, 0xdf, 0xf3, 0x40, 0x6f, 0x1b, 0x44, 0x9b, 0x5b, 0xc0,
+    0x6f, 0x3b, 0xc8, 0xbf, 0x92, 0x0f, 0xc8, 0x71, 0xc5, 0xdd, 0x3f, 0x0f,
+    0xcb, 0x31, 0xc2, 0x00, 0x7a, 0x0f, 0xcf, 0xc8, 0x03, 0xc0, 0x6f, 0x4d,
+    0xc2, 0x00, 0x5f, 0x00, 0x16, 0xc0, 0x09, 0xc0, 0x6f, 0x5d, 0x0d, 0xc0,
+    0x6f, 0x6f, 0x03, 0xc0, 0x6f, 0x92, 0x15, 0xc0, 0x6f, 0xa4, 0x06, 0xc0,
+    0x6f, 0xc1, 0x1b, 0xc0, 0x6f, 0xd1, 0x08, 0xc0, 0x6f, 0xdb, 0x42, 0x11,
+    0xee, 0xc0, 0x6f, 0xed, 0x0b, 0xc0, 0x6f, 0xff, 0x07, 0xc0, 0x70, 0x0f,
+    0x0f, 0xc0, 0x70, 0x31, 0x16, 0xc0, 0x70, 0x3d, 0x0e, 0xc0, 0x70, 0x4f,
+    0x11, 0xc0, 0x70, 0x59, 0x12, 0xc0, 0x70, 0x71, 0xcc, 0x87, 0x5d, 0x0e,
+    0x83, 0x51, 0x42, 0x02, 0x41, 0xc0, 0x70, 0x87, 0xc4, 0xc6, 0xc9, 0x0e,
+    0x82, 0x01, 0x14, 0x40, 0x70, 0x93, 0xc4, 0x26, 0x78, 0x08, 0xe3, 0x13,
+    0x00, 0x70, 0x9f, 0xc5, 0x06, 0xdb, 0x08, 0xe3, 0x0b, 0x00, 0x70, 0xa5,
+    0x15, 0xc0, 0x70, 0xa9, 0x08, 0xc0, 0x70, 0xbb, 0x16, 0xc0, 0x70, 0xc3,
+    0xc3, 0x05, 0x14, 0x08, 0xe2, 0xd0, 0x45, 0x09, 0x98, 0xc0, 0x70, 0xd1,
+    0xcb, 0x97, 0xf5, 0x08, 0xe2, 0x11, 0xc4, 0x19, 0x53, 0x08, 0xe2, 0x08,
+    0x9f, 0x08, 0xe2, 0x29, 0x9e, 0x08, 0xe2, 0x20, 0x03, 0xc0, 0x70, 0xf5,
+    0x42, 0x07, 0xb2, 0xc0, 0x71, 0x01, 0xcb, 0x1e, 0x89, 0x08, 0xe1, 0xe0,
+    0x03, 0xc0, 0x71, 0x0d, 0x91, 0x08, 0xe1, 0xd1, 0x87, 0x08, 0xe1, 0xc1,
+    0x48, 0xb2, 0x2d, 0xc0, 0x71, 0x19, 0x97, 0x08, 0xe1, 0x93, 0x00, 0x71,
+    0x24, 0x8b, 0x08, 0xe1, 0x82, 0x00, 0x71, 0x28, 0xc2, 0x00, 0xd0, 0x08,
+    0xe1, 0x71, 0x15, 0xc0, 0x71, 0x2c, 0x18, 0xc0, 0x71, 0x3c, 0xc2, 0x00,
+    0xdb, 0x08, 0xe1, 0x49, 0xc2, 0x00, 0x39, 0x08, 0xe1, 0x41, 0xc2, 0x19,
+    0x2c, 0x08, 0xe1, 0x39, 0xc2, 0x01, 0xc3, 0x08, 0xe1, 0x31, 0x04, 0xc0,
+    0x71, 0x46, 0x12, 0xc0, 0x71, 0x50, 0x10, 0xc0, 0x71, 0x5a, 0x06, 0xc0,
+    0x71, 0x70, 0x16, 0xc0, 0x71, 0x7e, 0x0c, 0xc0, 0x71, 0x8c, 0x05, 0xc0,
+    0x71, 0x96, 0x09, 0xc0, 0x71, 0xa0, 0x0d, 0xc0, 0x71, 0xaa, 0x83, 0x08,
+    0xe0, 0x03, 0x00, 0x71, 0xb4, 0x91, 0x08, 0xe0, 0x61, 0x87, 0x08, 0xe0,
+    0x51, 0x97, 0x08, 0xe0, 0x23, 0x00, 0x71, 0xc0, 0x8b, 0x08, 0xe0, 0x12,
+    0x00, 0x71, 0xc4, 0x43, 0x00, 0x29, 0xc0, 0x71, 0xc8, 0x00, 0x40, 0x71,
+    0xf6, 0x45, 0x00, 0x2c, 0xc0, 0x72, 0x15, 0x44, 0x00, 0x49, 0xc0, 0x72,
+    0x21, 0x06, 0x40, 0x72, 0x2b, 0xdb, 0x18, 0x6f, 0x01, 0x3f, 0x00, 0xc2,
+    0x00, 0xbf, 0x01, 0x11, 0x43, 0x00, 0x72, 0x3d, 0xc3, 0x02, 0x9b, 0x01,
+    0x11, 0x3a, 0x00, 0x72, 0x41, 0xcd, 0x7e, 0xa3, 0x0f, 0xa8, 0x79, 0x4a,
+    0xa0, 0x1c, 0x40, 0x72, 0x47, 0xc6, 0x02, 0x0e, 0x0f, 0xa4, 0x61, 0xc5,
+    0xd6, 0x05, 0x0f, 0x9f, 0x48, 0xca, 0x9b, 0x44, 0x0f, 0xcf, 0xa1, 0xc2,
+    0x11, 0xa5, 0x0f, 0xd5, 0xb8, 0x00, 0xc0, 0x72, 0x53, 0x46, 0x01, 0x4a,
+    0xc0, 0x72, 0xa2, 0x02, 0x40, 0x72, 0xe9, 0xc7, 0xc8, 0x3f, 0x0f, 0xcb,
+    0x61, 0xd3, 0x45, 0x01, 0x0f, 0x9a, 0x18, 0xc4, 0x0b, 0x66, 0x0f, 0xa0,
+    0x30, 0x4b, 0x37, 0x43, 0xc0, 0x73, 0x05, 0xd8, 0x24, 0xe3, 0x01, 0x16,
+    0xd1, 0x45, 0x00, 0x8c, 0xc0, 0x73, 0x11, 0x11, 0xc0, 0x73, 0x23, 0x03,
+    0xc0, 0x73, 0x2f, 0xc4, 0x00, 0xba, 0x00, 0x01, 0xe1, 0xcf, 0x69, 0x18,
+    0x01, 0x55, 0x32, 0x00, 0x73, 0x3b, 0x47, 0x02, 0x0e, 0xc0, 0x73, 0x41,
+    0x46, 0x09, 0x97, 0xc0, 0x73, 0x99, 0x4c, 0x11, 0xe2, 0xc0, 0x73, 0xbd,
+    0x15, 0xc0, 0x73, 0xcd, 0x4f, 0x30, 0x90, 0xc0, 0x73, 0xd9, 0x4b, 0x6f,
+    0xc7, 0x40, 0x73, 0xfb, 0x42, 0x00, 0x2f, 0xc0, 0x74, 0x17, 0xd6, 0x21,
+    0x9d, 0x0f, 0xb3, 0x90, 0x47, 0x02, 0x0e, 0xc0, 0x74, 0x24, 0x4c, 0x11,
+    0xe2, 0x40, 0x74, 0x9a, 0x07, 0xc0, 0x74, 0xa6, 0x0d, 0x40, 0x74, 0xb0,
+    0x43, 0xb6, 0x2f, 0xc0, 0x74, 0xbc, 0xd3, 0x44, 0x1d, 0x01, 0x96, 0x78,
+    0xc4, 0x1e, 0xf2, 0x0f, 0xa4, 0x20, 0xcf, 0x63, 0xe1, 0x08, 0x49, 0xf9,
+    0x47, 0x02, 0x0e, 0x40, 0x74, 0xde, 0x83, 0x08, 0x14, 0x03, 0x00, 0x75,
+    0x40, 0x87, 0x08, 0x14, 0x0b, 0x00, 0x75, 0x44, 0x84, 0x08, 0x14, 0x13,
+    0x00, 0x75, 0x48, 0x89, 0x08, 0x14, 0x21, 0x86, 0x08, 0x14, 0x29, 0x8b,
+    0x08, 0x14, 0x31, 0x99, 0x08, 0x14, 0x39, 0x9c, 0x08, 0x14, 0x41, 0x96,
+    0x08, 0x14, 0xbb, 0x00, 0x75, 0x4c, 0x8c, 0x08, 0x14, 0x51, 0x8d, 0x08,
+    0x14, 0x5b, 0x00, 0x75, 0x54, 0x93, 0x08, 0x14, 0x61, 0x8e, 0x08, 0x14,
+    0x69, 0x8f, 0x08, 0x14, 0x73, 0x00, 0x75, 0x58, 0x90, 0x08, 0x14, 0x7b,
+    0x00, 0x75, 0x5c, 0x97, 0x08, 0x14, 0x91, 0x92, 0x08, 0x14, 0x99, 0x94,
+    0x08, 0x14, 0xa9, 0x95, 0x08, 0x14, 0xb1, 0x8a, 0x08, 0x14, 0xd9, 0x9a,
+    0x08, 0x14, 0xe0, 0x42, 0x09, 0x3b, 0xc0, 0x75, 0x60, 0xc6, 0x8f, 0xfc,
+    0x01, 0x05, 0xf0, 0x15, 0xc0, 0x75, 0x6d, 0x47, 0x02, 0x0e, 0xc0, 0x75,
+    0x79, 0x05, 0xc0, 0x75, 0xc9, 0x52, 0x48, 0xc5, 0x40, 0x75, 0xd5, 0x00,
+    0x40, 0x75, 0xeb, 0xc2, 0x05, 0x03, 0x0f, 0x9f, 0xb9, 0xc5, 0xd8, 0x71,
+    0x0f, 0xcb, 0xe0, 0xc8, 0xbc, 0x7a, 0x0f, 0xa0, 0xf1, 0xc3, 0x01, 0xe5,
+    0x0f, 0xd4, 0xe0, 0x47, 0x02, 0x0e, 0xc0, 0x75, 0xf7, 0xc8, 0x22, 0x83,
+    0x00, 0x75, 0x79, 0x4b, 0x6f, 0xc7, 0xc0, 0x76, 0x4e, 0x15, 0xc0, 0x76,
+    0x7b, 0xc5, 0xdc, 0x54, 0x00, 0x76, 0x31, 0x49, 0xb2, 0x63, 0xc0, 0x76,
+    0x87, 0xd1, 0x52, 0xaa, 0x00, 0x76, 0x61, 0xc9, 0xae, 0x97, 0x00, 0x76,
+    0x69, 0x46, 0x09, 0x97, 0xc0, 0x76, 0x97, 0x43, 0x60, 0xe8, 0x40, 0x76,
+    0xbb, 0x46, 0x00, 0x2c, 0xc0, 0x76, 0xc7, 0x45, 0x00, 0x49, 0xc0, 0x76,
+    0xef, 0x44, 0x02, 0x9b, 0xc0, 0x77, 0x0b, 0x45, 0x01, 0xce, 0xc0, 0x77,
+    0x15, 0xce, 0x6b, 0x9c, 0x01, 0x38, 0x09, 0x44, 0x05, 0x14, 0xc0, 0x77,
+    0x30, 0x16, 0xc0, 0x77, 0x3c, 0xd2, 0x4a, 0x75, 0x0f, 0xdc, 0x21, 0xd3,
+    0x3f, 0xe2, 0x0f, 0xdc, 0x30, 0x46, 0x01, 0xfc, 0xc0, 0x77, 0x48, 0x16,
+    0xc0, 0x77, 0x5a, 0x15, 0xc0, 0x77, 0x66, 0xd0, 0x58, 0x62, 0x0f, 0xc1,
+    0xe9, 0xd1, 0x56, 0xd9, 0x0f, 0xc1, 0xa9, 0x03, 0xc0, 0x77, 0x72, 0xcf,
+    0x61, 0x4d, 0x01, 0x3f, 0x81, 0x06, 0xc0, 0x77, 0x81, 0xcd, 0x7c, 0xa8,
+    0x01, 0x0e, 0x41, 0x0a, 0xc0, 0x77, 0x8d, 0xc6, 0xca, 0xa3, 0x0f, 0xb3,
+    0x69, 0x46, 0x04, 0x8f, 0x40, 0x77, 0x99, 0x46, 0x03, 0x13, 0xc0, 0x77,
+    0xa5, 0x4e, 0x6c, 0xfa, 0xc0, 0x77, 0xb1, 0xcc, 0x4e, 0x35, 0x0f, 0xa9,
+    0xd1, 0xd1, 0x56, 0x2f, 0x0f, 0xb7, 0x31, 0xc8, 0x2e, 0x20, 0x0f, 0xb7,
+    0x38, 0xc4, 0x32, 0xbc, 0x01, 0x15, 0x2b, 0x00, 0x77, 0xbd, 0x45, 0x01,
+    0xa2, 0xc0, 0x77, 0xc3, 0xd7, 0x27, 0xfe, 0x01, 0x17, 0x81, 0x45, 0x11,
+    0x17, 0xc0, 0x77, 0xd2, 0xc9, 0xb2, 0xea, 0x01, 0x4b, 0xf1, 0x45, 0x01,
+    0x5d, 0x40, 0x77, 0xf9, 0xc9, 0xb0, 0xd7, 0x0f, 0xcc, 0x21, 0xd7, 0x1f,
+    0x33, 0x01, 0x33, 0x91, 0xc2, 0x00, 0x45, 0x01, 0x11, 0x53, 0x00, 0x78,
+    0x05, 0x16, 0x40, 0x78, 0x09, 0xc8, 0x9c, 0xae, 0x01, 0x1c, 0x61, 0xc5,
+    0xb9, 0x85, 0x01, 0x01, 0xf8, 0xc9, 0xac, 0x4e, 0x01, 0x37, 0x89, 0xcf,
+    0x6a, 0x62, 0x01, 0x30, 0xa0, 0x03, 0xc0, 0x78, 0x15, 0xc4, 0x93, 0xa9,
+    0x08, 0x1c, 0x09, 0x09, 0xc0, 0x78, 0x21, 0x0d, 0xc0, 0x78, 0x2d, 0x06,
+    0xc0, 0x78, 0x39, 0xc2, 0x01, 0x23, 0x08, 0x1c, 0x2b, 0x00, 0x78, 0x45,
+    0xc2, 0x02, 0xa0, 0x08, 0x1c, 0x31, 0x1c, 0xc0, 0x78, 0x4b, 0x16, 0xc0,
+    0x78, 0x55, 0xc3, 0x4a, 0xb9, 0x08, 0x1c, 0x51, 0x15, 0xc0, 0x78, 0x65,
+    0xc5, 0xdd, 0x99, 0x08, 0x1c, 0x69, 0xc3, 0x00, 0x4e, 0x08, 0x1c, 0x71,
+    0xc3, 0x20, 0x18, 0x08, 0x1c, 0x81, 0xc2, 0x05, 0x1c, 0x08, 0x1c, 0xa1,
+    0xc4, 0xe4, 0x97, 0x08, 0x1c, 0xb1, 0xc5, 0xd5, 0xec, 0x08, 0x1c, 0xb9,
+    0x8b, 0x08, 0x1c, 0xd9, 0x97, 0x08, 0x1c, 0xe0, 0x43, 0x11, 0x3c, 0xc0,
+    0x78, 0x75, 0x06, 0xc0, 0x78, 0xd1, 0x14, 0x40, 0x78, 0xe0, 0xc7, 0xc9,
+    0xab, 0x0f, 0xb4, 0x09, 0x0f, 0xc0, 0x78, 0xec, 0xd7, 0x26, 0x8e, 0x01,
+    0x5f, 0xf8, 0x14, 0xc0, 0x78, 0xf8, 0x0a, 0xc0, 0x79, 0x16, 0x10, 0xc0,
+    0x79, 0x34, 0x0d, 0xc0, 0x79, 0x58, 0x42, 0x28, 0x5b, 0xc0, 0x79, 0x76,
+    0x42, 0x01, 0x99, 0xc0, 0x79, 0x82, 0x42, 0x36, 0xa2, 0xc0, 0x79, 0x9a,
+    0x42, 0x2f, 0xf9, 0xc0, 0x79, 0xae, 0x42, 0x14, 0x7d, 0xc0, 0x79, 0xbe,
+    0x19, 0xc0, 0x79, 0xd0, 0x1b, 0xc0, 0x79, 0xe8, 0x0f, 0xc0, 0x79, 0xfa,
+    0x16, 0xc0, 0x7a, 0x18, 0x15, 0x40, 0x7a, 0x36, 0xd7, 0x27, 0x01, 0x01,
+    0x15, 0xc9, 0x84, 0x0f, 0x99, 0xf8, 0x0e, 0xc0, 0x7a, 0x54, 0x12, 0xc0,
+    0x7a, 0x60, 0xcc, 0x8a, 0x99, 0x00, 0x2f, 0x79, 0x45, 0x01, 0xc3, 0xc0,
+    0x7a, 0x6c, 0x47, 0x26, 0x6b, 0x40, 0x7a, 0x7e, 0x16, 0xc0, 0x7a, 0xc8,
+    0x06, 0xc0, 0x7a, 0xd4, 0xce, 0x6f, 0x00, 0x02, 0x6e, 0x19, 0x19, 0xc0,
+    0x7a, 0xe8, 0x42, 0x00, 0x99, 0xc0, 0x7a, 0xf4, 0xd0, 0x5a, 0xb2, 0x02,
+    0x6e, 0x39, 0x15, 0xc0, 0x7a, 0xfe, 0x12, 0xc0, 0x7b, 0x10, 0x08, 0xc0,
+    0x7b, 0x22, 0x09, 0xc0, 0x7b, 0x2e, 0x42, 0x00, 0xa2, 0xc0, 0x7b, 0x38,
+    0xca, 0xa3, 0xa0, 0x02, 0x6e, 0x79, 0x03, 0xc0, 0x7b, 0x44, 0x04, 0xc0,
+    0x7b, 0x56, 0x42, 0x01, 0x19, 0xc0, 0x7b, 0x68, 0x42, 0x00, 0x74, 0xc0,
+    0x7b, 0x72, 0x11, 0xc0, 0x7b, 0x82, 0xca, 0xa5, 0x6c, 0x02, 0x6f, 0xd8,
+    0x48, 0x01, 0x6b, 0xc0, 0x7b, 0x8e, 0xc2, 0x00, 0x40, 0x0f, 0xa0, 0x72,
+    0x00, 0x7b, 0xb4, 0x00, 0xc0, 0x7b, 0xb8, 0xc2, 0x05, 0x03, 0x0f, 0x9f,
+    0x40, 0xc6, 0xc6, 0xf0, 0x01, 0x18, 0xdb, 0x00, 0x7b, 0xd0, 0xc2, 0x00,
+    0x40, 0x01, 0x18, 0x12, 0x00, 0x7b, 0xd6, 0xd9, 0x1f, 0x7c, 0x0f, 0xb3,
+    0x43, 0x00, 0x7b, 0xda, 0x87, 0x0f, 0xab, 0x98, 0xc4, 0x49, 0x2a, 0x0f,
+    0x9b, 0x79, 0xc3, 0xb2, 0x36, 0x0f, 0xa0, 0xe8, 0x15, 0xc0, 0x7b, 0xe0,
+    0xc3, 0x2f, 0x1e, 0x0f, 0xa9, 0x43, 0x00, 0x7b, 0xea, 0xc6, 0xcb, 0x15,
+    0x0f, 0x9a, 0xa0, 0x06, 0xc0, 0x7b, 0xf0, 0x4d, 0x7f, 0xf5, 0xc0, 0x7c,
+    0x02, 0x45, 0xdb, 0x2d, 0xc0, 0x7c, 0x20, 0x09, 0x40, 0x7c, 0x32, 0xc6,
+    0x40, 0x87, 0x01, 0x00, 0x51, 0xc3, 0x23, 0x08, 0x0f, 0xa4, 0x38, 0x44,
+    0xc7, 0xf4, 0xc0, 0x7c, 0x3e, 0xcb, 0x96, 0xb6, 0x0f, 0xa1, 0x18, 0x4c,
+    0x1c, 0x86, 0xc0, 0x7c, 0x4a, 0x44, 0x00, 0x49, 0xc0, 0x7c, 0x56, 0x45,
+    0x00, 0x2c, 0xc0, 0x7c, 0x62, 0x48, 0xb5, 0x4a, 0xc0, 0x7c, 0x6e, 0x47,
+    0xc3, 0x3e, 0xc0, 0x7c, 0x78, 0xd4, 0x3b, 0x24, 0x07, 0xff, 0x41, 0xcd,
+    0x1b, 0x41, 0x07, 0xff, 0x51, 0xcf, 0x14, 0x22, 0x07, 0xff, 0x61, 0xcc,
+    0x0d, 0xae, 0x07, 0xff, 0x69, 0xcc, 0x0d, 0x9e, 0x07, 0xff, 0x70, 0x02,
+    0xc0, 0x7c, 0x84, 0x00, 0x40, 0x7c, 0x93, 0x47, 0x02, 0x0e, 0xc0, 0x7c,
+    0x9f, 0xce, 0x1c, 0x92, 0x01, 0x84, 0xe9, 0xd5, 0x34, 0xb8, 0x01, 0x84,
+    0xf1, 0xcc, 0x80, 0xe5, 0x01, 0x84, 0xf8, 0xc3, 0x06, 0x19, 0x01, 0x00,
+    0x83, 0x00, 0x7c, 0xf7, 0xc9, 0xab, 0x49, 0x01, 0x70, 0x90, 0x42, 0x00,
+    0x29, 0xc0, 0x7d, 0x07, 0x47, 0xc7, 0x04, 0x40, 0x7d, 0x13, 0x46, 0x0b,
+    0x11, 0xc0, 0x7d, 0x25, 0xc7, 0x00, 0x91, 0x0f, 0xa9, 0x19, 0xc7, 0xc1,
+    0x93, 0x0f, 0xa9, 0x10, 0x14, 0xc0, 0x7d, 0x37, 0xc4, 0x1e, 0x43, 0x01,
+    0x11, 0x5a, 0x00, 0x7d, 0x56, 0xcd, 0x77, 0xef, 0x01, 0x1c, 0x01, 0x4d,
+    0x7a, 0xe1, 0x40, 0x7d, 0x5a, 0xc5, 0x65, 0x44, 0x01, 0x10, 0xf3, 0x00,
+    0x7d, 0x66, 0x49, 0x53, 0x89, 0x40, 0x7d, 0x6c, 0x42, 0x01, 0x19, 0xc0,
+    0x7d, 0x76, 0x42, 0x00, 0x7a, 0x40, 0x7d, 0x82, 0x0b, 0xc0, 0x7d, 0x8e,
+    0xc2, 0x01, 0x0b, 0x00, 0x04, 0x22, 0x00, 0x7d, 0x9a, 0xd3, 0x46, 0x0b,
+    0x01, 0x03, 0x61, 0xd2, 0x4d, 0x69, 0x01, 0x03, 0x50, 0xcd, 0x76, 0xeb,
+    0x0f, 0xd5, 0x51, 0x44, 0x05, 0x89, 0x40, 0x7d, 0xa0, 0x16, 0xc0, 0x7d,
+    0xaf, 0x42, 0x00, 0x06, 0xc0, 0x7d, 0xbb, 0xc5, 0x40, 0x88, 0x01, 0x80,
+    0x01, 0x05, 0xc0, 0x7d, 0xc7, 0xc9, 0x11, 0xf6, 0x01, 0x80, 0x11, 0xce,
+    0x1c, 0x92, 0x01, 0x80, 0x29, 0xcb, 0x97, 0x87, 0x01, 0x80, 0x39, 0xcf,
+    0x66, 0xa2, 0x01, 0x81, 0x51, 0xd0, 0x5a, 0x32, 0x01, 0x81, 0x59, 0xd2,
+    0x49, 0x0d, 0x01, 0x81, 0x69, 0xd3, 0x3f, 0xcf, 0x01, 0x81, 0xf1, 0xcf,
+    0x64, 0x59, 0x01, 0x81, 0xf9, 0x4b, 0x55, 0xe0, 0x40, 0x7d, 0xd3, 0xc4,
+    0x59, 0x33, 0x0f, 0x9b, 0x41, 0xc3, 0xb3, 0x72, 0x0f, 0xce, 0x50, 0xda,
+    0x1a, 0x16, 0x01, 0x12, 0x98, 0x4e, 0x70, 0x18, 0x40, 0x7e, 0x09, 0x8f,
+    0x0f, 0xd5, 0x89, 0x42, 0x00, 0xa9, 0xc0, 0x7e, 0x1b, 0xc6, 0xd0, 0x1f,
+    0x0f, 0xaf, 0xd1, 0xc9, 0xaa, 0x29, 0x0f, 0xb0, 0xf8, 0xc2, 0x00, 0xd1,
+    0x0f, 0xa3, 0x4b, 0x00, 0x7e, 0x27, 0xca, 0xa2, 0x38, 0x0f, 0xb5, 0xd0,
+    0x00, 0xc0, 0x7e, 0x33, 0xdb, 0x14, 0xd9, 0x01, 0x3d, 0x98, 0xcc, 0x8c,
+    0x25, 0x01, 0x33, 0xf9, 0xca, 0x9d, 0x4c, 0x01, 0x31, 0xc0, 0x46, 0x1a,
+    0x37, 0xc0, 0x7e, 0x85, 0x46, 0x06, 0x1d, 0xc0, 0x7e, 0x91, 0x4a, 0x03,
+    0xc8, 0xc0, 0x7e, 0x9d, 0x4b, 0x03, 0x87, 0xc0, 0x7e, 0xbb, 0x4a, 0x01,
+    0x88, 0xc0, 0x7e, 0xd9, 0x48, 0x09, 0x0d, 0x40, 0x7e, 0xf7, 0x06, 0xc0,
+    0x7f, 0x15, 0xc7, 0xc2, 0xff, 0x0f, 0x9b, 0xb9, 0xc9, 0xa1, 0x3f, 0x0f,
+    0xb0, 0x48, 0x42, 0x00, 0x29, 0xc0, 0x7f, 0x1f, 0xc2, 0x11, 0xee, 0x01,
+    0x18, 0xd0, 0x44, 0xcc, 0x6b, 0xc0, 0x7f, 0x29, 0x44, 0x00, 0x74, 0x40,
+    0x7f, 0x41, 0x49, 0xb0, 0xfb, 0xc0, 0x7f, 0x4d, 0xc9, 0xae, 0xcd, 0x01,
+    0x35, 0x00, 0x42, 0x00, 0x36, 0xc0, 0x7f, 0x6b, 0x44, 0x00, 0x74, 0xc0,
+    0x7f, 0x7b, 0x42, 0x00, 0x5d, 0x40, 0x7f, 0x8d, 0xd3, 0x3f, 0x96, 0x0f,
+    0x98, 0xa1, 0xd4, 0x39, 0x08, 0x0f, 0x98, 0x90, 0xda, 0x14, 0xa3, 0x01,
+    0x3d, 0xe1, 0xc4, 0x03, 0x30, 0x0f, 0xa4, 0x90, 0xda, 0x1b, 0x9c, 0x01,
+    0x08, 0xc1, 0xca, 0x9b, 0x08, 0x0f, 0x9e, 0x58, 0xc4, 0x00, 0x87, 0x0f,
+    0xb1, 0x49, 0xc8, 0x1d, 0x3c, 0x0f, 0xb2, 0x00, 0xcb, 0x98, 0xc6, 0x01,
+    0x12, 0x01, 0xc3, 0x1e, 0xcf, 0x0f, 0xa9, 0x39, 0xc6, 0xcf, 0xf5, 0x0f,
+    0xc9, 0xe0, 0x44, 0x00, 0x74, 0x40, 0x7f, 0x99, 0xc5, 0xda, 0xd8, 0x0f,
+    0xcd, 0x49, 0x16, 0xc0, 0x7f, 0xab, 0xc9, 0xb1, 0x82, 0x01, 0x37, 0x98,
+    0xc9, 0x1c, 0xaa, 0x01, 0x3b, 0x31, 0xc3, 0x00, 0x28, 0x01, 0x34, 0xc3,
+    0x00, 0x7f, 0xbd, 0xc8, 0x31, 0xd1, 0x0f, 0xa5, 0xf0, 0xc9, 0xb1, 0x5e,
+    0x01, 0x34, 0xe1, 0xca, 0x9b, 0x4e, 0x0f, 0xa5, 0x50, 0x14, 0xc0, 0x7f,
+    0xc3, 0xc5, 0x03, 0x0a, 0x01, 0x37, 0x90, 0xc3, 0x4c, 0xa1, 0x01, 0x15,
+    0x49, 0xc4, 0x63, 0xf2, 0x01, 0x10, 0x01, 0x0d, 0xc0, 0x7f, 0xd3, 0xc6,
+    0xb7, 0xfc, 0x00, 0x00, 0x61, 0xcb, 0x90, 0xd3, 0x0f, 0xcb, 0x00, 0xc6,
+    0xb9, 0xbc, 0x0f, 0xa3, 0x18, 0xc2, 0x2e, 0x0e, 0x0f, 0x98, 0x08, 0x42,
+    0x00, 0x5d, 0xc0, 0x7f, 0xe8, 0xcb, 0x8e, 0xad, 0x01, 0x09, 0xd9, 0xc4,
+    0x89, 0x7c, 0x0f, 0x9f, 0x68, 0xc7, 0x43, 0xb7, 0x0f, 0xa7, 0x01, 0xc4,
+    0xd7, 0xa5, 0x0f, 0xad, 0xb8, 0x0e, 0xc0, 0x80, 0x0a, 0xc4, 0xe2, 0x0b,
+    0x0f, 0xce, 0x30, 0xca, 0x90, 0x19, 0x0f, 0xcb, 0xb1, 0x46, 0xce, 0x0f,
+    0x40, 0x80, 0x16, 0x43, 0x01, 0xe9, 0xc0, 0x80, 0x22, 0xc2, 0x01, 0x48,
+    0x01, 0x19, 0x13, 0x00, 0x80, 0x2e, 0xc6, 0x21, 0xfd, 0x0f, 0xa1, 0xc0,
+    0x46, 0x12, 0x41, 0xc0, 0x80, 0x34, 0x48, 0xa3, 0xc6, 0x40, 0x80, 0x40,
+    0x00, 0xc0, 0x80, 0x52, 0x46, 0x48, 0x65, 0x40, 0x80, 0x6a, 0xc8, 0xba,
+    0x52, 0x01, 0x35, 0x89, 0xd1, 0x57, 0x50, 0x01, 0x03, 0x08, 0x9b, 0x01,
+    0x37, 0xa1, 0xc8, 0xb6, 0xd2, 0x0f, 0x9d, 0x08, 0xc8, 0x1b, 0xc8, 0x01,
+    0x32, 0x01, 0xd7, 0x26, 0x77, 0x00, 0x05, 0x50, 0xc9, 0xa8, 0xa6, 0x0f,
+    0xb1, 0x41, 0xc4, 0x14, 0xdd, 0x0f, 0xd5, 0xb0, 0x43, 0x14, 0xcf, 0xc0,
+    0x80, 0xca, 0x87, 0x0f, 0xa9, 0x2a, 0x00, 0x80, 0xdf, 0x8a, 0x0f, 0xa0,
+    0xfb, 0x00, 0x80, 0xf1, 0xcd, 0x7f, 0x9a, 0x0f, 0xa2, 0x50, 0xcb, 0x05,
+    0x1c, 0x01, 0x02, 0xc9, 0xc4, 0x01, 0xc3, 0x01, 0x71, 0x68, 0xc4, 0x0e,
+    0x9a, 0x01, 0x00, 0x91, 0xc5, 0x40, 0x88, 0x01, 0x00, 0x38, 0x42, 0x00,
+    0x5d, 0xc0, 0x81, 0x03, 0x42, 0x00, 0x47, 0x40, 0x81, 0x15, 0xc5, 0x15,
+    0x2d, 0x0f, 0xd5, 0x48, 0x46, 0x56, 0x32, 0xc0, 0x81, 0x21, 0xc6, 0x44,
+    0xfb, 0x01, 0x05, 0x29, 0xc6, 0xd0, 0x67, 0x0f, 0x98, 0x60, 0x47, 0x02,
+    0x0e, 0xc0, 0x81, 0x2d, 0x45, 0x2b, 0x5f, 0xc0, 0x81, 0x87, 0x4b, 0x6f,
+    0xc7, 0xc0, 0x81, 0x9f, 0x45, 0x00, 0xba, 0x40, 0x81, 0xe6, 0x00, 0xc0,
+    0x81, 0xf8, 0x11, 0x40, 0x82, 0x04, 0xd8, 0x22, 0x73, 0x01, 0x17, 0x79,
+    0x44, 0x04, 0xce, 0x40, 0x82, 0x1c, 0x42, 0x11, 0xa5, 0xc0, 0x82, 0x28,
+    0x0b, 0xc0, 0x82, 0x32, 0x9b, 0x01, 0x4f, 0xf8, 0xc3, 0x03, 0x2a, 0x0f,
+    0xcd, 0xf1, 0xc3, 0x36, 0x44, 0x0f, 0xcd, 0xf8, 0x0b, 0xc0, 0x82, 0x44,
+    0x49, 0xb2, 0xb4, 0x40, 0x82, 0x50, 0x91, 0x0f, 0xb4, 0x39, 0x45, 0x05,
+    0x88, 0x40, 0x82, 0x70, 0x4b, 0x94, 0xb1, 0xc0, 0x82, 0x8c, 0xd7, 0x28,
+    0x15, 0x0f, 0xaa, 0x71, 0xc8, 0x2f, 0x03, 0x0f, 0xb5, 0xc8, 0xc4, 0x5d,
+    0x24, 0x01, 0x31, 0xf9, 0x46, 0xcc, 0xef, 0xc0, 0x82, 0x9e, 0xc6, 0x18,
+    0x8e, 0x0f, 0xce, 0xe0, 0x46, 0xd3, 0x7f, 0xc0, 0x82, 0xaa, 0xc9, 0xab,
+    0x2e, 0x0f, 0x9a, 0xb0, 0x46, 0x09, 0x97, 0xc0, 0x82, 0xbf, 0x03, 0xc0,
+    0x82, 0xe3, 0x18, 0xc0, 0x82, 0xf5, 0x0e, 0xc0, 0x83, 0x01, 0xd4, 0x3d,
+    0x04, 0x05, 0x57, 0xa1, 0xd8, 0x24, 0x53, 0x05, 0x57, 0x99, 0x46, 0xcc,
+    0x3b, 0x40, 0x83, 0x0d, 0xc2, 0x00, 0x45, 0x0f, 0x9a, 0x41, 0xc9, 0x85,
+    0xc8, 0x0f, 0xd7, 0x00, 0x42, 0x00, 0xbf, 0xc0, 0x83, 0x19, 0xcd, 0x73,
+    0xd1, 0x0f, 0xc9, 0xb0, 0x42, 0x00, 0x84, 0xc0, 0x83, 0x29, 0xc2, 0x00,
+    0x8e, 0x0f, 0xa2, 0x21, 0xc2, 0x00, 0x40, 0x0f, 0xa0, 0x0a, 0x00, 0x83,
+    0x38, 0x11, 0xc0, 0x83, 0x3c, 0x47, 0xbf, 0xfd, 0xc0, 0x83, 0x4e, 0x42,
+    0x17, 0x28, 0xc0, 0x83, 0x9d, 0xc3, 0x19, 0x2a, 0x0f, 0xa0, 0x92, 0x00,
+    0x83, 0xa7, 0x0b, 0xc0, 0x83, 0xad, 0x07, 0xc0, 0x83, 0xb7, 0xcb, 0x8c,
+    0xc9, 0x01, 0x50, 0x50, 0xc8, 0xbb, 0x6a, 0x0f, 0xaf, 0x81, 0x42, 0x00,
+    0xbd, 0x40, 0x83, 0xc3, 0x87, 0x0f, 0xaa, 0x61, 0xc3, 0x57, 0xb3, 0x0f,
+    0xcc, 0xf8, 0x00, 0x40, 0x83, 0xcf, 0x4a, 0x4c, 0x94, 0xc0, 0x83, 0xdb,
+    0xc7, 0xc3, 0x06, 0x0f, 0xce, 0x48, 0xc4, 0x26, 0x78, 0x0e, 0x97, 0x4b,
+    0x00, 0x84, 0x07, 0x07, 0xc0, 0x84, 0x0d, 0x15, 0xc0, 0x84, 0x1c, 0x08,
+    0xc0, 0x84, 0x2e, 0x16, 0xc0, 0x84, 0x3b, 0xc3, 0x05, 0x14, 0x0e, 0x97,
+    0x09, 0xc4, 0x15, 0xe7, 0x0e, 0x97, 0x00, 0xce, 0x6f, 0x0e, 0x08, 0xf7,
+    0xc1, 0xca, 0xa1, 0x16, 0x08, 0xf7, 0xb9, 0x4b, 0x6f, 0xc7, 0xc0, 0x84,
+    0x49, 0xc5, 0xcd, 0xfd, 0x08, 0xf7, 0x91, 0x47, 0x02, 0x0e, 0x40, 0x84,
+    0x59, 0x4b, 0x99, 0x13, 0xc0, 0x84, 0xb5, 0xcd, 0x7a, 0xee, 0x0f, 0x8d,
+    0x69, 0xd8, 0x21, 0xe3, 0x00, 0x05, 0xd1, 0xc6, 0xc3, 0xd9, 0x01, 0x81,
+    0xe0, 0x45, 0x45, 0x76, 0xc0, 0x84, 0xcf, 0xcc, 0x88, 0x41, 0x01, 0x35,
+    0x69, 0xd1, 0x55, 0x63, 0x0f, 0xca, 0x58, 0xca, 0x9f, 0x36, 0x01, 0x39,
+    0x01, 0x42, 0x00, 0x5d, 0xc0, 0x84, 0xeb, 0x47, 0xb3, 0xd6, 0x40, 0x84,
+    0xfd, 0xd6, 0x2f, 0x04, 0x01, 0x37, 0x79, 0xc7, 0xc1, 0x5b, 0x0f, 0x9a,
+    0x08, 0xc7, 0x61, 0xfa, 0x01, 0x05, 0xe1, 0x48, 0xbe, 0xba, 0xc0, 0x85,
+    0x25, 0x00, 0xc0, 0x85, 0x43, 0xce, 0x6e, 0xac, 0x0f, 0xab, 0x81, 0x45,
+    0xd9, 0x7a, 0xc0, 0x85, 0x5b, 0xc2, 0x0f, 0x7b, 0x0f, 0xcb, 0x69, 0xce,
+    0x6f, 0xee, 0x0f, 0xcd, 0xe9, 0xc6, 0xcc, 0xad, 0x0f, 0xa2, 0xf0, 0x46,
+    0xca, 0xdf, 0xc0, 0x85, 0x79, 0x4a, 0x9d, 0xd8, 0x40, 0x85, 0x87, 0x87,
+    0x0f, 0xce, 0xc9, 0xc3, 0x2b, 0x00, 0x0f, 0xcf, 0x91, 0xc7, 0xc9, 0x34,
+    0x0f, 0xd4, 0x20, 0x42, 0x00, 0x63, 0xc0, 0x85, 0xcd, 0xc5, 0xd8, 0x5d,
+    0x0f, 0x9a, 0x20, 0x0b, 0xc0, 0x85, 0xd7, 0x44, 0x91, 0x02, 0x40, 0x85,
+    0xec, 0xcc, 0x07, 0xc7, 0x01, 0x13, 0x59, 0xc9, 0x00, 0xca, 0x01, 0x13,
+    0x50, 0xcb, 0x97, 0xf5, 0x0b, 0x53, 0x79, 0xc4, 0x19, 0x53, 0x0b, 0x53,
+    0x71, 0x45, 0x09, 0x98, 0x40, 0x85, 0xf8, 0x16, 0xc0, 0x86, 0x1c, 0x14,
+    0xc0, 0x86, 0x2c, 0x42, 0x00, 0xd0, 0xc0, 0x86, 0x34, 0xc2, 0x00, 0xdb,
+    0x0b, 0x52, 0xdb, 0x00, 0x86, 0x3c, 0x0d, 0xc0, 0x86, 0x40, 0x87, 0x0b,
+    0x52, 0xc3, 0x00, 0x86, 0x50, 0xc2, 0x01, 0x4a, 0x0b, 0x52, 0xb9, 0xc3,
+    0x04, 0x2e, 0x0b, 0x52, 0xa1, 0x91, 0x0b, 0x52, 0x93, 0x00, 0x86, 0x54,
+    0x12, 0xc0, 0x86, 0x5c, 0x10, 0xc0, 0x86, 0x66, 0x0f, 0xc0, 0x86, 0x72,
+    0xc3, 0x30, 0x59, 0x0b, 0x52, 0x59, 0xc2, 0x0e, 0x9a, 0x0b, 0x52, 0x2b,
+    0x00, 0x86, 0x7e, 0x83, 0x0b, 0x52, 0x31, 0xc2, 0x01, 0x5d, 0x0b, 0x52,
+    0x21, 0xc2, 0x42, 0xcd, 0x0b, 0x52, 0x10, 0x44, 0x00, 0xbb, 0xc0, 0x86,
+    0x82, 0x46, 0x10, 0x79, 0xc0, 0x86, 0xba, 0x4a, 0x9e, 0x82, 0x40, 0x86,
+    0xd6, 0x46, 0x02, 0x0f, 0xc0, 0x86, 0xfa, 0x4f, 0x62, 0x88, 0x40, 0x87,
+    0x64, 0xd4, 0x3d, 0xb8, 0x05, 0x53, 0x81, 0xd2, 0x4d, 0x21, 0x05, 0x4f,
+    0x30, 0x4f, 0x6a, 0x71, 0xc0, 0x87, 0x76, 0x54, 0x39, 0x80, 0x40, 0x87,
+    0x9a, 0xc7, 0xc6, 0xb7, 0x00, 0x81, 0x59, 0x03, 0xc0, 0x87, 0xa6, 0x8b,
+    0x00, 0x81, 0x6b, 0x00, 0x87, 0xb1, 0x97, 0x00, 0x81, 0x7b, 0x00, 0x87,
+    0xb5, 0x87, 0x00, 0x81, 0x8b, 0x00, 0x87, 0xb9, 0x44, 0xb9, 0x62, 0xc0,
+    0x87, 0xbf, 0x48, 0xb2, 0x2d, 0xc0, 0x87, 0xc9, 0x15, 0xc0, 0x87, 0xd7,
+    0x52, 0x28, 0x9f, 0xc0, 0x87, 0xe3, 0xcc, 0x89, 0x19, 0x00, 0x83, 0x89,
+    0x46, 0xce, 0x5d, 0x40, 0x87, 0xef, 0x0f, 0xc0, 0x87, 0xff, 0xce, 0x6e,
+    0x4a, 0x00, 0x84, 0x10, 0xc4, 0x15, 0xe7, 0x00, 0x82, 0x01, 0xc3, 0x05,
+    0x14, 0x00, 0x82, 0x09, 0x16, 0xc0, 0x88, 0x0b, 0x08, 0xc0, 0x88, 0x17,
+    0x15, 0xc0, 0x88, 0x23, 0xc5, 0x06, 0xdb, 0x00, 0x82, 0x41, 0xc4, 0x26,
+    0x78, 0x00, 0x82, 0x48, 0xc7, 0xc6, 0xfd, 0x0f, 0xa8, 0xf9, 0xc5, 0x5b,
+    0x0d, 0x01, 0x19, 0x42, 0x00, 0x88, 0x2f, 0x00, 0xc0, 0x88, 0x35, 0x4a,
+    0x0d, 0xd8, 0x40, 0x88, 0x53, 0xcb, 0x97, 0x9d, 0x08, 0x85, 0xeb, 0x00,
+    0x88, 0x6b, 0x4b, 0x6f, 0xc7, 0xc0, 0x88, 0x71, 0x06, 0xc0, 0x88, 0x91,
+    0x15, 0xc0, 0x88, 0x9d, 0xd0, 0x5d, 0x12, 0x08, 0x85, 0xe1, 0xd1, 0x50,
+    0xce, 0x08, 0x85, 0xd9, 0x47, 0x02, 0x0e, 0x40, 0x88, 0xa9, 0x45, 0x00,
+    0xba, 0xc0, 0x89, 0x10, 0x45, 0x2b, 0x5f, 0xc0, 0x89, 0x1c, 0x46, 0x34,
+    0x6f, 0xc0, 0x89, 0x2b, 0x47, 0x02, 0x0e, 0xc0, 0x89, 0x3d, 0x46, 0x09,
+    0x97, 0x40, 0x89, 0xa3, 0x45, 0xdb, 0xe6, 0xc0, 0x89, 0xc7, 0x09, 0x40,
+    0x89, 0xe5, 0x4c, 0x8c, 0x49, 0xc0, 0x89, 0xf1, 0xc6, 0x92, 0x0c, 0x0b,
+    0x7f, 0x20, 0x46, 0x09, 0x97, 0xc0, 0x89, 0xf9, 0x45, 0x00, 0xba, 0xc0,
+    0x8a, 0x1d, 0x4b, 0x6f, 0xc7, 0xc0, 0x8a, 0x2f, 0x47, 0x02, 0x0e, 0x40,
+    0x8a, 0x49, 0x15, 0xc0, 0x8a, 0xb0, 0xd1, 0x50, 0xce, 0x08, 0x91, 0xe9,
+    0x06, 0xc0, 0x8a, 0xbc, 0xce, 0x73, 0x1a, 0x08, 0x91, 0xd1, 0x4b, 0x6f,
+    0xc7, 0xc0, 0x8a, 0xc8, 0x47, 0x02, 0x0e, 0x40, 0x8a, 0xdf, 0x15, 0xc0,
+    0x8b, 0x42, 0x46, 0x09, 0x97, 0xc0, 0x8b, 0x4e, 0xd4, 0x3a, 0xd4, 0x00,
+    0xbe, 0xd9, 0x46, 0x34, 0x6f, 0xc0, 0x8b, 0x72, 0x52, 0x4c, 0xb5, 0xc0,
+    0x8b, 0x7e, 0x47, 0x02, 0x0e, 0x40, 0x8b, 0x94, 0x4c, 0x11, 0xe2, 0xc0,
+    0x8b, 0xde, 0xd1, 0x53, 0xa9, 0x08, 0x52, 0x41, 0x47, 0x34, 0x2f, 0xc0,
+    0x8b, 0xf6, 0x46, 0x09, 0x97, 0xc0, 0x8c, 0x00, 0x18, 0xc0, 0x8c, 0x10,
+    0x45, 0x00, 0xba, 0xc0, 0x8c, 0x1c, 0x47, 0x02, 0x0e, 0x40, 0x8c, 0x3a,
+    0xc5, 0x01, 0xc2, 0x0f, 0xa4, 0x59, 0x44, 0x00, 0x74, 0x40, 0x8c, 0x90,
+    0x16, 0xc0, 0x8c, 0x9f, 0xc3, 0x7c, 0xb4, 0x01, 0x5e, 0xe0, 0x44, 0x03,
+    0xda, 0xc0, 0x8c, 0xab, 0xc2, 0x00, 0x29, 0x01, 0x35, 0x90, 0xc6, 0x6b,
+    0xc0, 0x0f, 0xa7, 0x81, 0x42, 0x01, 0x31, 0xc0, 0x8c, 0xb7, 0x00, 0xc0,
+    0x8c, 0xef, 0x45, 0x02, 0x6d, 0x40, 0x8d, 0x07, 0x44, 0x0d, 0x14, 0xc0,
+    0x8d, 0x13, 0x4d, 0x7c, 0x5a, 0x40, 0x8d, 0x2b, 0xc9, 0x2a, 0xec, 0x01,
+    0x5e, 0x48, 0xc4, 0x9b, 0xb8, 0x01, 0x1c, 0xc1, 0xc4, 0x02, 0x6d, 0x00,
+    0x04, 0x28, 0x03, 0xc0, 0x8d, 0x31, 0x51, 0x54, 0xca, 0xc0, 0x8d, 0x3d,
+    0x4e, 0x6f, 0x9a, 0x40, 0x8d, 0x49, 0x48, 0xbd, 0x22, 0x40, 0x8d, 0x55,
+    0xc2, 0x00, 0xdb, 0x01, 0x10, 0x39, 0x47, 0xc4, 0xb8, 0x40, 0x8d, 0x6d,
+    0xc7, 0x77, 0xc1, 0x01, 0x05, 0x31, 0xc8, 0xb5, 0x62, 0x0f, 0xa4, 0x28,
+    0xcc, 0x5f, 0x56, 0x01, 0x03, 0x71, 0xc4, 0xa8, 0x2a, 0x0f, 0x9e, 0xf0,
+    0x02, 0xc0, 0x8d, 0x7f, 0xc7, 0xc6, 0x5c, 0x01, 0x56, 0xe8, 0x42, 0x00,
+    0x8e, 0xc0, 0x8d, 0x8b, 0xcf, 0x4c, 0x04, 0x01, 0x15, 0x93, 0x00, 0x8d,
+    0x95, 0xcd, 0x7e, 0x62, 0x01, 0x05, 0xd8, 0x45, 0x84, 0xa8, 0xc0, 0x8d,
+    0x9b, 0x00, 0xc0, 0x8d, 0xab, 0x87, 0x0f, 0xae, 0x42, 0x00, 0x8d, 0xe4,
+    0xd9, 0x1f, 0x63, 0x0f, 0xa8, 0xf1, 0xc5, 0x53, 0xf8, 0x01, 0x36, 0xa3,
+    0x00, 0x8d, 0xf3, 0x12, 0xc0, 0x8d, 0xf9, 0xcd, 0x80, 0x43, 0x0f, 0xa7,
+    0xa9, 0x04, 0xc0, 0x8e, 0x05, 0xce, 0x71, 0x92, 0x0f, 0xb5, 0x68, 0xd0,
+    0x5f, 0x52, 0x01, 0x03, 0x79, 0xc8, 0xb8, 0x42, 0x08, 0x0c, 0x70, 0xcc,
+    0x8a, 0xa5, 0x0f, 0x0a, 0x71, 0x46, 0x02, 0x0f, 0x40, 0x8e, 0x11, 0xc4,
+    0x26, 0x78, 0x0f, 0x0a, 0x49, 0xc5, 0x06, 0xdb, 0x0f, 0x0a, 0x41, 0x15,
+    0xc0, 0x8e, 0x93, 0x08, 0xc0, 0x8e, 0x9f, 0x16, 0xc0, 0x8e, 0xab, 0xc3,
+    0x05, 0x14, 0x0f, 0x0a, 0x09, 0xc4, 0x15, 0xe7, 0x0f, 0x0a, 0x00, 0xd2,
+    0x4a, 0xcf, 0x0f, 0x09, 0xe9, 0x44, 0x00, 0xbb, 0x40, 0x8e, 0xb7, 0x86,
+    0x0f, 0x09, 0xb1, 0x89, 0x0f, 0x09, 0xa9, 0x95, 0x0f, 0x09, 0xa1, 0x98,
+    0x0f, 0x09, 0x99, 0x8c, 0x0f, 0x09, 0x91, 0x8f, 0x0f, 0x09, 0x89, 0x84,
+    0x0f, 0x09, 0x80, 0x4c, 0x8b, 0xad, 0xc0, 0x8e, 0xc3, 0xce, 0x1c, 0x92,
+    0x0b, 0x7f, 0x08, 0x44, 0x00, 0x51, 0xc0, 0x8e, 0xcb, 0xc8, 0xab, 0x80,
+    0x01, 0x08, 0xb0, 0x4f, 0x6a, 0x80, 0x40, 0x8e, 0xe1, 0xc2, 0x00, 0xbf,
+    0x01, 0x16, 0x09, 0xc3, 0x02, 0x9b, 0x01, 0x16, 0x00, 0xc8, 0x60, 0x55,
+    0x01, 0x10, 0x89, 0x46, 0x1f, 0x87, 0x40, 0x8e, 0xed, 0xc8, 0x26, 0x58,
+    0x01, 0x10, 0x81, 0x47, 0x20, 0x7d, 0x40, 0x8e, 0xf9, 0xca, 0x9e, 0x14,
+    0x00, 0x3f, 0xf1, 0xc9, 0xb1, 0xb8, 0x00, 0x3f, 0xe9, 0x45, 0x09, 0x98,
+    0x40, 0x8f, 0x0b, 0xc9, 0xb1, 0x55, 0x00, 0x3f, 0xd1, 0xd2, 0x4a, 0x1b,
+    0x00, 0x3f, 0xa9, 0x46, 0x02, 0x0f, 0x40, 0x8f, 0x2f, 0xc2, 0x01, 0xc3,
+    0x00, 0x3f, 0xc1, 0x47, 0x1d, 0xd4, 0x40, 0x8f, 0xaf, 0xca, 0x9f, 0x2c,
+    0x00, 0x3f, 0xb9, 0xc9, 0xac, 0x8d, 0x00, 0x3f, 0xb0, 0xc7, 0xc0, 0xd6,
+    0x0f, 0xd3, 0x69, 0xc7, 0xc8, 0x77, 0x0f, 0xd3, 0x39, 0xc8, 0xb9, 0xe2,
+    0x0f, 0xd3, 0x41, 0xc8, 0xbb, 0x52, 0x0f, 0xd3, 0x49, 0xc5, 0xa0, 0x85,
+    0x0f, 0xd3, 0x51, 0x05, 0x40, 0x8f, 0xc7, 0xc5, 0xa0, 0x85, 0x0f, 0xd3,
+    0x19, 0xc7, 0xc8, 0x77, 0x0f, 0xd3, 0x01, 0xc8, 0xb9, 0xe2, 0x0f, 0xd3,
+    0x09, 0xc8, 0xbb, 0x52, 0x0f, 0xd3, 0x11, 0x05, 0xc0, 0x8f, 0xd3, 0xc7,
+    0xc0, 0xd6, 0x0f, 0xd3, 0x30, 0x4a, 0xa3, 0x46, 0xc0, 0x8f, 0xdf, 0x5a,
+    0x1a, 0x98, 0x40, 0x8f, 0xf7, 0xcc, 0x88, 0x4d, 0x01, 0x1c, 0x19, 0x43,
+    0x18, 0x14, 0x40, 0x90, 0x0d, 0xc4, 0x0e, 0x9a, 0x01, 0x00, 0xa1, 0xc5,
+    0x40, 0x88, 0x01, 0x00, 0x19, 0xc4, 0x02, 0xb9, 0x01, 0x00, 0x08, 0xc2,
+    0x00, 0x8e, 0x01, 0x32, 0x0b, 0x00, 0x90, 0x29, 0x00, 0x40, 0x90, 0x2f,
+    0x07, 0xc0, 0x90, 0x3b, 0x04, 0xc0, 0x90, 0x45, 0x11, 0xc0, 0x90, 0x51,
+    0x0b, 0xc0, 0x90, 0x5b, 0x0a, 0xc0, 0x90, 0x65, 0x18, 0xc0, 0x90, 0x71,
+    0x03, 0xc0, 0x90, 0x7b, 0x42, 0x00, 0x1c, 0xc0, 0x90, 0x85, 0x43, 0xe5,
+    0xc6, 0xc0, 0x90, 0x8d, 0x43, 0xe6, 0x4d, 0xc0, 0x90, 0xb0, 0x42, 0xe6,
+    0xa1, 0xc0, 0x90, 0xd9, 0x42, 0xdd, 0x2f, 0xc0, 0x90, 0xe5, 0x42, 0xde,
+    0x65, 0xc0, 0x90, 0xf9, 0x42, 0xe4, 0xce, 0xc0, 0x91, 0x09, 0x42, 0xe6,
+    0x99, 0xc0, 0x91, 0x1d, 0x43, 0xe5, 0x5a, 0xc0, 0x91, 0x29, 0x42, 0xc6,
+    0x1c, 0xc0, 0x91, 0x45, 0x10, 0xc0, 0x91, 0x4d, 0x42, 0xe4, 0xb6, 0xc0,
+    0x91, 0x5d, 0x43, 0xe5, 0xd8, 0xc0, 0x91, 0x71, 0x43, 0xe5, 0xf3, 0xc0,
+    0x91, 0x97, 0x42, 0xd1, 0x32, 0xc0, 0x91, 0xb7, 0x42, 0xe5, 0x0a, 0xc0,
+    0x91, 0xcf, 0x42, 0xe6, 0x9d, 0xc0, 0x91, 0xe7, 0x42, 0xe6, 0x9b, 0x40,
+    0x92, 0x03, 0x14, 0xc0, 0x92, 0x0f, 0x59, 0x10, 0x15, 0x40, 0x92, 0x1b,
+    0xc3, 0x00, 0xcb, 0x01, 0x11, 0xc9, 0x49, 0x0f, 0x0c, 0x40, 0x92, 0x3f,
+    0x48, 0x14, 0x8a, 0xc0, 0x92, 0x4b, 0x07, 0x40, 0x92, 0x9f, 0x0f, 0xc0,
+    0x92, 0xab, 0xc3, 0x0d, 0xe5, 0x00, 0x9b, 0x28, 0xcc, 0x88, 0xad, 0x00,
+    0x9b, 0x31, 0xd2, 0x45, 0xf9, 0x00, 0x9b, 0x40, 0xc3, 0x05, 0x14, 0x00,
+    0x9b, 0x49, 0x16, 0xc0, 0x92, 0xb7, 0x08, 0xc0, 0x92, 0xc3, 0x15, 0xc0,
+    0x92, 0xcf, 0xc5, 0x06, 0xdb, 0x00, 0x9b, 0x81, 0xc4, 0x26, 0x78, 0x00,
+    0x9b, 0x88, 0x16, 0xc0, 0x92, 0xdb, 0x08, 0xc0, 0x92, 0xf0, 0x15, 0xc0,
+    0x92, 0xfc, 0xc6, 0xcf, 0x9b, 0x00, 0x9b, 0xc9, 0xc6, 0x2a, 0xfe, 0x00,
+    0x9b, 0xd1, 0xc7, 0x0d, 0x04, 0x00, 0x9b, 0xd8, 0xc5, 0xdc, 0x7c, 0x00,
+    0x9c, 0x81, 0x06, 0xc0, 0x93, 0x08, 0xc6, 0x80, 0xbb, 0x00, 0x9c, 0x91,
+    0xcc, 0x80, 0xb5, 0x00, 0x9c, 0x99, 0x0d, 0xc0, 0x93, 0x17, 0xc6, 0xcc,
+    0x65, 0x00, 0x9c, 0xb1, 0xc5, 0xce, 0xca, 0x00, 0x9c, 0xb8, 0xc7, 0x81,
+    0x9e, 0x01, 0x10, 0x43, 0x00, 0x93, 0x23, 0x45, 0xda, 0x29, 0xc0, 0x93,
+    0x27, 0xc5, 0xbb, 0x55, 0x0f, 0xa0, 0xc1, 0xc5, 0xd8, 0x67, 0x0f, 0xb6,
+    0xb8, 0xd2, 0x4a, 0xab, 0x08, 0x7f, 0xb1, 0x46, 0x02, 0x0f, 0x40, 0x93,
+    0x31, 0x83, 0x08, 0x28, 0x01, 0xc2, 0x00, 0x51, 0x08, 0x28, 0x09, 0x05,
+    0xc0, 0x93, 0x94, 0x06, 0xc0, 0x93, 0x9e, 0x10, 0xc0, 0x93, 0xa8, 0x87,
+    0x08, 0x28, 0x43, 0x00, 0x93, 0xbc, 0xc2, 0x14, 0xda, 0x08, 0x28, 0x49,
+    0x09, 0xc0, 0x93, 0xc0, 0xc2, 0x01, 0x7f, 0x08, 0x28, 0x61, 0x8b, 0x08,
+    0x28, 0x69, 0xc2, 0x1c, 0x52, 0x08, 0x28, 0x71, 0x0d, 0xc0, 0x93, 0xce,
+    0x0e, 0xc0, 0x93, 0xd8, 0xc2, 0x00, 0x4e, 0x08, 0x28, 0x91, 0x91, 0x08,
+    0x28, 0xb1, 0xc2, 0x00, 0x67, 0x08, 0x28, 0xb9, 0xc2, 0x99, 0xe7, 0x08,
+    0x28, 0xc1, 0x14, 0xc0, 0x93, 0xe2, 0x15, 0xc0, 0x93, 0xec, 0x16, 0xc0,
+    0x93, 0xf6, 0x97, 0x08, 0x28, 0xf9, 0xc2, 0x00, 0x5f, 0x08, 0x29, 0x01,
+    0xc2, 0x24, 0xe2, 0x08, 0x29, 0x09, 0x9b, 0x08, 0x29, 0x11, 0x1c, 0x40,
+    0x94, 0x00, 0x42, 0x00, 0xac, 0xc0, 0x94, 0x0a, 0x12, 0xc0, 0x94, 0x10,
+    0xcf, 0x15, 0x36, 0x01, 0x39, 0x98, 0x46, 0x00, 0x8b, 0x40, 0x94, 0x1c,
+    0x43, 0x00, 0x55, 0xc0, 0x94, 0x28, 0xda, 0x1c, 0xee, 0x0f, 0xa8, 0xd0,
+    0xc4, 0x0e, 0x9a, 0x01, 0x00, 0x99, 0xc5, 0x40, 0x88, 0x01, 0x00, 0x11,
+    0xc4, 0x02, 0xb9, 0x01, 0x00, 0x00, 0xc4, 0x00, 0x49, 0x01, 0x19, 0x59,
+    0xc5, 0x00, 0x2c, 0x01, 0x19, 0x30, 0x46, 0x04, 0x8f, 0xc0, 0x94, 0x4a,
+    0x46, 0x01, 0xfc, 0x40, 0x94, 0x5c, 0xc3, 0x05, 0x14, 0x01, 0x5f, 0x81,
+    0xc3, 0x02, 0x9f, 0x01, 0x5f, 0x88, 0x00, 0xc0, 0x94, 0x6e, 0x42, 0x00,
+    0x97, 0x40, 0x94, 0x7a, 0xca, 0x9f, 0x9a, 0x01, 0x12, 0xd1, 0x47, 0x37,
+    0x4f, 0x40, 0x94, 0x8f, 0x95, 0x01, 0x12, 0xc9, 0xc8, 0x19, 0x58, 0x01,
+    0x09, 0x70, 0xc5, 0x00, 0xb9, 0x01, 0x05, 0x61, 0xce, 0x72, 0x48, 0x01,
+    0x05, 0x01, 0x45, 0xd3, 0xe9, 0x40, 0x94, 0x9b, 0xc6, 0xcd, 0x91, 0x0f,
+    0xcd, 0x71, 0xc3, 0x0e, 0x6b, 0x0f, 0x9d, 0xc0, 0x46, 0x09, 0x97, 0xc0,
+    0x94, 0xa7, 0xc2, 0x00, 0x7a, 0x08, 0xec, 0xc1, 0x18, 0xc0, 0x94, 0xcb,
+    0x45, 0x00, 0xba, 0xc0, 0x94, 0xd7, 0x47, 0x02, 0x0e, 0x40, 0x94, 0xe3,
+    0xc8, 0x91, 0x02, 0x01, 0x05, 0x91, 0xc5, 0xda, 0xb0, 0x0f, 0xa4, 0x10,
+    0x45, 0x00, 0xba, 0xc0, 0x95, 0x50, 0x47, 0x02, 0x0e, 0xc0, 0x95, 0x74,
+    0x4b, 0x6f, 0xc7, 0xc0, 0x95, 0xe9, 0x46, 0x09, 0x97, 0xc0, 0x96, 0x07,
+    0xc5, 0xd6, 0xb9, 0x00, 0x53, 0x81, 0x03, 0xc0, 0x96, 0x2b, 0xc3, 0x02,
+    0x30, 0x00, 0x53, 0x91, 0xc3, 0x06, 0x63, 0x00, 0x53, 0x99, 0xc8, 0xbb,
+    0x5a, 0x00, 0x53, 0xa0, 0x45, 0x00, 0xba, 0xc0, 0x96, 0x37, 0x47, 0x02,
+    0x0e, 0xc0, 0x96, 0x59, 0x46, 0x34, 0x6f, 0xc0, 0x96, 0xc4, 0xc2, 0x00,
+    0x7a, 0x00, 0x56, 0x81, 0x46, 0x09, 0x97, 0xc0, 0x96, 0xd0, 0xd1, 0x50,
+    0xce, 0x00, 0x57, 0x81, 0xca, 0x76, 0x52, 0x00, 0x57, 0x88, 0x96, 0x0f,
+    0xa0, 0x81, 0xc5, 0xde, 0x61, 0x0f, 0xca, 0x28, 0xc4, 0xe3, 0x4b, 0x08,
+    0x19, 0x99, 0x03, 0xc0, 0x96, 0xf4, 0xc8, 0xbd, 0x52, 0x08, 0x19, 0xa9,
+    0x0b, 0xc0, 0x97, 0x00, 0x0a, 0xc0, 0x97, 0x0c, 0x16, 0xc0, 0x97, 0x18,
+    0xc3, 0x71, 0x13, 0x08, 0x19, 0xc9, 0xc5, 0xdd, 0xd5, 0x08, 0x19, 0xd1,
+    0xc5, 0xdd, 0x5d, 0x08, 0x19, 0xd9, 0xc5, 0x84, 0xe1, 0x08, 0x19, 0xe1,
+    0x10, 0xc0, 0x97, 0x24, 0xc3, 0xad, 0x41, 0x08, 0x19, 0xf1, 0xc4, 0xde,
+    0xd3, 0x08, 0x19, 0xf9, 0xc8, 0xbf, 0x7a, 0x08, 0x1a, 0x01, 0xc5, 0xd5,
+    0xa1, 0x08, 0x1a, 0x11, 0xc5, 0xda, 0x1f, 0x08, 0x1a, 0x19, 0xc5, 0xd5,
+    0x6f, 0x08, 0x1a, 0x29, 0xc5, 0xdd, 0x85, 0x08, 0x1a, 0x31, 0xc5, 0xd4,
+    0x6b, 0x08, 0x1a, 0x49, 0xc7, 0xc1, 0xa1, 0x08, 0x19, 0x89, 0xc4, 0xe0,
+    0x53, 0x08, 0x19, 0x90, 0x07, 0xc0, 0x97, 0x30, 0x4a, 0x07, 0xca, 0x40,
+    0x97, 0x3c, 0x45, 0xda, 0x51, 0xc0, 0x97, 0x63, 0xcb, 0x8e, 0x29, 0x0f,
+    0x9c, 0x99, 0xc3, 0x5f, 0x5f, 0x0f, 0x9a, 0x39, 0xc9, 0x1f, 0x0f, 0x00,
+    0x03, 0x00, 0x46, 0x96, 0x81, 0xc0, 0x97, 0x81, 0xcb, 0x8d, 0x63, 0x0f,
+    0xb1, 0x60, 0xca, 0x9b, 0x6c, 0x0f, 0xa4, 0xb9, 0x43, 0x11, 0x49, 0x40,
+    0x97, 0x90, 0x45, 0x00, 0x8b, 0x40, 0x97, 0x9c, 0xc3, 0x03, 0x0d, 0x01,
+    0x32, 0x51, 0xc6, 0xaf, 0x06, 0x0f, 0xa4, 0x70, 0x46, 0x4d, 0x6c, 0xc0,
+    0x97, 0xa8, 0x46, 0x8f, 0x12, 0x40, 0x97, 0xb4, 0x8e, 0x0f, 0xa3, 0x3b,
+    0x00, 0x97, 0xd2, 0xc9, 0xb3, 0xa7, 0x0f, 0xcc, 0x90, 0xc9, 0xb3, 0x29,
+    0x0f, 0x98, 0xf9, 0xd1, 0x54, 0xa8, 0x0f, 0x98, 0x81, 0xc3, 0x26, 0x19,
+    0x0f, 0xcf, 0x20, 0x48, 0x4f, 0x6b, 0xc0, 0x97, 0xd8, 0xca, 0xa6, 0x52,
+    0x0f, 0xca, 0xd8, 0xc4, 0xdf, 0x0b, 0x0f, 0xcd, 0x39, 0x42, 0x00, 0x5d,
+    0x40, 0x97, 0xe4, 0xc8, 0x27, 0xbc, 0x01, 0x15, 0xb1, 0x43, 0x38, 0x5f,
+    0x40, 0x97, 0xf0, 0xd0, 0x1d, 0xec, 0x07, 0xe9, 0xf1, 0xd1, 0x1a, 0x4a,
+    0x07, 0xe9, 0xf8, 0x4d, 0x53, 0xa9, 0xc0, 0x98, 0x18, 0x47, 0x34, 0x2f,
+    0xc0, 0x98, 0x24, 0xc8, 0xba, 0x12, 0x0f, 0x69, 0x71, 0x51, 0x4f, 0x03,
+    0x40, 0x98, 0x4b, 0xc4, 0xdf, 0x13, 0x0f, 0xb4, 0xb1, 0xc3, 0x22, 0xd3,
+    0x0f, 0xb4, 0x69, 0xca, 0x9f, 0x90, 0x0f, 0xb4, 0xa1, 0xca, 0xa0, 0x4e,
+    0x0f, 0xb4, 0xc1, 0xcb, 0x91, 0x4c, 0x0f, 0xb7, 0x88, 0x00, 0xc0, 0x98,
+    0x63, 0xcf, 0x6a, 0xcb, 0x0f, 0xd3, 0x88, 0xe0, 0x02, 0x47, 0x0f, 0xa8,
+    0xd8, 0x10, 0xc0, 0x98, 0x6f, 0xd5, 0x36, 0x71, 0x00, 0x04, 0xe8, 0xc6,
+    0xcb, 0xd5, 0x01, 0x19, 0x29, 0xc8, 0xb7, 0xca, 0x0f, 0xa5, 0xfa, 0x00,
+    0x98, 0x77, 0x00, 0xc0, 0x98, 0x7d, 0x43, 0x00, 0x29, 0x40, 0x98, 0xb3,
+    0x12, 0xc0, 0x98, 0xc5, 0xc4, 0x14, 0x4c, 0x00, 0xe3, 0xe9, 0xc5, 0xd6,
+    0xf5, 0x00, 0xe3, 0xd9, 0x42, 0x14, 0x48, 0xc0, 0x98, 0xd1, 0xd0, 0x4f,
+    0x37, 0x00, 0xe3, 0xc9, 0x47, 0x02, 0x0e, 0xc0, 0x98, 0xdd, 0x46, 0x09,
+    0x97, 0x40, 0x98, 0xf5, 0x46, 0x0c, 0x51, 0xc0, 0x99, 0x19, 0xc8, 0xb6,
+    0x1a, 0x0f, 0xa7, 0x20, 0x06, 0xc0, 0x99, 0x31, 0x05, 0xc0, 0x99, 0x3d,
+    0xcf, 0x6a, 0xf8, 0x01, 0x22, 0x39, 0x04, 0xc0, 0x99, 0x49, 0xcd, 0x7e,
+    0xca, 0x01, 0x22, 0x19, 0xc4, 0x4a, 0x3f, 0x01, 0x22, 0x11, 0xc4, 0x01,
+    0x23, 0x01, 0x22, 0x00, 0xc4, 0x7e, 0x7a, 0x0f, 0xa0, 0xc9, 0xcb, 0x99,
+    0xce, 0x0f, 0xb6, 0x88, 0x4e, 0x6e, 0x3c, 0xc0, 0x99, 0x5b, 0xc6, 0x59,
+    0x92, 0x01, 0x72, 0xe8, 0xc3, 0x02, 0x6e, 0x01, 0x01, 0xf1, 0xc2, 0x00,
+    0xb6, 0x0f, 0xae, 0xba, 0x00, 0x99, 0x67, 0xd5, 0x37, 0x97, 0x00, 0xb4,
+    0xe1, 0xcc, 0x37, 0xa0, 0x00, 0xb4, 0xd9, 0x47, 0x02, 0x0e, 0xc0, 0x99,
+    0x6d, 0xca, 0xa5, 0x1c, 0x00, 0xb4, 0x00, 0x47, 0x02, 0x0e, 0xc0, 0x99,
+    0xc7, 0x46, 0x09, 0x97, 0x40, 0x9a, 0x4a, 0x4f, 0x0b, 0x17, 0xc0, 0x9a,
+    0x6e, 0x4d, 0x29, 0xb9, 0x40, 0x9a, 0xd5, 0x12, 0xc0, 0x9b, 0x3c, 0xc5,
+    0xdb, 0x73, 0x0e, 0x7e, 0x11, 0x06, 0xc0, 0x9b, 0x4d, 0x11, 0xc0, 0x9b,
+    0x63, 0x0d, 0xc0, 0x9b, 0x72, 0x15, 0xc0, 0x9b, 0x90, 0xc6, 0xd2, 0xfb,
+    0x0e, 0x7d, 0x3b, 0x00, 0x9b, 0xa3, 0x1c, 0xc0, 0x9b, 0xa7, 0xc4, 0xe0,
+    0x1b, 0x0e, 0x7c, 0x19, 0x14, 0xc0, 0x9b, 0xb1, 0x42, 0x11, 0xee, 0xc0,
+    0x9b, 0xbd, 0x49, 0xb1, 0x79, 0xc0, 0x9b, 0xc9, 0x4a, 0xa0, 0x8a, 0x40,
+    0x9b, 0xe7, 0xc3, 0x23, 0x6d, 0x0e, 0x7a, 0x31, 0xc5, 0x78, 0xdb, 0x0e,
+    0x7a, 0x29, 0xce, 0x72, 0xe2, 0x0e, 0x7a, 0x21, 0x46, 0xce, 0xe7, 0x40,
+    0x9b, 0xfd, 0xdb, 0x18, 0xf6, 0x0e, 0x7a, 0x09, 0x45, 0x01, 0xc3, 0xc0,
+    0x9c, 0x05, 0xd7, 0x29, 0x40, 0x0e, 0x79, 0xf1, 0x51, 0x54, 0x75, 0x40,
+    0x9c, 0x57, 0xc8, 0xba, 0xca, 0x08, 0xd2, 0x39, 0x44, 0x00, 0xbb, 0x40,
+    0x9c, 0x69, 0x46, 0x37, 0xee, 0xc0, 0x9c, 0x7b, 0x46, 0x26, 0xd5, 0x40,
+    0x9c, 0x87, 0xd6, 0x2d, 0xe6, 0x08, 0xd2, 0x29, 0xc9, 0x15, 0xcc, 0x08,
+    0xd1, 0xf8, 0xca, 0xa4, 0x36, 0x08, 0xd2, 0x21, 0xcb, 0x99, 0x6b, 0x08,
+    0xd2, 0x19, 0xc4, 0x01, 0xe2, 0x08, 0xd2, 0x11, 0xc5, 0x32, 0x89, 0x08,
+    0xd2, 0x08, 0x0d, 0xc0, 0x9c, 0x93, 0xc2, 0x00, 0xd0, 0x08, 0xd1, 0x89,
+    0x15, 0xc0, 0x9c, 0xa3, 0xc2, 0x02, 0x41, 0x08, 0xd1, 0x69, 0xc2, 0x00,
+    0xdb, 0x08, 0xd1, 0x61, 0xc2, 0x00, 0x39, 0x08, 0xd1, 0x59, 0xc2, 0x19,
+    0x2c, 0x08, 0xd1, 0x51, 0xc2, 0x00, 0x02, 0x08, 0xd1, 0x49, 0x1c, 0xc0,
+    0x9c, 0xb3, 0x06, 0xc0, 0x9c, 0xbd, 0x16, 0xc0, 0x9c, 0xcf, 0xc2, 0x01,
+    0xc3, 0x08, 0xd1, 0x11, 0x04, 0xc0, 0x9c, 0xe1, 0x12, 0xc0, 0x9c, 0xeb,
+    0x10, 0xc0, 0x9c, 0xf5, 0xc2, 0x25, 0x3b, 0x08, 0xd0, 0x91, 0x05, 0xc0,
+    0x9d, 0x0b, 0x09, 0xc0, 0x9d, 0x15, 0x83, 0x08, 0xd0, 0x00, 0xcb, 0x36,
+    0x51, 0x08, 0xd0, 0x51, 0x45, 0x00, 0xba, 0x40, 0x9d, 0x1f, 0xd5, 0x34,
+    0xa3, 0x01, 0x51, 0xf1, 0x45, 0x00, 0x2d, 0xc0, 0x9d, 0x3f, 0xd4, 0x3a,
+    0xc0, 0x01, 0x53, 0x28, 0x46, 0xcc, 0x23, 0xc0, 0x9d, 0x4b, 0xc3, 0x3a,
+    0x48, 0x01, 0x4c, 0x08, 0xcf, 0x60, 0x30, 0x01, 0x4c, 0x49, 0xcd, 0x7d,
+    0x6b, 0x01, 0x4c, 0x38, 0xc6, 0x57, 0xec, 0x01, 0x00, 0x69, 0x42, 0x00,
+    0x10, 0xc0, 0x9d, 0x55, 0xc5, 0x40, 0x88, 0x01, 0x00, 0x58, 0xcb, 0x95,
+    0x82, 0x01, 0x37, 0xd9, 0xd3, 0x44, 0xdb, 0x0f, 0xa9, 0x81, 0xc6, 0xcf,
+    0x1d, 0x0f, 0xa3, 0xd1, 0xc4, 0xc9, 0x19, 0x0f, 0xa3, 0xc9, 0xcb, 0x95,
+    0x6c, 0x0f, 0x9f, 0x19, 0xc5, 0xb0, 0x15, 0x0f, 0x9c, 0x71, 0xc6, 0xcd,
+    0x2b, 0x0f, 0x9f, 0x79, 0xda, 0x19, 0x46, 0x01, 0x80, 0x20, 0x42, 0x00,
+    0xb0, 0xc0, 0x9d, 0x61, 0x42, 0x00, 0x49, 0xc0, 0x9d, 0x6d, 0x46, 0x09,
+    0x97, 0xc0, 0x9d, 0x79, 0xd3, 0x45, 0x99, 0x05, 0x4e, 0x69, 0xcf, 0x60,
+    0xc6, 0x05, 0x4e, 0x11, 0x4f, 0x30, 0x90, 0xc0, 0x9d, 0x9d, 0x4b, 0x6f,
+    0xc7, 0xc0, 0x9d, 0xaf, 0x45, 0x00, 0xba, 0x40, 0x9d, 0xd1, 0x44, 0x02,
+    0xbe, 0xc0, 0x9d, 0xec, 0x45, 0x44, 0xba, 0x40, 0x9d, 0xf8, 0xd0, 0x0f,
+    0x09, 0x01, 0x02, 0x41, 0xc4, 0x01, 0xc3, 0x00, 0x01, 0xf8, 0x49, 0x14,
+    0x89, 0xc0, 0x9e, 0x04, 0x48, 0x91, 0xff, 0x40, 0x9e, 0x7d, 0x47, 0x02,
+    0x0e, 0xc0, 0x9e, 0xcf, 0xd0, 0x59, 0x92, 0x08, 0x75, 0x69, 0x4a, 0x51,
+    0x89, 0x40, 0x9f, 0x54, 0x8e, 0x00, 0x00, 0xc3, 0x00, 0x9f, 0x60, 0x94,
+    0x01, 0x32, 0x58, 0x95, 0x00, 0xa8, 0x2b, 0x00, 0x9f, 0x6a, 0x90, 0x00,
+    0xa6, 0x83, 0x00, 0x9f, 0x95, 0x85, 0x00, 0xa5, 0x0b, 0x00, 0x9f, 0xd2,
+    0x04, 0xc0, 0x9f, 0xf5, 0x96, 0x00, 0xa3, 0x33, 0x00, 0xa0, 0x07, 0x19,
+    0xc0, 0xa0, 0x39, 0x94, 0x00, 0xaa, 0x83, 0x00, 0xa0, 0x55, 0x88, 0x00,
+    0xaa, 0xeb, 0x00, 0xa0, 0x78, 0x87, 0x00, 0xa0, 0x0b, 0x00, 0xa0, 0x9d,
+    0x91, 0x00, 0xa0, 0x2b, 0x00, 0xa0, 0xa7, 0x9b, 0x00, 0xa9, 0xf3, 0x00,
+    0xa0, 0xb9, 0x8e, 0x00, 0xa7, 0x53, 0x00, 0xa0, 0xdc, 0x8f, 0x00, 0xa5,
+    0xdb, 0x00, 0xa1, 0x00, 0x8d, 0x00, 0xa4, 0x1b, 0x00, 0xa1, 0x24, 0x92,
+    0x00, 0xa2, 0x4b, 0x00, 0xa1, 0x44, 0x83, 0x00, 0xa0, 0x53, 0x00, 0xa1,
+    0x61, 0x93, 0x00, 0xac, 0x2b, 0x00, 0xa1, 0x7d, 0x0a, 0xc0, 0xa1, 0x92,
+    0x8b, 0x00, 0xa0, 0x1b, 0x00, 0xa1, 0x9c, 0xcc, 0x23, 0x33, 0x00, 0xa0,
+    0xf0, 0xc2, 0x00, 0x49, 0x0f, 0xab, 0x79, 0x9b, 0x0f, 0x9b, 0x60, 0xc3,
+    0x00, 0x54, 0x01, 0x08, 0x29, 0x96, 0x01, 0x01, 0xc2, 0x00, 0xa1, 0xa4,
+    0xc8, 0xb6, 0x32, 0x0f, 0xae, 0x19, 0xc5, 0x06, 0x82, 0x0f, 0xa6, 0x3a,
+    0x00, 0xa1, 0xaa, 0xca, 0xa0, 0x80, 0x0f, 0x9d, 0x01, 0x90, 0x00, 0x16,
+    0x38, 0xc9, 0xaa, 0x4d, 0x0f, 0x9c, 0x79, 0xc9, 0xb2, 0x99, 0x0f, 0xd4,
+    0xd0, 0xcb, 0x75, 0x5a, 0x00, 0x00, 0x69, 0xc2, 0x01, 0xbb, 0x0f, 0xca,
+    0xa8, 0x97, 0x08, 0x15, 0x93, 0x00, 0xa1, 0xb0, 0x94, 0x08, 0x15, 0x2b,
+    0x00, 0xa1, 0xb7, 0x8e, 0x08, 0x15, 0x1b, 0x00, 0xa1, 0xbb, 0x83, 0x08,
+    0x15, 0x03, 0x00, 0xa1, 0xc2, 0x93, 0x08, 0x15, 0x41, 0x84, 0x08, 0x15,
+    0x49, 0x8f, 0x08, 0x15, 0x53, 0x00, 0xa1, 0xc6, 0x91, 0x08, 0x15, 0x59,
+    0x86, 0x08, 0x15, 0x13, 0x00, 0xa1, 0xcd, 0x96, 0x08, 0x15, 0x6b, 0x00,
+    0xa1, 0xd1, 0x95, 0x08, 0x15, 0x83, 0x00, 0xa1, 0xd8, 0x42, 0x09, 0x8f,
+    0xc0, 0xa1, 0xea, 0x90, 0x08, 0x15, 0xab, 0x00, 0xa1, 0xf6, 0x9a, 0x08,
+    0x15, 0xa1, 0x92, 0x08, 0x15, 0xbb, 0x00, 0xa2, 0x02, 0x8b, 0x08, 0x15,
+    0xcb, 0x00, 0xa2, 0x06, 0x87, 0x08, 0x15, 0xd3, 0x00, 0xa2, 0x0a, 0x8d,
+    0x08, 0x15, 0xe3, 0x00, 0xa2, 0x0e, 0x89, 0x08, 0x16, 0x02, 0x00, 0xa2,
+    0x12, 0x47, 0x02, 0x0e, 0xc0, 0xa2, 0x16, 0xcd, 0x79, 0x8f, 0x08, 0x2b,
+    0x78, 0xcb, 0x8d, 0xbb, 0x0f, 0xa7, 0xc0, 0x46, 0x00, 0x8b, 0x40, 0xa2,
+    0x8a, 0x26, 0xc0, 0xa2, 0x96, 0x25, 0xc0, 0xa2, 0xd6, 0x03, 0x40, 0xa3,
+    0x16, 0x03, 0xc0, 0xa3, 0x1e, 0x26, 0x40, 0xa3, 0x56, 0xc5, 0x61, 0xf7,
+    0x01, 0x74, 0x01, 0x03, 0x40, 0xa3, 0x96, 0x0e, 0xc0, 0xa3, 0xa4, 0xc4,
+    0xdf, 0xfb, 0x01, 0x74, 0xd9, 0x0b, 0xc0, 0xa3, 0xb0, 0xc2, 0x00, 0x27,
+    0x01, 0x75, 0x39, 0x4c, 0x8c, 0x6d, 0x40, 0xa3, 0xbc, 0x07, 0xc0, 0xa3,
+    0xf2, 0x45, 0x03, 0x14, 0xc0, 0xa3, 0xfe, 0x10, 0xc0, 0xa4, 0x0a, 0xc2,
+    0x05, 0x1d, 0x01, 0x74, 0xe1, 0x0b, 0xc0, 0xa4, 0x16, 0x46, 0xcd, 0xaf,
+    0xc0, 0xa4, 0x22, 0xc4, 0xdf, 0x97, 0x01, 0x75, 0xb0, 0xc5, 0x18, 0x8f,
+    0x01, 0x74, 0x29, 0x43, 0x39, 0x8b, 0x40, 0xa4, 0x2e, 0x11, 0xc0, 0xa4,
+    0x3a, 0xc5, 0xc0, 0xd0, 0x01, 0x75, 0x71, 0x45, 0xdc, 0x09, 0xc0, 0xa4,
+    0x4a, 0xc3, 0x87, 0x22, 0x01, 0x76, 0xc0, 0xc4, 0x14, 0x8d, 0x01, 0x74,
+    0x39, 0xc5, 0x8c, 0xf0, 0x01, 0x74, 0x99, 0xc4, 0xe1, 0x3b, 0x01, 0x76,
+    0x09, 0xc5, 0xd5, 0x65, 0x01, 0x77, 0x88, 0xc3, 0x05, 0x14, 0x01, 0x74,
+    0x41, 0xc3, 0x02, 0x9f, 0x01, 0x74, 0x48, 0xc9, 0xab, 0xac, 0x01, 0x74,
+    0x51, 0xc4, 0x04, 0xa6, 0x01, 0x74, 0xf1, 0xc2, 0x13, 0x38, 0x01, 0x75,
+    0x40, 0x44, 0xb3, 0x85, 0xc0, 0xa4, 0x56, 0x44, 0x08, 0x48, 0x40, 0xa4,
+    0x66, 0x42, 0x01, 0x9c, 0xc0, 0xa4, 0x72, 0xc3, 0x02, 0x9b, 0x01, 0x74,
+    0xc1, 0xc3, 0x00, 0xbf, 0x01, 0x76, 0x38, 0x11, 0xc0, 0xa4, 0x7c, 0x07,
+    0x40, 0xa4, 0x94, 0x03, 0xc0, 0xa4, 0xa0, 0x44, 0x15, 0xa8, 0x40, 0xa4,
+    0xac, 0xc3, 0x05, 0xba, 0x01, 0x75, 0x19, 0xc3, 0x65, 0xba, 0x01, 0x76,
+    0x50, 0xc3, 0x01, 0x9d, 0x01, 0x75, 0x49, 0x4c, 0x8c, 0x6d, 0x40, 0xa4,
+    0xb8, 0xc2, 0x0c, 0x43, 0x01, 0x75, 0x59, 0xc2, 0x00, 0x28, 0x01, 0x75,
+    0xc1, 0x43, 0x0a, 0x0c, 0x40, 0xa4, 0xc8, 0xc3, 0x05, 0x14, 0x01, 0x75,
+    0x89, 0x16, 0xc0, 0xa4, 0xd2, 0xc4, 0x09, 0x9d, 0x01, 0x75, 0xa0, 0x45,
+    0x1b, 0xa0, 0xc0, 0xa4, 0xde, 0xc4, 0xe0, 0x07, 0x01, 0x77, 0x20, 0x90,
+    0x01, 0x8e, 0xe8, 0x99, 0x01, 0x8e, 0x23, 0x00, 0xa4, 0xe8, 0x9c, 0x01,
+    0x8e, 0xbb, 0x00, 0xa4, 0xf0, 0x92, 0x01, 0x8e, 0x99, 0x96, 0x01, 0x8e,
+    0xc9, 0x89, 0x01, 0x8e, 0xd0, 0x9c, 0x01, 0x8e, 0xab, 0x00, 0xa4, 0xfa,
+    0x92, 0x01, 0x8e, 0x3b, 0x00, 0xa5, 0x10, 0x89, 0x01, 0x8e, 0xb1, 0xc3,
+    0xe6, 0x56, 0x01, 0x8f, 0x00, 0x86, 0x01, 0x8e, 0xd9, 0x9c, 0x01, 0x8e,
+    0xe1, 0x89, 0x01, 0x8f, 0x10, 0xc8, 0x78, 0xcc, 0x0f, 0xb3, 0xf3, 0x00,
+    0xa5, 0x16, 0xc5, 0x01, 0xc2, 0x01, 0x38, 0x98, 0xce, 0x6d, 0xb0, 0x0f,
+    0xa7, 0x19, 0xc8, 0xbb, 0x4a, 0x0f, 0xce, 0x00, 0x45, 0xde, 0x1b, 0xc0,
+    0xa5, 0x1c, 0x14, 0x40, 0xa5, 0x28, 0x94, 0x0f, 0xd4, 0x89, 0xc2, 0x05,
+    0x26, 0x01, 0x36, 0x98, 0x47, 0xc2, 0xf1, 0xc0, 0xa5, 0x34, 0x47, 0x07,
+    0x93, 0x40, 0xa5, 0x43, 0x47, 0x02, 0x0e, 0xc0, 0xa5, 0x52, 0x18, 0xc0,
+    0xa5, 0xb4, 0xcd, 0x2c, 0xb2, 0x08, 0x8a, 0x19, 0x06, 0xc0, 0xa5, 0xc0,
+    0x15, 0xc0, 0xa5, 0xd2, 0xc7, 0xc2, 0xab, 0x08, 0x89, 0xa1, 0xc7, 0xc3,
+    0xd8, 0x08, 0x89, 0x91, 0xc6, 0xb6, 0x44, 0x08, 0x89, 0x88, 0x4f, 0x30,
+    0x90, 0xc0, 0xa5, 0xde, 0x4b, 0x6f, 0xc7, 0xc0, 0xa5, 0xfc, 0x47, 0x02,
+    0x0e, 0xc0, 0xa6, 0x1b, 0x4c, 0x11, 0xe2, 0xc0, 0xa6, 0x84, 0x46, 0x09,
+    0x97, 0x40, 0xa6, 0x94, 0xcc, 0x88, 0xa1, 0x0f, 0xb5, 0xc0, 0x47, 0x34,
+    0x2f, 0xc0, 0xa6, 0xb8, 0x47, 0x02, 0x0e, 0x40, 0xa6, 0xcb, 0xc8, 0x1d,
+    0x3c, 0x0f, 0xb1, 0xf9, 0xc4, 0x00, 0x87, 0x0f, 0xb1, 0x10, 0x00, 0xc0,
+    0xa7, 0x30, 0xc9, 0xae, 0xe8, 0x01, 0x36, 0x61, 0x43, 0x00, 0xa8, 0x40,
+    0xa7, 0x40, 0xca, 0x9b, 0xee, 0x0f, 0x9b, 0xc1, 0xc5, 0xc9, 0x75, 0x0f,
+    0xd5, 0x98, 0x09, 0xc0, 0xa7, 0x52, 0x03, 0xc0, 0xa7, 0x5c, 0x14, 0xc0,
+    0xa7, 0x72, 0x0e, 0xc0, 0xa7, 0x7a, 0x42, 0x00, 0x8c, 0xc0, 0xa7, 0x90,
+    0x16, 0xc0, 0xa7, 0x9c, 0x06, 0xc0, 0xa7, 0xb7, 0x07, 0xc0, 0xa7, 0xc8,
+    0x08, 0xc0, 0xa7, 0xd4, 0x05, 0xc0, 0xa7, 0xe0, 0x15, 0xc0, 0xa8, 0x03,
+    0x04, 0xc0, 0xa8, 0x25, 0x42, 0x02, 0x2b, 0xc0, 0xa8, 0x2f, 0x17, 0xc0,
+    0xa8, 0x3b, 0x0b, 0xc0, 0xa8, 0x4b, 0x47, 0x2e, 0x48, 0xc0, 0xa8, 0x55,
+    0x11, 0xc0, 0xa8, 0x61, 0x0f, 0xc0, 0xa8, 0x7c, 0x12, 0xc0, 0xa8, 0x8b,
+    0x10, 0xc0, 0xa8, 0x95, 0x1a, 0xc0, 0xa8, 0xa1, 0x42, 0x01, 0x23, 0xc0,
+    0xa8, 0xab, 0x49, 0x07, 0xbb, 0x40, 0xa8, 0xbd, 0xce, 0x72, 0x80, 0x01,
+    0x1c, 0x21, 0xc6, 0x81, 0x9c, 0x01, 0x10, 0x09, 0xc7, 0x50, 0x25, 0x0f,
+    0xae, 0xe1, 0xc3, 0x1b, 0xa1, 0x0f, 0xcf, 0x68, 0x47, 0xb4, 0x64, 0xc0,
+    0xa8, 0xc9, 0x83, 0x00, 0x01, 0x60, 0x48, 0xb6, 0xaa, 0xc0, 0xa8, 0xd5,
+    0x42, 0x00, 0x29, 0x40, 0xa8, 0xe1, 0xd7, 0x16, 0xc3, 0x01, 0x1c, 0x09,
+    0x45, 0xc2, 0x13, 0xc0, 0xa8, 0xed, 0xcc, 0x62, 0xe5, 0x01, 0x11, 0x71,
+    0x44, 0x7e, 0xe0, 0x40, 0xa8, 0xf9, 0xc6, 0xd3, 0xa9, 0x0f, 0xa3, 0xb9,
+    0xc4, 0x00, 0xba, 0x0f, 0xb5, 0x38, 0xc9, 0xb0, 0x74, 0x0f, 0x9c, 0x51,
+    0xcb, 0x98, 0x16, 0x0f, 0xb0, 0xb1, 0xc9, 0x96, 0x1e, 0x0f, 0xb0, 0xa8,
+    0x00, 0x40, 0xa9, 0x05, 0xc2, 0x00, 0x75, 0x0f, 0x9b, 0x99, 0x87, 0x0f,
+    0x9b, 0x50, 0xcb, 0x8d, 0x79, 0x0f, 0x89, 0x79, 0xca, 0x9d, 0x6a, 0x00,
+    0x05, 0x48, 0x15, 0xc0, 0xa9, 0x11, 0x05, 0xc0, 0xa9, 0x1d, 0x46, 0xd1,
+    0x4b, 0xc0, 0xa9, 0x29, 0x4b, 0x96, 0x06, 0xc0, 0xa9, 0x3b, 0x08, 0xc0,
+    0xa9, 0x53, 0xd5, 0x36, 0xda, 0x01, 0x67, 0xf8, 0xc7, 0xb4, 0xd2, 0x0f,
+    0xca, 0x11, 0xc9, 0xb2, 0x36, 0x0f, 0x9b, 0xd8, 0x42, 0x00, 0xa9, 0xc0,
+    0xa9, 0x5f, 0xc3, 0x02, 0xad, 0x01, 0x02, 0x80, 0x45, 0x05, 0xfd, 0xc0,
+    0xa9, 0x81, 0x46, 0x11, 0x55, 0x40, 0xa9, 0xa7, 0x46, 0x00, 0x8b, 0x40,
+    0xa9, 0xc3, 0xce, 0x6c, 0x7c, 0x0f, 0xa2, 0x79, 0xc8, 0x78, 0xcc, 0x0f,
+    0x9d, 0x60, 0x42, 0x00, 0xa9, 0xc0, 0xa9, 0xdb, 0x00, 0x40, 0xaa, 0x3d,
+    0xc6, 0xcc, 0x89, 0x0f, 0x9d, 0x51, 0xcf, 0x69, 0x27, 0x01, 0x50, 0x81,
+    0xcc, 0x08, 0xfb, 0x00, 0x02, 0xf0, 0x1c, 0xc0, 0xaa, 0x49, 0x97, 0x09,
+    0x18, 0x5b, 0x00, 0xaa, 0x64, 0x16, 0xc0, 0xaa, 0x9f, 0x15, 0xc0, 0xaa,
+    0xbb, 0x10, 0xc0, 0xaa, 0xd4, 0x0f, 0xc0, 0xaa, 0xf0, 0x0e, 0xc0, 0xab,
+    0x0c, 0x0d, 0xc0, 0xab, 0x21, 0x0a, 0xc0, 0xab, 0x42, 0x09, 0xc0, 0xab,
+    0x57, 0x87, 0x09, 0x04, 0x53, 0x00, 0xab, 0x70, 0x06, 0xc0, 0xab, 0xa8,
+    0x04, 0xc0, 0xab, 0xbd, 0x83, 0x09, 0x00, 0x03, 0x00, 0xab, 0xd2, 0x12,
+    0xc0, 0xac, 0x16, 0x14, 0xc0, 0xac, 0x2d, 0x8b, 0x09, 0x09, 0xfa, 0x00,
+    0xac, 0x3c, 0x49, 0x1e, 0x56, 0xc0, 0xac, 0x72, 0xce, 0x74, 0x16, 0x09,
+    0x23, 0x89, 0xd9, 0x1d, 0xba, 0x09, 0x23, 0x80, 0x42, 0x00, 0xec, 0xc0,
+    0xac, 0x84, 0x07, 0xc0, 0xac, 0x90, 0x15, 0xc0, 0xac, 0x9c, 0x08, 0xc0,
+    0xac, 0xae, 0x11, 0xc0, 0xac, 0xba, 0x16, 0x40, 0xac, 0xc6, 0x42, 0x00,
+    0x36, 0xc0, 0xac, 0xd2, 0xc9, 0xaf, 0x03, 0x0f, 0xca, 0x60, 0x45, 0x3a,
+    0xd8, 0xc0, 0xac, 0xde, 0xca, 0x9e, 0x96, 0x0f, 0x9a, 0xd8, 0xcf, 0x55,
+    0xa9, 0x01, 0x37, 0xf1, 0xca, 0x9e, 0xb4, 0x0f, 0xcb, 0x20, 0xcc, 0x87,
+    0x81, 0x01, 0x08, 0x21, 0x45, 0x02, 0x6d, 0x40, 0xac, 0xea, 0x42, 0xe6,
+    0x4a, 0xc0, 0xac, 0xf6, 0x1e, 0xc0, 0xac, 0xfe, 0x1d, 0x40, 0xad, 0x06,
+    0x19, 0xc0, 0xad, 0x2e, 0x1a, 0xc0, 0xad, 0x3e, 0x1c, 0xc0, 0xad, 0x46,
+    0x83, 0x08, 0x40, 0x01, 0x87, 0x08, 0x40, 0x09, 0x8b, 0x08, 0x40, 0x11,
+    0x91, 0x08, 0x40, 0x19, 0x97, 0x08, 0x40, 0x21, 0x0c, 0xc0, 0xad, 0x4e,
+    0x0d, 0xc0, 0xad, 0x56, 0x0e, 0xc0, 0xad, 0x6a, 0x0f, 0xc0, 0xad, 0x7e,
+    0x10, 0xc0, 0xad, 0x92, 0x12, 0xc0, 0xad, 0xa6, 0x14, 0xc0, 0xad, 0xba,
+    0x15, 0xc0, 0xad, 0xce, 0x16, 0x40, 0xad, 0xe2, 0xd0, 0x5a, 0xa2, 0x00,
+    0xe9, 0x59, 0xc8, 0xbe, 0xaa, 0x00, 0x26, 0x01, 0xcd, 0x7f, 0xb4, 0x05,
+    0x33, 0x70, 0x46, 0x02, 0x0f, 0xc0, 0xad, 0xf6, 0x48, 0x19, 0x9b, 0x40,
+    0xae, 0x73, 0x46, 0x02, 0x0f, 0xc0, 0xae, 0x85, 0x48, 0x19, 0x9b, 0x40,
+    0xaf, 0x04, 0xc4, 0x26, 0x78, 0x0f, 0xdf, 0xc9, 0xc4, 0x15, 0xe7, 0x0f,
+    0xdf, 0x81, 0xc3, 0x05, 0x14, 0x0f, 0xdf, 0x89, 0x16, 0xc0, 0xaf, 0x16,
+    0x08, 0xc0, 0xaf, 0x22, 0x15, 0xc0, 0xaf, 0x2e, 0xc5, 0x06, 0xdb, 0x0f,
+    0xdf, 0xc0, 0xe0, 0x07, 0x87, 0x01, 0x51, 0x90, 0xc2, 0x00, 0xbf, 0x01,
+    0x18, 0xa1, 0xc8, 0x08, 0xe8, 0x00, 0x05, 0x38, 0xe0, 0x00, 0x87, 0x0f,
+    0xc9, 0x60, 0x47, 0xc1, 0x1c, 0xc0, 0xaf, 0x3a, 0x00, 0x40, 0xaf, 0x42,
+    0x48, 0x78, 0xbf, 0xc0, 0xaf, 0x5e, 0x45, 0x00, 0xba, 0xc0, 0xaf, 0x6a,
+    0x0e, 0xc0, 0xaf, 0x7a, 0x4b, 0x6f, 0xc7, 0xc0, 0xaf, 0x86, 0xd6, 0x2d,
+    0x20, 0x00, 0x6f, 0xa0, 0x14, 0xc0, 0xaf, 0x9c, 0x08, 0xc0, 0xaf, 0xa8,
+    0xcb, 0x1a, 0x50, 0x0e, 0xd4, 0x59, 0x05, 0xc0, 0xaf, 0xc2, 0x15, 0xc0,
+    0xaf, 0xcc, 0x0e, 0xc0, 0xaf, 0xea, 0x42, 0x02, 0xae, 0xc0, 0xaf, 0xf4,
+    0x16, 0xc0, 0xaf, 0xfa, 0xdb, 0x18, 0xa5, 0x0e, 0xd3, 0x79, 0x07, 0xc0,
+    0xb0, 0x08, 0x0a, 0xc0, 0xb0, 0x1a, 0x10, 0xc0, 0xb0, 0x27, 0x42, 0x00,
+    0xa2, 0xc0, 0xb0, 0x33, 0x42, 0x00, 0x38, 0xc0, 0xb0, 0x3f, 0x44, 0x8c,
+    0x27, 0xc0, 0xb0, 0x4b, 0x06, 0xc0, 0xb0, 0x57, 0x46, 0xd3, 0x9d, 0x40,
+    0xb0, 0x63, 0xe0, 0x04, 0x87, 0x01, 0x39, 0xf1, 0x47, 0x0a, 0xaa, 0x40,
+    0xb0, 0x75, 0x4b, 0x6f, 0xc7, 0xc0, 0xb0, 0x87, 0x47, 0x02, 0x0e, 0xc0,
+    0xb0, 0xaa, 0x15, 0xc0, 0xb1, 0x11, 0xd0, 0x5c, 0xe2, 0x08, 0xae, 0x49,
+    0x50, 0x5d, 0xf2, 0xc0, 0xb1, 0x1b, 0x06, 0x40, 0xb1, 0x27, 0x46, 0x04,
+    0x8f, 0xc0, 0xb1, 0x33, 0x46, 0x01, 0xfc, 0x40, 0xb1, 0x4b, 0xc9, 0x00,
+    0xca, 0x01, 0x54, 0xe9, 0xcc, 0x07, 0xc7, 0x01, 0x54, 0xf0, 0xdb, 0x16,
+    0x38, 0x01, 0x54, 0xf9, 0xde, 0x0e, 0xaa, 0x01, 0x55, 0x00, 0xcb, 0x6c,
+    0x2b, 0x0f, 0xb4, 0x11, 0xc8, 0xbf, 0xba, 0x0f, 0x9a, 0xe0, 0xc3, 0x00,
+    0x44, 0x0f, 0xb4, 0x49, 0xcd, 0x80, 0x77, 0x0f, 0xaf, 0xe8, 0x00, 0xc0,
+    0xb1, 0x63, 0x45, 0x2d, 0xd5, 0x40, 0xb1, 0x79, 0xc6, 0xd1, 0xf3, 0x01,
+    0x34, 0xd1, 0xcb, 0x99, 0x34, 0x01, 0x34, 0xa8, 0x44, 0x00, 0x2d, 0xc0,
+    0xb1, 0x95, 0xc6, 0xd3, 0x91, 0x0f, 0x9a, 0x98, 0xd2, 0x4b, 0x71, 0x01,
+    0x13, 0x19, 0xcd, 0x7b, 0xff, 0x00, 0x04, 0xe0, 0x45, 0x00, 0x8c, 0xc0,
+    0xb1, 0xa1, 0x48, 0xba, 0x8a, 0x40, 0xb1, 0xad, 0xc7, 0xc4, 0x09, 0x0f,
+    0xce, 0x11, 0xc3, 0x05, 0xba, 0x01, 0x30, 0x98, 0x45, 0x00, 0xba, 0xc0,
+    0xb1, 0xb9, 0x4b, 0x6f, 0xc7, 0xc0, 0xb1, 0xcb, 0x47, 0x02, 0x0e, 0xc0,
+    0xb1, 0xf1, 0xd4, 0x3d, 0x40, 0x05, 0x45, 0xa1, 0x06, 0x40, 0xb2, 0x5c,
+    0xd4, 0x10, 0xc9, 0x0f, 0xb3, 0xd1, 0x46, 0x11, 0x39, 0x40, 0xb2, 0x6e,
+    0xc8, 0xbd, 0x9a, 0x0f, 0xa7, 0x08, 0x03, 0xc0, 0xb2, 0x7a, 0x15, 0xc0,
+    0xb2, 0x90, 0xc4, 0xde, 0x9f, 0x00, 0x41, 0xd9, 0x1c, 0xc0, 0xb2, 0x9c,
+    0xc5, 0x7a, 0xc2, 0x00, 0x41, 0xc9, 0xcd, 0x7a, 0xba, 0x00, 0x41, 0xb9,
+    0xc3, 0xe5, 0xa2, 0x00, 0x41, 0x99, 0xc7, 0xc4, 0x33, 0x00, 0x41, 0x80,
+    0x44, 0x01, 0xc4, 0xc0, 0xb2, 0xa8, 0x4f, 0x0f, 0x5f, 0x40, 0xb2, 0xc9,
+    0x15, 0xc0, 0xb2, 0xd9, 0x91, 0x00, 0x41, 0x5b, 0x00, 0xb2, 0xe5, 0x8b,
+    0x00, 0x41, 0x51, 0x45, 0x2c, 0x86, 0xc0, 0xb2, 0xee, 0x97, 0x00, 0x41,
+    0x39, 0x83, 0x00, 0x41, 0x1b, 0x00, 0xb3, 0x01, 0x87, 0x00, 0x40, 0xe8,
+    0x16, 0xc0, 0xb3, 0x05, 0x15, 0xc0, 0xb3, 0x17, 0xc4, 0x49, 0x87, 0x00,
+    0x40, 0x99, 0xc3, 0xe5, 0x6f, 0x00, 0x40, 0x91, 0xc2, 0x02, 0x09, 0x00,
+    0x40, 0x81, 0x0b, 0xc0, 0xb3, 0x23, 0xc3, 0x20, 0x18, 0x00, 0x40, 0x69,
+    0xc3, 0x8c, 0x3f, 0x00, 0x40, 0x61, 0xc5, 0xdd, 0x7b, 0x00, 0x40, 0x59,
+    0xc4, 0xe1, 0x63, 0x00, 0x40, 0x51, 0xc3, 0x70, 0x3f, 0x00, 0x40, 0x49,
+    0xc3, 0x0a, 0xe2, 0x00, 0x40, 0x31, 0x04, 0xc0, 0xb3, 0x2f, 0xc5, 0x49,
+    0x80, 0x00, 0x40, 0x19, 0xc5, 0xb5, 0x1e, 0x00, 0x40, 0x11, 0xc4, 0xd8,
+    0xe5, 0x00, 0x40, 0x00, 0xcf, 0x40, 0x0c, 0x01, 0x31, 0x00, 0x8a, 0x0f,
+    0xcd, 0x29, 0xc8, 0x43, 0xb6, 0x0f, 0x9d, 0x80, 0x87, 0x01, 0x19, 0x99,
+    0x4a, 0xa0, 0x30, 0x40, 0xb3, 0x3b, 0x44, 0x00, 0x74, 0xc0, 0xb3, 0x47,
+    0xc6, 0xca, 0x85, 0x0f, 0xb1, 0x50, 0xcc, 0x82, 0xd1, 0x0f, 0xb2, 0x11,
+    0xcd, 0x7d, 0x5e, 0x0f, 0xb2, 0x08, 0x4c, 0x24, 0xe3, 0xc0, 0xb3, 0x59,
+    0x53, 0x41, 0xe3, 0x40, 0xb3, 0x6b, 0x8d, 0x0f, 0xcc, 0x41, 0x44, 0x45,
+    0xa1, 0x40, 0xb3, 0x77, 0xc6, 0x02, 0xd1, 0x01, 0x3a, 0x69, 0xc4, 0x0e,
+    0x6a, 0x01, 0x39, 0x81, 0xcb, 0x8e, 0x08, 0x01, 0x38, 0xf0, 0xc6, 0xd3,
+    0x8b, 0x0f, 0x9b, 0x39, 0x4b, 0x8c, 0x62, 0x40, 0xb3, 0xa7, 0x4c, 0x88,
+    0x29, 0xc0, 0xb4, 0x27, 0xc4, 0x2a, 0x3e, 0x0f, 0x9b, 0x81, 0x00, 0xc0,
+    0xb4, 0x3f, 0x95, 0x0f, 0xd3, 0x98, 0xc4, 0xe1, 0xe7, 0x0f, 0xb6, 0x69,
+    0xc7, 0xc6, 0x7f, 0x0f, 0xb6, 0x90, 0xc2, 0x00, 0x74, 0x00, 0x00, 0x79,
+    0xc3, 0x00, 0xa3, 0x00, 0x00, 0x70, 0xc2, 0x00, 0x45, 0x0f, 0xcc, 0x11,
+    0xc2, 0x11, 0xa5, 0x01, 0x32, 0x78, 0x46, 0x03, 0x13, 0xc0, 0xb4, 0x67,
+    0x48, 0x0b, 0x17, 0xc0, 0xb4, 0x77, 0xd4, 0x19, 0x9a, 0x0f, 0xb3, 0x80,
+    0xc2, 0x00, 0xc4, 0x0f, 0xad, 0xa9, 0xc7, 0xc4, 0xa3, 0x0f, 0xd4, 0xd8,
+    0xcd, 0x7b, 0xcb, 0x01, 0x36, 0x20, 0x45, 0x15, 0xa7, 0xc0, 0xb4, 0x9b,
+    0x45, 0x20, 0x6c, 0x40, 0xb4, 0xcb, 0xd0, 0x0d, 0xaa, 0x0f, 0xb3, 0x58,
+    0xcd, 0x80, 0x6a, 0x01, 0x4f, 0xb0, 0x9f, 0x08, 0xd5, 0x11, 0x9e, 0x08,
+    0xd5, 0x08, 0x45, 0x02, 0x9a, 0x40, 0xb4, 0xfb, 0xc5, 0xd7, 0x3b, 0x08,
+    0xd4, 0xe9, 0xcb, 0x99, 0x6b, 0x08, 0xd4, 0xe1, 0xc4, 0x01, 0xe2, 0x08,
+    0xd4, 0xd9, 0xc5, 0x32, 0x89, 0x08, 0xd4, 0xd0, 0xc8, 0xba, 0xca, 0x08,
+    0xd4, 0xc9, 0x44, 0x00, 0xbb, 0x40, 0xb5, 0x07, 0xc2, 0x00, 0x02, 0x08,
+    0xd4, 0xa9, 0x95, 0x08, 0xd4, 0xa3, 0x00, 0xb5, 0x1f, 0x8e, 0x08, 0xd4,
+    0x91, 0x94, 0x08, 0xd4, 0x89, 0x8f, 0x08, 0xd4, 0x81, 0x84, 0x08, 0xd4,
+    0x79, 0x90, 0x08, 0xd4, 0x73, 0x00, 0xb5, 0x23, 0x86, 0x08, 0xd4, 0x69,
+    0x8d, 0x08, 0xd4, 0x59, 0x89, 0x08, 0xd4, 0x50, 0x15, 0xc0, 0xb5, 0x27,
+    0xc2, 0x00, 0xdb, 0x08, 0xd4, 0x39, 0xc2, 0x00, 0x39, 0x08, 0xd4, 0x30,
+    0x0d, 0xc0, 0xb5, 0x31, 0xc2, 0x00, 0xd0, 0x08, 0xd4, 0x11, 0x15, 0xc0,
+    0xb5, 0x41, 0xc2, 0x02, 0x41, 0x08, 0xd3, 0xf1, 0xc2, 0x00, 0xdb, 0x08,
+    0xd3, 0xe9, 0xc2, 0x00, 0x39, 0x08, 0xd3, 0xe1, 0xc2, 0x19, 0x2c, 0x08,
+    0xd3, 0xd9, 0xc2, 0x00, 0x02, 0x08, 0xd3, 0xd1, 0x1c, 0xc0, 0xb5, 0x51,
+    0x06, 0xc0, 0xb5, 0x5b, 0x16, 0xc0, 0xb5, 0x6f, 0xc2, 0x01, 0xc3, 0x08,
+    0xd3, 0xa1, 0x04, 0xc0, 0xb5, 0x81, 0x12, 0xc0, 0xb5, 0x8b, 0x10, 0xc0,
+    0xb5, 0x95, 0x0c, 0xc0, 0xb5, 0xab, 0x05, 0xc0, 0xb5, 0xb5, 0x09, 0xc0,
+    0xb5, 0xbf, 0x83, 0x08, 0xd2, 0x80, 0xcb, 0x36, 0x51, 0x08, 0xd2, 0xd9,
+    0x45, 0x00, 0xba, 0x40, 0xb5, 0xc9, 0xd1, 0x31, 0xc8, 0x0f, 0xad, 0x61,
+    0xc9, 0xa9, 0x12, 0x0f, 0x9b, 0x31, 0xc6, 0x59, 0x92, 0x00, 0x05, 0x68,
+    0xc4, 0x26, 0x78, 0x08, 0x87, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0x87, 0xc1,
+    0x15, 0xc0, 0xb5, 0xe9, 0x08, 0xc0, 0xb5, 0xf5, 0x16, 0xc0, 0xb6, 0x01,
+    0xc3, 0x05, 0x14, 0x08, 0x87, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0x87, 0x80,
+    0x42, 0x01, 0xc3, 0xc0, 0xb6, 0x0d, 0x07, 0xc0, 0xb6, 0x15, 0xc2, 0x38,
+    0x2a, 0x08, 0x87, 0x31, 0xc2, 0x53, 0x31, 0x08, 0x87, 0x29, 0xc2, 0x14,
+    0x77, 0x08, 0x87, 0x21, 0xc2, 0x02, 0x98, 0x08, 0x87, 0x11, 0x10, 0xc0,
+    0xb6, 0x1f, 0xc3, 0xe5, 0xf9, 0x08, 0x87, 0x01, 0xc3, 0x38, 0x66, 0x08,
+    0x86, 0xf9, 0xc3, 0x14, 0x4b, 0x08, 0x86, 0xf1, 0xc3, 0x0f, 0xb6, 0x08,
+    0x86, 0xe9, 0xc3, 0x44, 0x79, 0x08, 0x86, 0xe1, 0xc3, 0x62, 0x26, 0x08,
+    0x86, 0xd9, 0xc3, 0xc1, 0x9d, 0x08, 0x86, 0xd1, 0xc3, 0x12, 0xae, 0x08,
+    0x86, 0xc1, 0xc3, 0x40, 0x40, 0x08, 0x86, 0xa9, 0xc3, 0x70, 0xaf, 0x08,
+    0x86, 0xa1, 0xc3, 0xe5, 0x87, 0x08, 0x86, 0x99, 0xc3, 0x44, 0x19, 0x08,
+    0x86, 0x91, 0xc3, 0x02, 0x97, 0x08, 0x86, 0x89, 0xc3, 0xc3, 0x6e, 0x08,
+    0x86, 0x80, 0xd4, 0x38, 0x90, 0x08, 0x7a, 0xc9, 0x44, 0x02, 0x9f, 0xc0,
+    0xb6, 0x31, 0xcf, 0x38, 0x95, 0x08, 0x7a, 0xb8, 0xc3, 0x05, 0x14, 0x08,
+    0x7a, 0x8b, 0x00, 0xb6, 0x40, 0x16, 0x40, 0xb6, 0x46, 0xcc, 0x08, 0x5b,
+    0x08, 0x7a, 0x81, 0xca, 0x9d, 0x38, 0x08, 0x7a, 0x79, 0xcf, 0x66, 0xed,
+    0x08, 0x7a, 0x71, 0x45, 0x11, 0xba, 0xc0, 0xb6, 0x52, 0x46, 0x0e, 0xd4,
+    0xc0, 0xb6, 0x5e, 0x49, 0x04, 0xf9, 0xc0, 0xb6, 0x6a, 0x44, 0x05, 0x18,
+    0x40, 0xb6, 0x76, 0x0e, 0xc0, 0xb6, 0x82, 0xc4, 0xe0, 0x4b, 0x08, 0x7a,
+    0x19, 0xc3, 0xb5, 0x3e, 0x08, 0x7a, 0x11, 0x15, 0xc0, 0xb6, 0x8e, 0xc9,
+    0x5d, 0xe2, 0x08, 0x7a, 0x01, 0xc2, 0x00, 0x67, 0x08, 0x79, 0xf1, 0x03,
+    0xc0, 0xb6, 0x98, 0xc3, 0x20, 0x18, 0x08, 0x79, 0xd9, 0xc3, 0x00, 0x4e,
+    0x08, 0x79, 0xd1, 0xc4, 0xe0, 0xe7, 0x08, 0x79, 0xc1, 0xc4, 0x4a, 0xb9,
+    0x08, 0x79, 0xb9, 0xc2, 0x01, 0x7f, 0x08, 0x79, 0x9b, 0x00, 0xb6, 0xa4,
+    0xc5, 0x4a, 0xb3, 0x08, 0x79, 0xa9, 0xc3, 0x7e, 0x89, 0x08, 0x79, 0xa1,
+    0xc5, 0x9c, 0xa2, 0x08, 0x79, 0x91, 0xc4, 0xe3, 0x27, 0x08, 0x79, 0x88,
+    0x00, 0xc0, 0xb6, 0xaa, 0x42, 0x00, 0xa9, 0x40, 0xb7, 0x06, 0xcd, 0x7a,
+    0xad, 0x0f, 0xaa, 0x29, 0x15, 0xc0, 0xb7, 0x5e, 0x06, 0xc0, 0xb7, 0x85,
+    0x10, 0xc0, 0xb7, 0x8f, 0xce, 0x6c, 0xec, 0x01, 0x20, 0xf9, 0xd0, 0x5e,
+    0x82, 0x01, 0x20, 0xf1, 0xcf, 0x64, 0x3b, 0x01, 0x20, 0xe9, 0x08, 0xc0,
+    0xb7, 0x99, 0x07, 0xc0, 0xb7, 0xa5, 0x42, 0x00, 0x64, 0xc0, 0xb7, 0xaf,
+    0xd3, 0x42, 0x42, 0x01, 0x20, 0x59, 0xc9, 0x1b, 0x00, 0x01, 0x20, 0x51,
+    0xd5, 0x33, 0xd1, 0x01, 0x20, 0x49, 0x04, 0xc0, 0xb7, 0xbb, 0xcb, 0x49,
+    0x4a, 0x01, 0x20, 0x31, 0xd2, 0x48, 0x47, 0x01, 0x5c, 0xb8, 0x47, 0x02,
+    0x0e, 0xc0, 0xb7, 0xc7, 0x0a, 0xc0, 0xb8, 0x39, 0x4d, 0x76, 0xb7, 0xc0,
+    0xb8, 0x4b, 0x14, 0xc0, 0xb8, 0x57, 0x47, 0xc0, 0x4a, 0xc0, 0xb8, 0x69,
+    0x47, 0xbf, 0xda, 0xc0, 0xb8, 0x7b, 0xd1, 0x48, 0x11, 0x00, 0x38, 0x79,
+    0x42, 0x00, 0x99, 0xc0, 0xb8, 0x8d, 0x42, 0x06, 0x62, 0xc0, 0xb8, 0x99,
+    0x07, 0xc0, 0xb8, 0xa5, 0xc7, 0xc9, 0x6c, 0x00, 0x3a, 0x51, 0xc5, 0x23,
+    0x26, 0x00, 0x3a, 0x49, 0xcc, 0x86, 0xf1, 0x00, 0x3a, 0x01, 0xc9, 0xa8,
+    0xaf, 0x00, 0x3a, 0x09, 0x16, 0xc0, 0xb8, 0xb1, 0x4d, 0x78, 0xb2, 0x40,
+    0xb8, 0xbd, 0x83, 0x05, 0x40, 0x01, 0x8b, 0x05, 0x40, 0x09, 0x97, 0x05,
+    0x40, 0x19, 0x87, 0x05, 0x40, 0x21, 0x91, 0x05, 0x40, 0x29, 0x0d, 0xc0,
+    0xb8, 0xc9, 0x09, 0xc0, 0xb8, 0xd3, 0x05, 0xc0, 0xb8, 0xdd, 0x16, 0xc0,
+    0xb8, 0xe7, 0x06, 0xc0, 0xb8, 0xf5, 0xc2, 0x01, 0x23, 0x05, 0x41, 0x11,
+    0x0c, 0xc0, 0xb9, 0x03, 0xc2, 0x00, 0x10, 0x05, 0x40, 0xc1, 0x12, 0xc0,
+    0xb9, 0x0d, 0x04, 0xc0, 0xb9, 0x17, 0xc2, 0x00, 0xa2, 0x05, 0x40, 0xe9,
+    0x14, 0xc0, 0xb9, 0x21, 0xc2, 0x01, 0xc8, 0x05, 0x40, 0xf9, 0xc2, 0x00,
+    0xfb, 0x05, 0x41, 0x08, 0xc8, 0xb9, 0xea, 0x05, 0x40, 0x11, 0xc7, 0x5a,
+    0xdb, 0x05, 0x40, 0x31, 0x03, 0x40, 0xb9, 0x2b, 0x83, 0x05, 0x41, 0x19,
+    0x8b, 0x05, 0x41, 0x21, 0x97, 0x05, 0x41, 0x29, 0x87, 0x05, 0x41, 0x31,
+    0xc2, 0x01, 0x24, 0x05, 0x41, 0x38, 0x9e, 0x05, 0x41, 0x41, 0x9f, 0x05,
+    0x41, 0x49, 0xa0, 0x05, 0x41, 0x51, 0xa1, 0x05, 0x41, 0x58, 0xca, 0x9d,
+    0x10, 0x0f, 0xa5, 0x61, 0xc5, 0xdb, 0x64, 0x0f, 0xb5, 0x20, 0xd6, 0x2f,
+    0xb4, 0x0f, 0xaf, 0x19, 0xc2, 0x00, 0x29, 0x0f, 0xa8, 0x43, 0x00, 0xb9,
+    0x37, 0xcf, 0x6b, 0x34, 0x0f, 0xb2, 0x50, 0x87, 0x01, 0x3a, 0x3b, 0x00,
+    0xb9, 0x3d, 0xc9, 0x78, 0x74, 0x0f, 0xa4, 0xb0, 0xc2, 0x02, 0xae, 0x01,
+    0x4d, 0x09, 0xc4, 0x00, 0x49, 0x01, 0x4d, 0x00, 0xcc, 0x8c, 0x55, 0x0f,
+    0xae, 0x99, 0xc8, 0xbb, 0xda, 0x0f, 0xae, 0x91, 0xc5, 0x08, 0x91, 0x0f,
+    0xa0, 0xd0, 0xc4, 0xe4, 0x43, 0x0f, 0xab, 0xc0, 0x90, 0x0f, 0xca, 0x21,
+    0xcb, 0x8c, 0xea, 0x0f, 0xcf, 0xa8, 0x43, 0x00, 0x3d, 0xc0, 0xb9, 0x41,
+    0x46, 0x07, 0x2f, 0x40, 0xb9, 0x62, 0xcc, 0x85, 0xf5, 0x01, 0x36, 0x29,
+    0xc9, 0xb2, 0xa2, 0x0f, 0x98, 0xf0, 0x52, 0x48, 0xe9, 0xc0, 0xb9, 0x9a,
+    0x47, 0x02, 0x0e, 0xc0, 0xb9, 0xc2, 0xc8, 0x7a, 0x7e, 0x00, 0xdd, 0xd1,
+    0x46, 0x09, 0x97, 0xc0, 0xba, 0x4c, 0x51, 0x4f, 0x25, 0xc0, 0xba, 0x70,
+    0x45, 0x00, 0xba, 0xc0, 0xba, 0x82, 0x4d, 0x80, 0x50, 0x40, 0xba, 0x8e,
+    0xcf, 0x69, 0xae, 0x0f, 0x98, 0x20, 0xd5, 0x37, 0x43, 0x01, 0x17, 0x49,
+    0xce, 0x74, 0x32, 0x01, 0x15, 0x89, 0x46, 0x23, 0xa0, 0xc0, 0xba, 0x98,
+    0x46, 0x00, 0xd4, 0x40, 0xba, 0xa4, 0xc2, 0x00, 0x55, 0x01, 0x14, 0x13,
+    0x00, 0xba, 0xbc, 0x46, 0x00, 0xd4, 0xc0, 0xba, 0xc0, 0x45, 0x00, 0x8c,
+    0x40, 0xba, 0xcc, 0xd1, 0x1a, 0x4a, 0x01, 0x04, 0x71, 0xd0, 0x1d, 0xec,
+    0x01, 0x04, 0x69, 0x07, 0xc0, 0xba, 0xde, 0xc5, 0x1d, 0x1d, 0x01, 0x04,
+    0x59, 0xc9, 0x60, 0xf3, 0x01, 0x04, 0x51, 0xc4, 0x26, 0x78, 0x01, 0x04,
+    0x49, 0x15, 0xc0, 0xba, 0xea, 0x08, 0xc0, 0xba, 0xf6, 0x16, 0xc0, 0xbb,
+    0x02, 0xc3, 0x05, 0x14, 0x01, 0x04, 0x09, 0xc4, 0x15, 0xe7, 0x01, 0x04,
+    0x00, 0x87, 0x01, 0x19, 0x19, 0x44, 0x00, 0x74, 0x40, 0xbb, 0x0e, 0x00,
+    0xc0, 0xbb, 0x1a, 0xc7, 0xc1, 0xfc, 0x01, 0x55, 0x52, 0x00, 0xbb, 0x7c,
+    0x46, 0xcf, 0xe3, 0xc0, 0xbb, 0x82, 0xca, 0xa4, 0x40, 0x00, 0x04, 0xf0,
+    0x16, 0xc0, 0xbb, 0x8a, 0xc2, 0x00, 0x89, 0x0f, 0xc9, 0xa2, 0x00, 0xbb,
+    0x99, 0xc6, 0x1d, 0xb4, 0x01, 0x11, 0xbb, 0x00, 0xbb, 0x9f, 0xc9, 0xb3,
+    0xdd, 0x01, 0x0a, 0x50, 0x00, 0x40, 0xbb, 0xa5, 0xcd, 0x7a, 0xc7, 0x01,
+    0x08, 0xf1, 0x5b, 0x17, 0x2b, 0x40, 0xbb, 0xbd, 0xc5, 0x29, 0xfc, 0x0f,
+    0xc9, 0x81, 0xc3, 0x12, 0xb8, 0x0f, 0xd6, 0x19, 0xc6, 0x18, 0x8e, 0x0f,
+    0xd6, 0x20, 0xc3, 0x01, 0x4b, 0x0f, 0xd5, 0x39, 0x45, 0x3c, 0x54, 0x40,
+    0xbb, 0xf5, 0xcc, 0x8b, 0xdd, 0x01, 0x08, 0x78, 0x49, 0xb0, 0x08, 0xc0,
+    0xbc, 0x01, 0xcc, 0x87, 0xd5, 0x0f, 0xb6, 0xe8, 0x46, 0x17, 0x33, 0x40,
+    0xbc, 0x3f, 0xc5, 0x00, 0xb9, 0x00, 0x01, 0x5b, 0x00, 0xbc, 0x47, 0xcb,
+    0x8d, 0xb0, 0x00, 0x05, 0x88, 0xc8, 0x2a, 0x06, 0x0f, 0xc8, 0x79, 0xca,
+    0xa1, 0xca, 0x0f, 0xc8, 0x60, 0xcb, 0x95, 0xcf, 0x0f, 0x9c, 0x69, 0xc5,
+    0xd7, 0x1d, 0x0f, 0x9a, 0x68, 0xc4, 0x12, 0x50, 0x0f, 0xa1, 0xe9, 0xc4,
+    0x00, 0x87, 0x0f, 0xa1, 0xb8, 0xd0, 0x58, 0x52, 0x01, 0x1c, 0x91, 0xd2,
+    0x49, 0x67, 0x01, 0x1c, 0x88, 0xc8, 0x19, 0x58, 0x01, 0x5f, 0xe9, 0xc9,
+    0xa8, 0x5e, 0x0f, 0xb7, 0x98, 0x94, 0x0f, 0xa6, 0xf9, 0x00, 0xc0, 0xbc,
+    0x4b, 0x95, 0x0f, 0xae, 0x80, 0x43, 0x02, 0x18, 0xc0, 0xbc, 0x57, 0xc8,
+    0xbd, 0x5a, 0x0f, 0x9c, 0x49, 0xd1, 0x4f, 0xf1, 0x01, 0x81, 0xe9, 0xcc,
+    0x84, 0x45, 0x01, 0x92, 0x80, 0x46, 0x0b, 0x11, 0xc0, 0xbc, 0x61, 0x47,
+    0x34, 0x2f, 0xc0, 0xbc, 0x6d, 0x46, 0x09, 0x97, 0xc0, 0xbc, 0x83, 0x47,
+    0xc3, 0x3e, 0xc0, 0xbc, 0xa1, 0x52, 0x4b, 0xef, 0xc0, 0xbc, 0xe7, 0x4a,
+    0x9f, 0x86, 0x40, 0xbc, 0xf3, 0x45, 0x6b, 0x87, 0xc0, 0xbd, 0x31, 0x45,
+    0x00, 0xb4, 0xc0, 0xbd, 0x3d, 0xc5, 0xdc, 0x0e, 0x0f, 0xd4, 0x10, 0x00,
+    0x40, 0xbd, 0x4f, 0xcf, 0x63, 0x1e, 0x08, 0xd7, 0xa3, 0x00, 0xbd, 0x5b,
+    0x46, 0x02, 0x0f, 0x40, 0xbd, 0x5f, 0x00, 0x40, 0xbd, 0xcd, 0xc4, 0x28,
+    0xb1, 0x08, 0xd7, 0x63, 0x00, 0xbd, 0xd9, 0xcc, 0x23, 0x33, 0x08, 0xd7,
+    0x3a, 0x00, 0xbd, 0xdd, 0x00, 0x40, 0xbd, 0xe3, 0x00, 0xc0, 0xbd, 0xf2,
+    0x46, 0xd0, 0x4f, 0xc0, 0xbe, 0x0a, 0xcd, 0x79, 0x34, 0x0f, 0xc9, 0x90,
+    0x49, 0xab, 0x91, 0xc0, 0xbe, 0x1c, 0x49, 0x2b, 0xed, 0x40, 0xbe, 0x4e,
+    0x44, 0xaa, 0x7f, 0xc0, 0xbe, 0x90, 0x0f, 0xc0, 0xbe, 0xaa, 0xc3, 0x07,
+    0xa2, 0x0b, 0x5b, 0x81, 0x16, 0xc0, 0xbe, 0xb6, 0xc2, 0x04, 0xad, 0x0b,
+    0x5b, 0x61, 0x10, 0xc0, 0xbe, 0xc8, 0x1a, 0xc0, 0xbe, 0xd4, 0x0a, 0xc0,
+    0xbe, 0xe4, 0xc8, 0xbe, 0xd2, 0x0b, 0x5b, 0x39, 0x44, 0xde, 0xeb, 0xc0,
+    0xbe, 0xf0, 0xc6, 0xce, 0xe1, 0x0b, 0x5a, 0x18, 0x16, 0xc0, 0xbf, 0x0c,
+    0x47, 0x0d, 0x04, 0xc0, 0xbf, 0x18, 0xc8, 0x33, 0xee, 0x0b, 0x5a, 0xf0,
+    0xc4, 0x26, 0x78, 0x0b, 0x5a, 0xc9, 0xc5, 0x06, 0xdb, 0x0b, 0x5a, 0xc1,
+    0x15, 0xc0, 0xbf, 0x22, 0x08, 0xc0, 0xbf, 0x2e, 0x16, 0xc0, 0xbf, 0x3a,
+    0xc3, 0x05, 0x14, 0x0b, 0x5a, 0x89, 0xc4, 0x15, 0xe7, 0x0b, 0x5a, 0x80,
+    0x16, 0xc0, 0xbf, 0x46, 0xc3, 0xdf, 0xff, 0x0b, 0x59, 0xa9, 0x15, 0xc0,
+    0xbf, 0x52, 0x0d, 0x40, 0xbf, 0x5c, 0x03, 0xc0, 0xbf, 0x68, 0x19, 0xc0,
+    0xbf, 0x80, 0x0b, 0xc0, 0xbf, 0x88, 0x11, 0xc0, 0xbf, 0x94, 0x17, 0xc0,
+    0xbf, 0xa0, 0x07, 0x40, 0xbf, 0xac, 0xd0, 0x3a, 0x4c, 0x0f, 0xb5, 0x81,
+    0xc2, 0x00, 0xf1, 0x0f, 0xca, 0xa0, 0xc8, 0x1d, 0x3c, 0x0f, 0xb1, 0xf1,
+    0xc4, 0x00, 0x87, 0x0f, 0xb1, 0x08, 0xcb, 0x8d, 0xd1, 0x01, 0x1f, 0xf1,
+    0xc5, 0x00, 0x92, 0x01, 0x1f, 0xd8, 0xc7, 0x00, 0x90, 0x01, 0x1f, 0xe9,
+    0xcb, 0x8d, 0x6e, 0x01, 0x1f, 0xe0, 0x43, 0x00, 0xe5, 0xc0, 0xbf, 0xb8,
+    0xc3, 0x32, 0x36, 0x0f, 0xa7, 0x70, 0xc7, 0x00, 0xfa, 0x01, 0x03, 0x49,
+    0xca, 0xa1, 0x5c, 0x01, 0x01, 0x60, 0xd1, 0x54, 0xfd, 0x0f, 0xb5, 0x40,
+    0xc7, 0x00, 0x8b, 0x01, 0x57, 0x08, 0x42, 0x00, 0x45, 0xc0, 0xbf, 0xc7,
+    0xc7, 0xc7, 0x51, 0x01, 0x18, 0x31, 0xcc, 0x8b, 0x1d, 0x0f, 0xb1, 0x18,
+    0xc4, 0x00, 0xba, 0x01, 0x0a, 0x61, 0xd1, 0x57, 0x1d, 0x01, 0x01, 0x89,
+    0xca, 0xa8, 0x00, 0x01, 0x01, 0x80, 0xc8, 0x12, 0x85, 0x01, 0x31, 0x71,
+    0x8a, 0x0f, 0x9a, 0x89, 0xc3, 0x04, 0x20, 0x0f, 0xcc, 0xd0, 0xc4, 0x02,
+    0xde, 0x08, 0x5d, 0x59, 0x19, 0xc0, 0xbf, 0xd1, 0xc2, 0x00, 0xc4, 0x08,
+    0x5d, 0x68, 0xc8, 0x0d, 0x03, 0x08, 0x5d, 0x78, 0xc3, 0x11, 0xef, 0x08,
+    0x5c, 0x81, 0x03, 0x40, 0xbf, 0xdb, 0xc2, 0x00, 0x8e, 0x08, 0x5c, 0x38,
+    0xce, 0x73, 0x1a, 0x08, 0x48, 0xf9, 0x47, 0x34, 0x2f, 0xc0, 0xbf, 0xe7,
+    0x47, 0x02, 0x0e, 0x40, 0xbf, 0xf4, 0x47, 0x02, 0x0e, 0xc0, 0xc0, 0x57,
+    0x15, 0xc0, 0xc0, 0xdd, 0xd0, 0x59, 0x22, 0x05, 0x43, 0xa9, 0x45, 0x01,
+    0xc3, 0x40, 0xc0, 0xe7, 0x12, 0xc0, 0xc0, 0xf3, 0x16, 0xc0, 0xc1, 0x03,
+    0x05, 0xc0, 0xc1, 0x15, 0x19, 0xc0, 0xc1, 0x29, 0x0a, 0xc0, 0xc1, 0x35,
+    0x04, 0xc0, 0xc1, 0x47, 0x15, 0xc0, 0xc1, 0x5a, 0x42, 0x01, 0xc3, 0xc0,
+    0xc1, 0x78, 0x42, 0x01, 0x0f, 0xc0, 0xc1, 0x84, 0x42, 0x00, 0x58, 0xc0,
+    0xc1, 0x8e, 0x14, 0xc0, 0xc1, 0x9a, 0xc5, 0xdb, 0xd2, 0x08, 0x0f, 0x71,
+    0xc4, 0xb4, 0x91, 0x08, 0x0f, 0x99, 0xc7, 0xc9, 0xa4, 0x08, 0x0f, 0xb9,
+    0x09, 0xc0, 0xc1, 0xa6, 0xc5, 0x01, 0xa2, 0x08, 0x0e, 0xc9, 0xc5, 0xd3,
+    0xe4, 0x08, 0x0f, 0xc0, 0xc6, 0x5b, 0x02, 0x00, 0x04, 0x81, 0xc4, 0x09,
+    0x9d, 0x00, 0x00, 0xa1, 0x16, 0xc0, 0xc1, 0xb2, 0xc3, 0x05, 0x14, 0x00,
+    0x00, 0x88, 0x03, 0xc0, 0xc1, 0xbe, 0x09, 0xc0, 0xc1, 0xca, 0x15, 0xc0,
+    0xc1, 0xd6, 0xc2, 0x00, 0x7a, 0x00, 0x4a, 0x81, 0x4b, 0x6f, 0xc7, 0xc0,
+    0xc1, 0xe2, 0x47, 0x02, 0x0e, 0xc0, 0xc2, 0x17, 0xc7, 0xc7, 0xac, 0x05,
+    0x47, 0xe9, 0xca, 0x9d, 0x56, 0x05, 0x47, 0xd9, 0xc5, 0x95, 0xf0, 0x05,
+    0x47, 0xd1, 0x06, 0x40, 0xc2, 0x8c, 0xc6, 0xd2, 0x77, 0x0f, 0xae, 0xa1,
+    0xc8, 0x3f, 0xff, 0x0f, 0xad, 0x28, 0x96, 0x0f, 0x9e, 0xe3, 0x00, 0xc2,
+    0x9e, 0x43, 0x00, 0x3d, 0x40, 0xc2, 0xa4, 0x44, 0x05, 0xaa, 0xc0, 0xc2,
+    0xb0, 0xca, 0xa6, 0xac, 0x0f, 0x99, 0x98, 0x44, 0x02, 0x9b, 0xc0, 0xc2,
+    0xbc, 0x45, 0x00, 0x8c, 0x40, 0xc2, 0xce, 0x46, 0x00, 0x8b, 0x40, 0xc2,
+    0xda, 0x46, 0x00, 0x8b, 0x40, 0xc2, 0xec, 0xc5, 0x61, 0xc0, 0x0e, 0x98,
+    0x2b, 0x00, 0xc2, 0xfe, 0x0a, 0xc0, 0xc3, 0x04, 0x49, 0xb1, 0xaf, 0xc0,
+    0xc3, 0x10, 0x48, 0xbc, 0x1a, 0x40, 0xc3, 0x1c, 0xc4, 0x26, 0x78, 0x00,
+    0x01, 0xcb, 0x00, 0xc3, 0x28, 0xc5, 0x06, 0xdb, 0x00, 0x01, 0xc3, 0x00,
+    0xc3, 0x2c, 0x15, 0xc0, 0xc3, 0x30, 0x08, 0xc0, 0xc3, 0x42, 0x16, 0xc0,
+    0xc3, 0x54, 0xc3, 0x05, 0x14, 0x00, 0x01, 0x8b, 0x00, 0xc3, 0x66, 0xc4,
+    0x15, 0xe7, 0x00, 0x01, 0x82, 0x00, 0xc3, 0x6a, 0x06, 0xc0, 0xc3, 0x6e,
+    0xd0, 0x5c, 0xe2, 0x08, 0xca, 0x31, 0xca, 0x93, 0x30, 0x08, 0xca, 0x29,
+    0x45, 0x00, 0xba, 0xc0, 0xc3, 0x7a, 0x47, 0x30, 0x9f, 0xc0, 0xc3, 0x92,
+    0xca, 0xa0, 0x3a, 0x08, 0xca, 0x09, 0xd3, 0x44, 0xee, 0x08, 0xc9, 0xf9,
+    0x18, 0xc0, 0xc3, 0x9e, 0x47, 0x02, 0x0e, 0x40, 0xc3, 0xaa, 0x45, 0x29,
+    0x90, 0xc0, 0xc4, 0x17, 0xc3, 0x23, 0x1b, 0x01, 0x11, 0x19, 0xc7, 0xc3,
+    0xfb, 0x0f, 0xc9, 0xf8, 0x4b, 0x43, 0x54, 0xc0, 0xc4, 0x21, 0xca, 0xa3,
+    0x64, 0x01, 0x3b, 0xf9, 0x46, 0x09, 0x97, 0x40, 0xc4, 0x2d, 0xca, 0xa3,
+    0x64, 0x01, 0x3c, 0x49, 0x46, 0x09, 0x97, 0x40, 0xc4, 0x4b, 0xc8, 0xbf,
+    0x32, 0x01, 0x36, 0x69, 0x49, 0xae, 0x85, 0x40, 0xc4, 0x6f, 0xa3, 0x01,
+    0x34, 0x29, 0xa2, 0x01, 0x34, 0x21, 0xa1, 0x01, 0x34, 0x19, 0xa0, 0x01,
+    0x34, 0x11, 0x9f, 0x01, 0x34, 0x09, 0x9e, 0x01, 0x34, 0x00, 0xc9, 0xb4,
+    0x52, 0x01, 0x18, 0x01, 0x44, 0x4a, 0x60, 0x40, 0xc4, 0x7b, 0xc9, 0xab,
+    0x9a, 0x0f, 0xd3, 0xc1, 0xc3, 0x02, 0x0e, 0x0f, 0xa5, 0x38, 0xc5, 0x11,
+    0x55, 0x0f, 0xa1, 0x90, 0x48, 0xbf, 0xb2, 0xc0, 0xc4, 0x93, 0x42, 0x00,
+    0x97, 0x40, 0xc4, 0xa5, 0xc9, 0x03, 0xde, 0x01, 0x18, 0x21, 0xd7, 0x27,
+    0xfe, 0x01, 0x17, 0x89, 0xc4, 0x32, 0xbc, 0x01, 0x15, 0x23, 0x00, 0xc4,
+    0xec, 0xc9, 0xb2, 0xea, 0x01, 0x4b, 0xf8, 0xd2, 0x4e, 0x2f, 0x0f, 0xa9,
+    0xe9, 0xcc, 0x4e, 0x35, 0x0f, 0xa9, 0xd9, 0x4e, 0x6c, 0xfa, 0x40, 0xc4,
+    0xf2, 0x42, 0x3c, 0xd3, 0xc0, 0xc4, 0xfe, 0xc5, 0x02, 0xfd, 0x0f, 0x81,
+    0x80, 0xc5, 0x02, 0xfd, 0x0f, 0x83, 0x11, 0x42, 0x3c, 0xd3, 0x40, 0xc5,
+    0x28, 0x00, 0xc0, 0xc5, 0x52, 0x42, 0x00, 0xa9, 0xc0, 0xc5, 0xa4, 0x02,
+    0x40, 0xc5, 0xb6, 0x05, 0xc0, 0xc5, 0xc8, 0xc5, 0x8a, 0x10, 0x01, 0x4c,
+    0xc9, 0x15, 0xc0, 0xc5, 0xd4, 0xc9, 0xad, 0xd1, 0x0f, 0xd7, 0x29, 0xd4,
+    0x3a, 0xe8, 0x01, 0x70, 0x41, 0xc6, 0xcc, 0x71, 0x01, 0x70, 0x99, 0xd4,
+    0x3d, 0x90, 0x01, 0x70, 0xb0, 0xc8, 0x18, 0x67, 0x01, 0x16, 0x29, 0xc5,
+    0x1d, 0x1d, 0x01, 0x11, 0xc1, 0xc4, 0x25, 0xd5, 0x01, 0x10, 0xa1, 0xc5,
+    0x00, 0xd4, 0x00, 0x16, 0xc8, 0xd1, 0x50, 0xce, 0x08, 0xc1, 0xd9, 0x45,
+    0x00, 0xba, 0xc0, 0xc5, 0xe0, 0x4b, 0x6f, 0xc7, 0xc0, 0xc5, 0xf2, 0x47,
+    0x02, 0x0e, 0x40, 0xc6, 0x15, 0xcf, 0x4c, 0x01, 0x01, 0x17, 0x5b, 0x00,
+    0xc6, 0x7c, 0xc6, 0x00, 0x4e, 0x01, 0x10, 0x60, 0xc9, 0x23, 0x9f, 0x01,
+    0x17, 0x08, 0xc5, 0x2d, 0x7a, 0x01, 0x14, 0x03, 0x00, 0xc6, 0x82, 0xc3,
+    0x00, 0x9a, 0x01, 0x15, 0x60, 0xdd, 0x11, 0x6e, 0x01, 0x57, 0x70, 0xc7,
+    0x87, 0xc2, 0x0f, 0xad, 0xd9, 0xc4, 0x27, 0xe3, 0x0f, 0xad, 0xca, 0x00,
+    0xc6, 0x88, 0x0e, 0xc0, 0xc6, 0x8e, 0x45, 0x08, 0xcb, 0xc0, 0xc6, 0x9a,
+    0x49, 0xb2, 0xab, 0xc0, 0xc6, 0xcb, 0x44, 0xaf, 0x82, 0xc0, 0xc6, 0xe9,
+    0xd7, 0x27, 0x8b, 0x0d, 0xe3, 0x90, 0x99, 0x0d, 0xe1, 0xc3, 0x00, 0xc6,
+    0xf5, 0x96, 0x0d, 0xe0, 0x1b, 0x00, 0xc7, 0x14, 0x95, 0x0d, 0xe0, 0xe3,
+    0x00, 0xc7, 0x1c, 0x8c, 0x0d, 0xe0, 0xdb, 0x00, 0xc7, 0x2c, 0x90, 0x0d,
+    0xe0, 0xd3, 0x00, 0xc7, 0x30, 0x8f, 0x0d, 0xe0, 0xcb, 0x00, 0xc7, 0x3a,
+    0x94, 0x0d, 0xe0, 0x5b, 0x00, 0xc7, 0x3e, 0x8e, 0x0d, 0xe0, 0x33, 0x00,
+    0xc7, 0x4e, 0x8a, 0x0d, 0xe0, 0x03, 0x00, 0xc7, 0x58, 0x8d, 0x0d, 0xe0,
+    0x2b, 0x00, 0xc7, 0x5c, 0x86, 0x0d, 0xe0, 0x43, 0x00, 0xc7, 0x64, 0x88,
+    0x0d, 0xe0, 0x23, 0x00, 0xc7, 0x6e, 0x92, 0x0d, 0xe0, 0x13, 0x00, 0xc7,
+    0x74, 0x89, 0x0d, 0xe0, 0x53, 0x00, 0xc7, 0x80, 0x98, 0x0d, 0xe0, 0x4b,
+    0x00, 0xc7, 0x86, 0x84, 0x0d, 0xe0, 0x39, 0x9a, 0x0d, 0xe0, 0x0b, 0x00,
+    0xc7, 0x8c, 0x91, 0x0d, 0xe2, 0x23, 0x00, 0xc7, 0x90, 0x97, 0x0d, 0xe2,
+    0x8b, 0x00, 0xc7, 0xa2, 0x87, 0x0d, 0xe2, 0x3b, 0x00, 0xc7, 0xb0, 0xc2,
+    0x0c, 0x43, 0x0d, 0xe2, 0x81, 0x8b, 0x0d, 0xe2, 0x33, 0x00, 0xc7, 0xb8,
+    0x83, 0x0d, 0xe2, 0x0a, 0x00, 0xc7, 0xbc, 0xe0, 0x03, 0xa7, 0x01, 0x3c,
+    0xf9, 0xc8, 0x7d, 0xa4, 0x07, 0xf2, 0x49, 0xc8, 0x80, 0x2e, 0x07, 0xf2,
+    0x68, 0xc6, 0x00, 0x91, 0x0f, 0xa5, 0x41, 0xd0, 0x5e, 0xd2, 0x01, 0x72,
+    0x18, 0xc5, 0xa0, 0xc1, 0x0f, 0xaf, 0x09, 0x45, 0x00, 0x8c, 0x40, 0xc7,
+    0xc2, 0x00, 0xc0, 0xc7, 0xce, 0x42, 0x00, 0xa9, 0x40, 0xc7, 0xef, 0x51,
+    0x53, 0xed, 0xc0, 0xc8, 0x38, 0xc3, 0x4e, 0x13, 0x0f, 0xb5, 0xd8, 0xcf,
+    0x25, 0xc4, 0x01, 0x33, 0xe1, 0x4f, 0x68, 0x28, 0x40, 0xc8, 0x40, 0x9c,
+    0x0f, 0x8f, 0xf9, 0x9b, 0x0f, 0x8f, 0xf1, 0x9a, 0x0f, 0x8f, 0xe9, 0x99,
+    0x0f, 0x8f, 0xe1, 0x98, 0x0f, 0x8f, 0xd9, 0x97, 0x0f, 0x8f, 0xd1, 0x96,
+    0x0f, 0x8f, 0xc9, 0x95, 0x0f, 0x8f, 0xc1, 0x94, 0x0f, 0x8f, 0xb9, 0x93,
+    0x0f, 0x8f, 0xb1, 0x92, 0x0f, 0x8f, 0xa9, 0x91, 0x0f, 0x8f, 0xa1, 0x90,
+    0x0f, 0x8f, 0x99, 0x8f, 0x0f, 0x8f, 0x91, 0x8e, 0x0f, 0x8f, 0x89, 0x8d,
+    0x0f, 0x8f, 0x81, 0x8c, 0x0f, 0x8f, 0x79, 0x8b, 0x0f, 0x8f, 0x71, 0x8a,
+    0x0f, 0x8f, 0x69, 0x89, 0x0f, 0x8f, 0x61, 0x88, 0x0f, 0x8f, 0x59, 0x87,
+    0x0f, 0x8f, 0x51, 0x86, 0x0f, 0x8f, 0x49, 0x85, 0x0f, 0x8f, 0x41, 0x84,
+    0x0f, 0x8f, 0x39, 0x83, 0x0f, 0x8f, 0x30, 0xc5, 0x1e, 0x96, 0x05, 0x4a,
+    0x99, 0x4a, 0x6f, 0xc8, 0x40, 0xc8, 0x4c, 0x8a, 0x05, 0x4a, 0x91, 0x94,
+    0x05, 0x4a, 0x89, 0x90, 0x05, 0x4a, 0x82, 0x00, 0xc8, 0x63, 0x83, 0x05,
+    0x4a, 0x31, 0x10, 0xc0, 0xc8, 0x67, 0x0f, 0xc0, 0xc8, 0x79, 0xc2, 0x00,
+    0xd0, 0x05, 0x4a, 0x09, 0xc2, 0x01, 0x4a, 0x05, 0x4a, 0x01, 0xc2, 0x19,
+    0x2c, 0x05, 0x49, 0xf9, 0xc2, 0x00, 0xdb, 0x05, 0x49, 0xf1, 0xc2, 0x00,
+    0x39, 0x05, 0x49, 0xe9, 0xc2, 0x0d, 0xf6, 0x05, 0x49, 0xe1, 0xc2, 0x25,
+    0x3b, 0x05, 0x49, 0xd1, 0xc2, 0x00, 0x64, 0x05, 0x49, 0xc9, 0xc2, 0x01,
+    0x5d, 0x05, 0x49, 0xb9, 0xc2, 0x00, 0xb0, 0x05, 0x49, 0xb1, 0xc2, 0x0e,
+    0x9a, 0x05, 0x49, 0xa1, 0xc2, 0x01, 0x6f, 0x05, 0x49, 0x99, 0xc2, 0x01,
+    0x30, 0x05, 0x49, 0x89, 0xc2, 0x02, 0x2b, 0x05, 0x49, 0x80, 0x15, 0xc0,
+    0xc8, 0x83, 0x03, 0xc0, 0xc8, 0xa6, 0x11, 0xc0, 0xc8, 0xae, 0x42, 0x00,
+    0xd0, 0xc0, 0xc8, 0xc0, 0x4a, 0x07, 0xbb, 0xc0, 0xc8, 0xcc, 0x05, 0xc0,
+    0xc8, 0xd8, 0xcb, 0x1a, 0x50, 0x00, 0x01, 0x4b, 0x00, 0xc8, 0xed, 0x08,
+    0xc0, 0xc8, 0xf1, 0xe0, 0x05, 0xa7, 0x01, 0x16, 0x51, 0x16, 0xc0, 0xc8,
+    0xfb, 0x42, 0x00, 0x58, 0xc0, 0xc9, 0x0f, 0x19, 0xc0, 0xc9, 0x1b, 0x46,
+    0x04, 0x8f, 0xc0, 0xc9, 0x27, 0xd7, 0x29, 0x85, 0x01, 0x70, 0x69, 0xd6,
+    0x2c, 0xf4, 0x01, 0x70, 0xe8, 0x19, 0xc0, 0xc9, 0x33, 0x16, 0xc0, 0xc9,
+    0x42, 0x15, 0xc0, 0xc9, 0x54, 0x0a, 0xc0, 0xc9, 0x60, 0xd0, 0x58, 0x62,
+    0x0f, 0xc1, 0xf1, 0xc5, 0x01, 0xa2, 0x01, 0x0c, 0x93, 0x00, 0xc9, 0x6a,
+    0xd1, 0x55, 0x30, 0x01, 0x0f, 0xf1, 0x06, 0xc0, 0xc9, 0x74, 0xcd, 0x7c,
+    0xa8, 0x01, 0x0e, 0x49, 0x14, 0xc0, 0xc9, 0x80, 0xcf, 0x61, 0x4d, 0x01,
+    0x5a, 0x31, 0x04, 0xc0, 0xc9, 0x8c, 0x08, 0xc0, 0xc9, 0x9e, 0xd7, 0x26,
+    0xbc, 0x0f, 0xc5, 0x38, 0x49, 0x01, 0xaa, 0xc0, 0xc9, 0xaa, 0x15, 0xc0,
+    0xc9, 0xc2, 0xdb, 0x16, 0x1d, 0x01, 0x37, 0x29, 0x48, 0xbc, 0xba, 0xc0,
+    0xc9, 0xce, 0x47, 0x55, 0x85, 0x40, 0xc9, 0xe6, 0xc8, 0x07, 0x5f, 0x01,
+    0x12, 0xb9, 0xcb, 0x90, 0x9c, 0x01, 0x12, 0xb1, 0xc8, 0x18, 0x67, 0x01,
+    0x10, 0xc1, 0xc5, 0x00, 0xd4, 0x00, 0x16, 0xd1, 0xc4, 0xe3, 0x07, 0x0f,
+    0xb6, 0xf9, 0xc5, 0x01, 0xaa, 0x01, 0x71, 0x80, 0x45, 0x11, 0x17, 0xc0,
+    0xc9, 0xfb, 0x43, 0x11, 0x49, 0xc0, 0xca, 0x07, 0x45, 0x00, 0x49, 0xc0,
+    0xca, 0x13, 0x46, 0x00, 0x2c, 0x40, 0xca, 0x1f, 0xce, 0x6b, 0xb8, 0x0f,
+    0xae, 0xf1, 0x42, 0x00, 0x2a, 0x40, 0xca, 0x2b, 0xc6, 0xcf, 0xad, 0x0f,
+    0xbc, 0x59, 0xc7, 0xc1, 0x00, 0x0f, 0xa6, 0x68, 0xc3, 0xe5, 0x99, 0x0f,
+    0x93, 0x29, 0x42, 0x01, 0xe2, 0xc0, 0xca, 0x37, 0xc2, 0x07, 0x49, 0x0f,
+    0x93, 0x19, 0xc2, 0x10, 0x37, 0x0f, 0x93, 0x09, 0xc2, 0x11, 0xf6, 0x0f,
+    0x93, 0x00, 0xc3, 0x05, 0x14, 0x01, 0x0b, 0x03, 0x00, 0xca, 0x43, 0x08,
+    0xc0, 0xca, 0x47, 0x15, 0xc0, 0xca, 0x51, 0xd4, 0x3f, 0x20, 0x01, 0x0c,
+    0x19, 0x16, 0xc0, 0xca, 0x60, 0x07, 0xc0, 0xca, 0x73, 0xc4, 0x26, 0x78,
+    0x01, 0x0b, 0x40, 0x07, 0xc0, 0xca, 0x7f, 0xcb, 0x92, 0xc2, 0x08, 0x0c,
+    0xa8, 0xd3, 0x45, 0xe5, 0x08, 0x0c, 0xa1, 0xcc, 0x83, 0xfd, 0x08, 0x0c,
+    0xb1, 0xcd, 0x76, 0xaa, 0x08, 0x0c, 0xc8, 0xc3, 0x63, 0x7e, 0x0f, 0xb4,
+    0x19, 0xc5, 0xd8, 0x49, 0x0f, 0xb7, 0x20, 0xc4, 0x07, 0x73, 0x01, 0x38,
+    0x5b, 0x00, 0xca, 0x91, 0xc4, 0xb9, 0x3c, 0x01, 0x38, 0x51, 0x0f, 0xc0,
+    0xca, 0x97, 0xcc, 0x88, 0xf5, 0x0f, 0xc8, 0xd1, 0xd4, 0x21, 0x3f, 0x01,
+    0x70, 0x31, 0xc3, 0x02, 0xa3, 0x01, 0x71, 0x9b, 0x00, 0xca, 0xa9, 0xc6,
+    0x0b, 0x09, 0x01, 0x70, 0x59, 0xc5, 0x0a, 0x8a, 0x01, 0x71, 0xa0, 0xc3,
+    0x80, 0x5d, 0x0f, 0x98, 0x40, 0xcb, 0x8f, 0x31, 0x01, 0x31, 0x11, 0xc7,
+    0xc4, 0x95, 0x0f, 0xa8, 0xc0, 0xc3, 0x63, 0x7e, 0x0f, 0x9e, 0x71, 0xca,
+    0xa5, 0xa8, 0x0f, 0x9e, 0x68, 0xca, 0x9d, 0x2e, 0x08, 0x73, 0xf1, 0x44,
+    0x05, 0x14, 0x40, 0xca, 0xaf, 0x44, 0x26, 0x78, 0xc0, 0xca, 0xc1, 0x45,
+    0x06, 0xdb, 0xc0, 0xca, 0xcd, 0x15, 0xc0, 0xca, 0xd7, 0x08, 0xc0, 0xca,
+    0xe3, 0x16, 0xc0, 0xca, 0xeb, 0xcb, 0x0d, 0x00, 0x08, 0x73, 0x90, 0xc4,
+    0x26, 0x78, 0x08, 0x73, 0x41, 0xc5, 0x06, 0xdb, 0x08, 0x73, 0x39, 0x15,
+    0xc0, 0xca, 0xf9, 0x08, 0xc0, 0xcb, 0x05, 0x16, 0xc0, 0xcb, 0x11, 0xc3,
+    0x05, 0x14, 0x08, 0x73, 0x00, 0x47, 0x02, 0x0e, 0xc0, 0xcb, 0x1d, 0xcf,
+    0x62, 0x4c, 0x00, 0xb7, 0x81, 0xcf, 0x66, 0x1b, 0x00, 0xb7, 0x79, 0xcd,
+    0x78, 0x16, 0x00, 0xb7, 0x71, 0xd1, 0x57, 0x61, 0x00, 0xb7, 0x69, 0xd4,
+    0x3b, 0xec, 0x00, 0xb7, 0x61, 0xd2, 0x4c, 0xa3, 0x00, 0xb7, 0x58, 0xc2,
+    0x00, 0x29, 0x0f, 0x9e, 0x19, 0xd3, 0x46, 0xc9, 0x0f, 0x9d, 0xe8, 0xa2,
+    0x07, 0xf0, 0x73, 0x00, 0xcb, 0xad, 0x9e, 0x07, 0xf0, 0x53, 0x00, 0xcb,
+    0xd5, 0x9d, 0x07, 0xf0, 0x4b, 0x00, 0xcb, 0xfd, 0xa6, 0x70, 0x08, 0x13,
+    0x00, 0xcc, 0x25, 0xa5, 0x70, 0x08, 0x0b, 0x00, 0xcc, 0x4d, 0xa4, 0x70,
+    0x08, 0x03, 0x00, 0xcc, 0x75, 0xa3, 0x07, 0xf0, 0x7b, 0x00, 0xcc, 0x9d,
+    0xa1, 0x07, 0xf0, 0x6b, 0x00, 0xcc, 0xc5, 0xa0, 0x07, 0xf0, 0x63, 0x00,
+    0xcc, 0xed, 0x9f, 0x07, 0xf0, 0x5a, 0x00, 0xcd, 0x15, 0xa2, 0x70, 0x08,
+    0x43, 0x00, 0xcd, 0x3d, 0xa1, 0x70, 0x08, 0x3b, 0x00, 0xcd, 0x59, 0xa0,
+    0x70, 0x08, 0x33, 0x00, 0xcd, 0x81, 0x9f, 0x70, 0x08, 0x2b, 0x00, 0xcd,
+    0xa9, 0x9e, 0x70, 0x08, 0x23, 0x00, 0xcd, 0xd1, 0x9d, 0x70, 0x08, 0x1b,
+    0x00, 0xcd, 0xf9, 0xa6, 0x70, 0x08, 0x61, 0xa5, 0x70, 0x08, 0x59, 0xa4,
+    0x70, 0x08, 0x51, 0xa3, 0x70, 0x08, 0x48, 0xa6, 0x70, 0x0a, 0x91, 0xa5,
+    0x70, 0x0a, 0x89, 0xa4, 0x70, 0x0a, 0x81, 0xa3, 0x70, 0x0a, 0x79, 0xa2,
+    0x70, 0x0a, 0x71, 0xa1, 0x70, 0x0a, 0x69, 0xa0, 0x70, 0x0a, 0x61, 0x9f,
+    0x70, 0x0a, 0x59, 0x9e, 0x70, 0x0a, 0x51, 0x9d, 0x70, 0x0a, 0x48, 0xa6,
+    0x70, 0x0a, 0x41, 0xa5, 0x70, 0x0a, 0x39, 0xa4, 0x70, 0x0a, 0x31, 0xa3,
+    0x70, 0x0a, 0x29, 0xa2, 0x70, 0x0a, 0x21, 0xa1, 0x70, 0x0a, 0x19, 0xa0,
+    0x70, 0x0a, 0x11, 0x9f, 0x70, 0x0a, 0x09, 0x9e, 0x70, 0x0a, 0x01, 0x9d,
+    0x70, 0x09, 0xf8, 0xa6, 0x70, 0x09, 0xf1, 0xa5, 0x70, 0x09, 0xe9, 0xa4,
+    0x70, 0x09, 0xe1, 0xa3, 0x70, 0x09, 0xd9, 0xa2, 0x70, 0x09, 0xd1, 0xa1,
+    0x70, 0x09, 0xc9, 0xa0, 0x70, 0x09, 0xc1, 0x9f, 0x70, 0x09, 0xb9, 0x9e,
+    0x70, 0x09, 0xb1, 0x9d, 0x70, 0x09, 0xa8, 0xa6, 0x70, 0x09, 0xa1, 0xa5,
+    0x70, 0x09, 0x99, 0xa4, 0x70, 0x09, 0x91, 0xa3, 0x70, 0x09, 0x89, 0xa2,
+    0x70, 0x09, 0x81, 0xa1, 0x70, 0x09, 0x79, 0xa0, 0x70, 0x09, 0x71, 0x9f,
+    0x70, 0x09, 0x69, 0x9e, 0x70, 0x09, 0x61, 0x9d, 0x70, 0x09, 0x58, 0xa6,
+    0x70, 0x09, 0x51, 0xa5, 0x70, 0x09, 0x49, 0xa4, 0x70, 0x09, 0x41, 0xa3,
+    0x70, 0x09, 0x39, 0xa2, 0x70, 0x09, 0x31, 0xa1, 0x70, 0x09, 0x29, 0xa0,
+    0x70, 0x09, 0x21, 0x9f, 0x70, 0x09, 0x19, 0x9e, 0x70, 0x09, 0x11, 0x9d,
+    0x70, 0x09, 0x08, 0xa6, 0x70, 0x09, 0x01, 0xa5, 0x70, 0x08, 0xf9, 0xa4,
+    0x70, 0x08, 0xf1, 0xa3, 0x70, 0x08, 0xe9, 0xa2, 0x70, 0x08, 0xe1, 0xa1,
+    0x70, 0x08, 0xd9, 0xa0, 0x70, 0x08, 0xd1, 0x9f, 0x70, 0x08, 0xc9, 0x9e,
+    0x70, 0x08, 0xc1, 0x9d, 0x70, 0x08, 0xb8, 0xa6, 0x70, 0x08, 0xb1, 0xa5,
+    0x70, 0x08, 0xa9, 0xa4, 0x70, 0x08, 0xa1, 0xa3, 0x70, 0x08, 0x99, 0xa2,
+    0x70, 0x08, 0x91, 0xa1, 0x70, 0x08, 0x89, 0xa0, 0x70, 0x08, 0x81, 0x9f,
+    0x70, 0x08, 0x79, 0x9e, 0x70, 0x08, 0x71, 0x9d, 0x70, 0x08, 0x68, 0x47,
+    0x14, 0x8b, 0xc0, 0xce, 0x21, 0x45, 0x10, 0x7a, 0x40, 0xce, 0x90, 0xc4,
+    0x15, 0xe7, 0x05, 0x31, 0x01, 0xc3, 0x05, 0x14, 0x05, 0x31, 0x09, 0x16,
+    0xc0, 0xce, 0xb2, 0x08, 0xc0, 0xce, 0xbe, 0x15, 0xc0, 0xce, 0xca, 0xc5,
+    0x06, 0xdb, 0x05, 0x31, 0x41, 0xc4, 0x26, 0x78, 0x05, 0x31, 0x48, 0x51,
+    0x54, 0x86, 0xc0, 0xce, 0xd6, 0x44, 0x05, 0x8d, 0xc0, 0xce, 0xee, 0xd5,
+    0x37, 0x2e, 0x01, 0x35, 0x41, 0xc4, 0x02, 0x6d, 0x00, 0x03, 0xe3, 0x00,
+    0xcf, 0x06, 0xc8, 0x22, 0x83, 0x01, 0x17, 0x71, 0xc9, 0x3b, 0x79, 0x01,
+    0x02, 0xf1, 0x16, 0xc0, 0xcf, 0x0a, 0xcb, 0x93, 0xb4, 0x01, 0x4c, 0xd1,
+    0xc8, 0xb8, 0x92, 0x01, 0x71, 0xe9, 0x4c, 0x8a, 0xe1, 0xc0, 0xcf, 0x1c,
+    0xda, 0x1c, 0x86, 0x01, 0x81, 0xd8, 0x46, 0x11, 0x39, 0xc0, 0xcf, 0x2e,
+    0xd0, 0x58, 0xc2, 0x0f, 0xbd, 0x29, 0x45, 0xda, 0xab, 0x40, 0xcf, 0x50,
+    0xdc, 0x14, 0x31, 0x00, 0xe7, 0xd1, 0x03, 0xc0, 0xcf, 0x5c, 0xcb, 0x93,
+    0xf6, 0x00, 0xe7, 0xb1, 0xcb, 0x8f, 0xe1, 0x00, 0xe7, 0xa9, 0x14, 0xc0,
+    0xcf, 0x6e, 0xcd, 0x2e, 0xcb, 0x00, 0xe7, 0x79, 0xd6, 0x2e, 0xc2, 0x00,
+    0xe7, 0x71, 0xc6, 0xd3, 0x0d, 0x00, 0xe7, 0x69, 0x48, 0x5f, 0x6a, 0xc0,
+    0xcf, 0x80, 0xda, 0x19, 0x2c, 0x00, 0xe6, 0xa1, 0xc9, 0xae, 0xa9, 0x00,
+    0xe6, 0x98, 0x42, 0x00, 0x58, 0xc0, 0xcf, 0x98, 0x42, 0x00, 0x2c, 0xc0,
+    0xcf, 0xa4, 0x47, 0xc7, 0x7b, 0xc0, 0xcf, 0xb0, 0xe0, 0x04, 0xa7, 0x00,
+    0xe7, 0x09, 0x16, 0xc0, 0xcf, 0xbc, 0x42, 0x02, 0x2b, 0xc0, 0xcf, 0xce,
+    0x4b, 0x19, 0x2c, 0xc0, 0xcf, 0xda, 0xc7, 0xc9, 0x03, 0x00, 0xe6, 0x91,
+    0xc5, 0xdb, 0xe1, 0x00, 0xe6, 0x88, 0xc4, 0xe3, 0xa7, 0x0b, 0x7f, 0x89,
+    0xc2, 0x00, 0x64, 0x0b, 0x7f, 0x80, 0xc6, 0xa0, 0xd4, 0x0f, 0xa7, 0xc9,
+    0xc4, 0xe0, 0x8b, 0x0f, 0x9d, 0x70, 0x83, 0x08, 0x2b, 0x81, 0x04, 0xc0,
+    0xcf, 0xef, 0x05, 0xc0, 0xcf, 0xf9, 0x06, 0xc0, 0xd0, 0x03, 0x87, 0x08,
+    0x2b, 0xc3, 0x00, 0xd0, 0x0d, 0xc2, 0x14, 0xda, 0x08, 0x2b, 0xc9, 0xc2,
+    0x01, 0x30, 0x08, 0x2b, 0xd1, 0x0a, 0xc0, 0xd0, 0x11, 0x8b, 0x08, 0x2b,
+    0xf3, 0x00, 0xd0, 0x1b, 0xc2, 0x1c, 0x52, 0x08, 0x2c, 0x01, 0x0e, 0xc0,
+    0xd0, 0x21, 0xc2, 0x00, 0x4e, 0x08, 0x2c, 0x21, 0x10, 0xc0, 0xd0, 0x2b,
+    0x91, 0x08, 0x2c, 0x39, 0xc2, 0x00, 0x67, 0x08, 0x2c, 0x41, 0xc2, 0x0f,
+    0x9a, 0x08, 0x2c, 0x49, 0x15, 0xc0, 0xd0, 0x35, 0x16, 0xc0, 0xd0, 0x3f,
+    0x97, 0x08, 0x2c, 0x81, 0x9b, 0x08, 0x2c, 0xa1, 0xc2, 0x0a, 0xe2, 0x08,
+    0x2c, 0xa9, 0xc2, 0x02, 0x2b, 0x08, 0x2c, 0x09, 0xc2, 0x01, 0x19, 0x08,
+    0x2c, 0x51, 0xc2, 0x00, 0x5f, 0x08, 0x2c, 0x89, 0xc2, 0x24, 0xe2, 0x08,
+    0x2c, 0x90, 0x83, 0x08, 0x2c, 0xb9, 0x04, 0xc0, 0xd0, 0x49, 0x05, 0xc0,
+    0xd0, 0x53, 0x06, 0xc0, 0xd0, 0x5d, 0x87, 0x08, 0x2c, 0xfb, 0x00, 0xd0,
+    0x67, 0xc2, 0x14, 0xda, 0x08, 0x2d, 0x01, 0xc2, 0x01, 0x30, 0x08, 0x2d,
+    0x09, 0x0a, 0xc0, 0xd0, 0x6b, 0x8b, 0x08, 0x2d, 0x2b, 0x00, 0xd0, 0x75,
+    0xc2, 0x1c, 0x52, 0x08, 0x2d, 0x39, 0xc2, 0x02, 0x2b, 0x08, 0x2d, 0x41,
+    0x0e, 0xc0, 0xd0, 0x7b, 0xc2, 0x00, 0x4e, 0x08, 0x2d, 0x59, 0x10, 0xc0,
+    0xd0, 0x85, 0x91, 0x08, 0x2d, 0x71, 0xc2, 0x00, 0x67, 0x08, 0x2d, 0x79,
+    0xc2, 0x0f, 0x9a, 0x08, 0x2d, 0x81, 0xc2, 0x01, 0x19, 0x08, 0x2d, 0x89,
+    0x15, 0xc0, 0xd0, 0x8f, 0x16, 0xc0, 0xd0, 0x99, 0x97, 0x08, 0x2d, 0xb9,
+    0xc2, 0x00, 0x5f, 0x08, 0x2d, 0xc1, 0xc2, 0x24, 0xe2, 0x08, 0x2d, 0xc9,
+    0x9b, 0x08, 0x2d, 0xd9, 0xc2, 0x0a, 0xe2, 0x08, 0x2d, 0xe0, 0x44, 0x0d,
+    0x14, 0xc0, 0xd0, 0xa3, 0xca, 0x9c, 0x02, 0x01, 0x0a, 0xc0, 0x45, 0x02,
+    0xde, 0xc0, 0xd0, 0xaf, 0x43, 0x02, 0xa0, 0x40, 0xd0, 0xc1, 0xc6, 0x06,
+    0xdb, 0x01, 0x0a, 0xd9, 0x15, 0xc0, 0xd0, 0xcd, 0xc5, 0x9c, 0x06, 0x01,
+    0x0a, 0xa9, 0x16, 0xc0, 0xd0, 0xd9, 0xc5, 0xd9, 0x1b, 0x01, 0x0a, 0x89,
+    0xc7, 0x08, 0x79, 0x00, 0x05, 0xe1, 0xc4, 0x01, 0xce, 0x00, 0x05, 0xe8,
+    0x42, 0x00, 0xb4, 0xc0, 0xd0, 0xe5, 0x0e, 0xc0, 0xd0, 0xf1, 0x05, 0xc0,
+    0xd1, 0x01, 0x14, 0xc0, 0xd1, 0x0b, 0x42, 0x00, 0xe3, 0xc0, 0xd1, 0x17,
+    0x07, 0xc0, 0xd1, 0x23, 0x15, 0xc0, 0xd1, 0x2f, 0x06, 0xc0, 0xd1, 0x41,
+    0xc9, 0x11, 0xf6, 0x70, 0x01, 0x71, 0xcc, 0x89, 0xcd, 0x70, 0x01, 0x69,
+    0x12, 0xc0, 0xd1, 0x4d, 0x03, 0xc0, 0xd1, 0x59, 0xc5, 0x1e, 0xc8, 0x70,
+    0x03, 0xf1, 0xcd, 0x36, 0x86, 0x70, 0x03, 0xe1, 0xcb, 0x97, 0x9d, 0x70,
+    0x01, 0x18, 0x4b, 0x6f, 0xc7, 0xc0, 0xd1, 0x6b, 0x47, 0x02, 0x0e, 0x40,
+    0xd1, 0x73, 0x47, 0x02, 0x0e, 0xc0, 0xd1, 0xc5, 0x45, 0x00, 0xba, 0xc0,
+    0xd2, 0x26, 0x4b, 0x6f, 0xc7, 0x40, 0xd2, 0x32, 0x43, 0x02, 0xab, 0xc0,
+    0xd2, 0x3a, 0x43, 0x44, 0xc7, 0xc0, 0xd2, 0x46, 0xc5, 0x55, 0xd8, 0x0f,
+    0x9a, 0x50, 0xd7, 0x27, 0xd0, 0x08, 0xff, 0xf9, 0x15, 0xc0, 0xd2, 0x52,
+    0xd2, 0x4c, 0xc7, 0x08, 0xff, 0x71, 0x16, 0xc0, 0xd2, 0x6a, 0x03, 0xc0,
+    0xd2, 0x76, 0x05, 0xc0, 0xd2, 0x88, 0x0e, 0xc0, 0xd2, 0x94, 0x06, 0xc0,
+    0xd2, 0xa0, 0xd4, 0x39, 0xe4, 0x08, 0xff, 0x21, 0x49, 0x53, 0xa9, 0xc0,
+    0xd2, 0xb8, 0x4b, 0x6f, 0xc7, 0xc0, 0xd2, 0xca, 0xc2, 0x00, 0x7a, 0x00,
+    0x5e, 0x81, 0x47, 0x34, 0x2f, 0xc0, 0xd2, 0xea, 0xca, 0xa3, 0xdc, 0x00,
+    0x5f, 0xa1, 0xc9, 0xab, 0xe2, 0x00, 0x5f, 0xa9, 0xca, 0x76, 0x52, 0x00,
+    0x5f, 0xc8, 0x46, 0x09, 0x97, 0xc0, 0xd2, 0xfc, 0xd1, 0x50, 0xce, 0x08,
+    0xb5, 0xc9, 0x47, 0x02, 0x0e, 0xc0, 0xd3, 0x20, 0x45, 0x00, 0xba, 0xc0,
+    0xd3, 0x87, 0x4b, 0x6f, 0xc7, 0x40, 0xd3, 0x99, 0x45, 0x00, 0xba, 0xc0,
+    0xd3, 0xb3, 0x4b, 0x92, 0x80, 0xc0, 0xd3, 0xe6, 0x4b, 0x8c, 0xbe, 0xc0,
+    0xd4, 0x0a, 0x42, 0x00, 0x99, 0xc0, 0xd4, 0x2e, 0x4b, 0x6f, 0xc7, 0xc0,
+    0xd4, 0x3a, 0x47, 0x02, 0x0e, 0x40, 0xd4, 0x64, 0x16, 0xc0, 0xd4, 0xb2,
+    0x83, 0x00, 0xcb, 0x1b, 0x00, 0xd4, 0xc6, 0x87, 0x00, 0xcb, 0x5b, 0x00,
+    0xd4, 0xd0, 0x97, 0x00, 0xcb, 0x3b, 0x00, 0xd4, 0xd8, 0x91, 0x00, 0xcb,
+    0x4b, 0x00, 0xd4, 0xdc, 0x8b, 0x00, 0xcb, 0x21, 0x10, 0xc0, 0xd4, 0xe0,
+    0x0d, 0xc0, 0xd4, 0xea, 0xc2, 0x0f, 0x9a, 0x00, 0xca, 0xf9, 0xc2, 0x00,
+    0xd0, 0x00, 0xca, 0xf1, 0xc2, 0x02, 0x41, 0x00, 0xca, 0xe9, 0xc2, 0x00,
+    0x87, 0x00, 0xca, 0xe1, 0xc2, 0x01, 0xc3, 0x00, 0xca, 0xd9, 0x12, 0xc0,
+    0xd4, 0xf4, 0xc2, 0x00, 0xdb, 0x00, 0xca, 0xc1, 0xc2, 0x19, 0x2c, 0x00,
+    0xca, 0xa9, 0xc2, 0x0d, 0xf6, 0x00, 0xca, 0xa1, 0xc2, 0x8d, 0x8f, 0x00,
+    0xca, 0x88, 0x47, 0x10, 0x78, 0xc0, 0xd4, 0xfe, 0x49, 0xb2, 0x63, 0xc0,
+    0xd5, 0x16, 0x46, 0x34, 0x6f, 0xc0, 0xd5, 0x2e, 0x45, 0xdb, 0x96, 0xc0,
+    0xd5, 0x48, 0x47, 0x02, 0x0e, 0x40, 0xd5, 0x54, 0xc2, 0x17, 0x28, 0x0f,
+    0xcc, 0x19, 0xcd, 0x77, 0xbb, 0x01, 0x05, 0xd0, 0x46, 0x04, 0x8f, 0xc0,
+    0xd5, 0x60, 0xd1, 0x50, 0x79, 0x01, 0x36, 0x49, 0x42, 0x00, 0x10, 0xc0,
+    0xd5, 0x6c, 0x06, 0xc0, 0xd5, 0x78, 0x15, 0xc0, 0xd5, 0x84, 0x03, 0xc0,
+    0xd5, 0x9c, 0x05, 0xc0, 0xd5, 0xa8, 0xd7, 0x29, 0xb3, 0x01, 0x09, 0x49,
+    0xcc, 0x8a, 0xd5, 0x0f, 0xac, 0x78, 0xd2, 0x22, 0x49, 0x0f, 0xbe, 0x11,
+    0x06, 0xc0, 0xd5, 0xb4, 0x0e, 0xc0, 0xd5, 0xc0, 0x14, 0xc0, 0xd5, 0xcc,
+    0xce, 0x6f, 0xb6, 0x0f, 0xaf, 0x59, 0xcc, 0x86, 0xfd, 0x0f, 0xad, 0x89,
+    0xd3, 0x3f, 0xf5, 0x0f, 0xad, 0x39, 0xd8, 0x23, 0x03, 0x01, 0x53, 0xb0,
+    0x42, 0x00, 0xa9, 0xc0, 0xd5, 0xd8, 0xcc, 0x79, 0x42, 0x01, 0x00, 0x21,
+    0xc7, 0xbc, 0x33, 0x01, 0x71, 0xd8, 0x00, 0xc0, 0xd5, 0xf0, 0xc9, 0xa1,
+    0x3f, 0x0f, 0xc8, 0xa0, 0xcf, 0x69, 0xf9, 0x01, 0x36, 0x41, 0xc5, 0xdc,
+    0x6d, 0x01, 0x30, 0x40, 0xc9, 0xb2, 0xfc, 0x0f, 0xa2, 0x71, 0xc7, 0xc4,
+    0x6b, 0x0f, 0xa2, 0x68, 0xc4, 0x5e, 0x73, 0x01, 0x11, 0xa1, 0x00, 0x40,
+    0xd5, 0xfa, 0xc5, 0x9b, 0x3f, 0x0f, 0x99, 0x09, 0xc7, 0xc2, 0x49, 0x01,
+    0x4f, 0x38, 0x11, 0xc0, 0xd6, 0x06, 0xc7, 0xc0, 0x27, 0x00, 0x3d, 0x51,
+    0x07, 0xc0, 0xd6, 0x18, 0xc7, 0xc0, 0x5f, 0x00, 0x3d, 0x41, 0x03, 0xc0,
+    0xd6, 0x2a, 0x47, 0x02, 0x0e, 0xc0, 0xd6, 0x36, 0xc5, 0xdb, 0xfa, 0x00,
+    0x3d, 0x80, 0x05, 0xc0, 0xd6, 0xa0, 0x46, 0x09, 0x97, 0x40, 0xd6, 0xac,
+    0x43, 0x01, 0xd0, 0xc0, 0xd6, 0xd0, 0x96, 0x0f, 0x9d, 0x48, 0x05, 0xc0,
+    0xd6, 0xee, 0xcc, 0x88, 0x65, 0x01, 0x71, 0x18, 0x05, 0xc0, 0xd6, 0xfa,
+    0xcc, 0x88, 0x65, 0x01, 0x71, 0x10, 0xd3, 0x05, 0xf4, 0x01, 0x49, 0xd3,
+    0x00, 0xd7, 0x06, 0xda, 0x1d, 0x08, 0x01, 0x49, 0xe0, 0xd0, 0x5e, 0xb2,
+    0x0f, 0x15, 0x71, 0x47, 0x02, 0x0e, 0x40, 0xd7, 0x0c, 0x42, 0xe6, 0x8f,
+    0xc0, 0xd7, 0x85, 0x23, 0xc0, 0xd7, 0x91, 0x22, 0xc0, 0xd7, 0xa3, 0x24,
+    0x40, 0xd7, 0xaf, 0xc5, 0xb4, 0xb0, 0x0f, 0xd5, 0x28, 0xc4, 0x63, 0x7d,
+    0x0f, 0xb4, 0x58, 0xc5, 0xdd, 0x21, 0x0f, 0xad, 0x91, 0xc3, 0x05, 0xb1,
+    0x0f, 0xb4, 0xe0, 0xd3, 0x44, 0x56, 0x01, 0x56, 0xd9, 0xc5, 0xd7, 0x36,
+    0x01, 0x5e, 0xb8, 0x42, 0x00, 0x49, 0xc0, 0xd7, 0xbb, 0x45, 0x05, 0xef,
+    0x40, 0xd7, 0xc7, 0xc5, 0x61, 0xc0, 0x01, 0x31, 0xb9, 0xc8, 0x2d, 0xb2,
+    0x01, 0x31, 0xb1, 0x19, 0xc0, 0xd7, 0xd9, 0xc7, 0x71, 0xa7, 0x01, 0x31,
+    0x99, 0xc4, 0x83, 0x39, 0x01, 0x31, 0x91, 0xc4, 0x2a, 0x95, 0x01, 0x31,
+    0x89, 0xc6, 0x73, 0xca, 0x01, 0x31, 0x80, 0x4d, 0x18, 0x5a, 0xc0, 0xd7,
+    0xe5, 0xc5, 0x1e, 0xc8, 0x01, 0x12, 0x59, 0xc8, 0x1e, 0x3f, 0x01, 0x11,
+    0x69, 0x12, 0xc0, 0xd7, 0xfd, 0x54, 0x3b, 0xb0, 0xc0, 0xd8, 0x09, 0xce,
+    0x6f, 0xe0, 0x01, 0x57, 0xb1, 0x47, 0xc4, 0x17, 0xc0, 0xd8, 0x15, 0xd7,
+    0x27, 0x5d, 0x01, 0x57, 0xd9, 0xc6, 0xce, 0x21, 0x01, 0x72, 0x58, 0xd0,
+    0x59, 0x62, 0x01, 0x5e, 0xf8, 0xc2, 0x38, 0x5e, 0x0f, 0x9e, 0x31, 0x45,
+    0x05, 0x88, 0x40, 0xd8, 0x21, 0xc5, 0xd4, 0x70, 0x0f, 0xb4, 0x70, 0x11,
+    0xc0, 0xd8, 0x2d, 0xc6, 0xcb, 0x99, 0x0e, 0x9a, 0x81, 0xc5, 0x07, 0xeb,
+    0x0e, 0x99, 0xb1, 0x43, 0x11, 0xf7, 0x40, 0xd8, 0x39, 0x03, 0xc0, 0xd8,
+    0x45, 0xc5, 0xd9, 0x84, 0x0e, 0x99, 0x28, 0x0b, 0xc0, 0xd8, 0x51, 0xc8,
+    0x35, 0xc9, 0x0e, 0x9a, 0x41, 0x07, 0xc0, 0xd8, 0x61, 0xc4, 0xe4, 0x4b,
+    0x0e, 0x9a, 0x19, 0xc5, 0xd7, 0x45, 0x0e, 0x99, 0x00, 0xcb, 0x9a, 0x1b,
+    0x0e, 0x9a, 0x99, 0xc9, 0xae, 0x73, 0x0e, 0x98, 0x68, 0x11, 0xc0, 0xd8,
+    0x73, 0x43, 0x07, 0xa2, 0xc0, 0xd8, 0x7d, 0xc5, 0xb7, 0x35, 0x0e, 0x99,
+    0x09, 0xc5, 0x04, 0xe2, 0x0e, 0x98, 0x30, 0xca, 0xa1, 0x8e, 0x0e, 0x9a,
+    0x89, 0xcb, 0x96, 0xe2, 0x0e, 0x9a, 0x09, 0xc6, 0xd1, 0xe7, 0x0e, 0x98,
+    0xc9, 0xc5, 0x39, 0x0b, 0x0e, 0x98, 0x60, 0xc7, 0xc3, 0x68, 0x0e, 0x9a,
+    0x69, 0xcb, 0x4c, 0x26, 0x0e, 0x98, 0xb0, 0x16, 0xc0, 0xd8, 0x87, 0xc8,
+    0xb7, 0x62, 0x0e, 0x9a, 0x59, 0xc6, 0x83, 0x26, 0x0e, 0x9a, 0x28, 0xc9,
+    0xa8, 0xb8, 0x0e, 0x9a, 0x51, 0xcc, 0x81, 0x51, 0x0e, 0x9a, 0x11, 0xc7,
+    0x2d, 0x56, 0x0e, 0x99, 0xd1, 0x10, 0xc0, 0xd8, 0x91, 0xc3, 0x2c, 0xff,
+    0x0e, 0x98, 0xe0, 0xc3, 0x13, 0x69, 0x0e, 0x9a, 0x31, 0xc6, 0xcc, 0x17,
+    0x0e, 0x98, 0x90, 0xc3, 0x1c, 0xe6, 0x0e, 0x9a, 0x21, 0xc5, 0x20, 0xd8,
+    0x0e, 0x98, 0xb8, 0xc6, 0xcb, 0x2d, 0x0e, 0x9a, 0x01, 0xc6, 0x14, 0xc5,
+    0x0e, 0x99, 0xc9, 0xc4, 0x7c, 0xaa, 0x0e, 0x98, 0x40, 0xc8, 0x55, 0xc9,
+    0x0e, 0x99, 0x43, 0x00, 0xd8, 0xa3, 0xca, 0xa7, 0xd8, 0x0e, 0x99, 0xf1,
+    0xc8, 0xbd, 0x6a, 0x0e, 0x99, 0x91, 0xcc, 0x8b, 0x7d, 0x0e, 0x99, 0x78,
+    0xc5, 0xdc, 0x5e, 0x0e, 0x99, 0xa9, 0x07, 0x40, 0xd8, 0xa9, 0x03, 0xc0,
+    0xd8, 0xb9, 0xc5, 0xdd, 0x58, 0x0e, 0x99, 0x51, 0xca, 0xa2, 0x06, 0x0e,
+    0x98, 0x98, 0xc6, 0xcf, 0x53, 0x0e, 0x99, 0x39, 0xcc, 0x84, 0xc9, 0x0e,
+    0x98, 0x50, 0xce, 0x70, 0x7a, 0x0e, 0x99, 0x19, 0xcc, 0x88, 0x11, 0x0e,
+    0x98, 0x71, 0xc6, 0x69, 0x74, 0x0e, 0x98, 0x48, 0x45, 0x0a, 0xe9, 0xc0,
+    0xd8, 0xc5, 0xcd, 0x79, 0x82, 0x0f, 0xa6, 0x30, 0x46, 0x36, 0xb7, 0xc0,
+    0xd8, 0xd1, 0xc5, 0xbc, 0xed, 0x0f, 0xa9, 0x69, 0xc6, 0x30, 0xf3, 0x0f,
+    0xa7, 0xd0, 0x45, 0x00, 0xba, 0xc0, 0xd8, 0xe9, 0x42, 0x00, 0x49, 0xc0,
+    0xd9, 0x09, 0x4b, 0x6f, 0xc7, 0xc0, 0xd9, 0x15, 0xce, 0x74, 0xcc, 0x00,
+    0x62, 0xb1, 0x46, 0x09, 0x97, 0xc0, 0xd9, 0x3b, 0x4f, 0x63, 0xa5, 0x40,
+    0xd9, 0x5f, 0xc5, 0x11, 0x55, 0x0f, 0xa1, 0x78, 0xd0, 0x5d, 0x52, 0x01,
+    0x4e, 0xa9, 0xcf, 0x66, 0x66, 0x01, 0x4e, 0xa0, 0xc8, 0x18, 0x67, 0x01,
+    0x11, 0xe3, 0x00, 0xd9, 0x6f, 0x45, 0x00, 0x8c, 0x40, 0xd9, 0x73, 0x46,
+    0x09, 0x97, 0xc0, 0xd9, 0x7f, 0xc2, 0x00, 0x7a, 0x08, 0xa6, 0x39, 0x03,
+    0xc0, 0xd9, 0xa3, 0xc5, 0xd5, 0xce, 0x08, 0xa6, 0x29, 0x45, 0x00, 0xba,
+    0xc0, 0xd9, 0xaf, 0x4b, 0x6f, 0xc7, 0xc0, 0xd9, 0xc5, 0x47, 0x02, 0x0e,
+    0x40, 0xd9, 0xeb, 0xc2, 0x00, 0x3d, 0x01, 0x02, 0x51, 0xca, 0x9e, 0x0a,
+    0x01, 0x72, 0x90, 0xe0, 0x05, 0x07, 0x08, 0x59, 0xd0, 0x1b, 0xc0, 0xda,
+    0x52, 0x44, 0x00, 0xbb, 0xc0, 0xda, 0x5e, 0x49, 0x5c, 0xf2, 0x40, 0xda,
+    0x8a, 0x09, 0xc0, 0xda, 0x96, 0x42, 0x00, 0x74, 0xc0, 0xda, 0xa2, 0x05,
+    0xc0, 0xda, 0xae, 0xd5, 0x32, 0x81, 0x00, 0x78, 0x39, 0x15, 0xc0, 0xda,
+    0xc0, 0x04, 0xc0, 0xda, 0xcc, 0xd5, 0x32, 0xff, 0x00, 0x78, 0x61, 0x10,
+    0xc0, 0xda, 0xd6, 0x16, 0xc0, 0xda, 0xe2, 0x14, 0xc0, 0xda, 0xec, 0x4c,
+    0x85, 0x65, 0xc0, 0xda, 0xf8, 0xc7, 0xc3, 0xa7, 0x00, 0x7c, 0x21, 0xc6,
+    0xcb, 0x09, 0x00, 0x7c, 0x29, 0xd6, 0x2d, 0xfc, 0x00, 0x7e, 0x89, 0xd3,
+    0x3f, 0xbc, 0x00, 0x7e, 0xc8, 0x4d, 0x79, 0x27, 0xc0, 0xdb, 0x04, 0x46,
+    0x02, 0x0f, 0x40, 0xdb, 0x10, 0x15, 0xc0, 0xdb, 0x70, 0xc9, 0xaf, 0xf6,
+    0x00, 0x78, 0xc0, 0xc4, 0x15, 0xe7, 0x00, 0x79, 0x01, 0xc3, 0x05, 0x14,
+    0x00, 0x79, 0x09, 0x16, 0xc0, 0xdb, 0x7c, 0x08, 0xc0, 0xdb, 0x88, 0x15,
+    0xc0, 0xdb, 0x94, 0xc5, 0x06, 0xdb, 0x00, 0x79, 0x41, 0xc4, 0x26, 0x78,
+    0x00, 0x79, 0x49, 0x45, 0x01, 0xce, 0x40, 0xdb, 0xa0, 0xc2, 0x04, 0xc6,
+    0x00, 0x7b, 0x89, 0x8b, 0x00, 0x7b, 0x93, 0x00, 0xdb, 0xc4, 0x97, 0x00,
+    0x7b, 0xa3, 0x00, 0xdb, 0xc8, 0x48, 0xb2, 0x2d, 0xc0, 0xdb, 0xcc, 0x87,
+    0x00, 0x7b, 0xd3, 0x00, 0xdb, 0xda, 0x91, 0x00, 0x7b, 0xe3, 0x00, 0xdb,
+    0xde, 0xca, 0x9d, 0xe2, 0x00, 0x7c, 0x02, 0x00, 0xdb, 0xe2, 0xcd, 0x7c,
+    0xc2, 0x00, 0x7d, 0xf8, 0xca, 0x9a, 0xf4, 0x00, 0x7e, 0x01, 0xca, 0xa5,
+    0x9e, 0x00, 0x7e, 0x09, 0xc9, 0xb2, 0x5a, 0x00, 0x7e, 0x11, 0xca, 0xa3,
+    0x96, 0x00, 0x7e, 0x18, 0x1b, 0xc0, 0xdb, 0xe6, 0x51, 0x54, 0xec, 0xc0,
+    0xdc, 0x00, 0x16, 0xc0, 0xdc, 0x08, 0x03, 0x40, 0xdc, 0x14, 0xe0, 0x02,
+    0x07, 0x01, 0x6b, 0x78, 0x43, 0x02, 0xa3, 0xc0, 0xdc, 0x20, 0xdc, 0x13,
+    0xa5, 0x01, 0x02, 0x89, 0xce, 0x6f, 0xb6, 0x0f, 0xaf, 0x51, 0xcc, 0x86,
+    0xfd, 0x0f, 0xad, 0x81, 0xc6, 0x78, 0x78, 0x0f, 0xa4, 0xa9, 0x55, 0x33,
+    0x7d, 0xc0, 0xdc, 0x2a, 0x48, 0x19, 0xb9, 0xc0, 0xdc, 0x36, 0xce, 0x71,
+    0xd8, 0x01, 0x4e, 0x49, 0xd8, 0x23, 0x03, 0x01, 0x53, 0xa9, 0xd1, 0x40,
+    0xee, 0x0f, 0xa3, 0x61, 0xd3, 0x40, 0xec, 0x0f, 0xa3, 0x68, 0xd7, 0x26,
+    0xa5, 0x0f, 0xc5, 0x81, 0x58, 0x21, 0x6b, 0xc0, 0xdc, 0x42, 0x57, 0x2b,
+    0x23, 0x40, 0xdc, 0x54, 0x0e, 0xc0, 0xdc, 0x60, 0x42, 0x01, 0xc3, 0xc0,
+    0xdc, 0x70, 0x06, 0xc0, 0xdc, 0x82, 0x14, 0xc0, 0xdc, 0x98, 0xc5, 0x4d,
+    0x40, 0x00, 0x32, 0x83, 0x00, 0xdc, 0xae, 0x08, 0xc0, 0xdc, 0xbb, 0x15,
+    0xc0, 0xdc, 0xd6, 0x45, 0x05, 0x75, 0xc0, 0xdd, 0x01, 0x16, 0xc0, 0xdd,
+    0x13, 0x05, 0xc0, 0xdd, 0x2f, 0x42, 0x00, 0xd0, 0xc0, 0xdd, 0x3b, 0x12,
+    0xc0, 0xdd, 0x47, 0x18, 0xc0, 0xdd, 0x5d, 0xd2, 0x4d, 0xd5, 0x00, 0x44,
+    0x39, 0x07, 0xc0, 0xdd, 0x69, 0xd0, 0x5e, 0x02, 0x00, 0x32, 0xf9, 0xc8,
+    0xbe, 0xf2, 0x00, 0x32, 0xc9, 0xce, 0x72, 0x2c, 0x00, 0x32, 0xb9, 0xcd,
+    0x2c, 0xb2, 0x00, 0x30, 0xf9, 0x47, 0x34, 0x2f, 0x40, 0xdd, 0x75, 0x46,
+    0x09, 0x97, 0xc0, 0xdd, 0x81, 0x44, 0x00, 0x67, 0xc0, 0xdd, 0xa5, 0xcb,
+    0x90, 0x4f, 0x00, 0x30, 0x39, 0xc9, 0xb3, 0x71, 0x00, 0x30, 0x30, 0x48,
+    0x19, 0x9b, 0xc0, 0xdd, 0xb1, 0x46, 0x02, 0x0f, 0x40, 0xdd, 0xc3, 0xd0,
+    0x48, 0x12, 0x00, 0x2a, 0xf9, 0xc9, 0x2d, 0x85, 0x00, 0x2a, 0xd0, 0xc4,
+    0x0a, 0x8b, 0x00, 0x2a, 0xe9, 0x4e, 0x0b, 0x18, 0x40, 0xde, 0x3c, 0xcf,
+    0x0f, 0x0a, 0x00, 0x2a, 0xe1, 0xcc, 0x81, 0x39, 0x00, 0x2a, 0xd8, 0x4e,
+    0x0b, 0x18, 0xc0, 0xde, 0xb5, 0xd1, 0x2b, 0xed, 0x0f, 0x4a, 0x40, 0xc4,
+    0x6b, 0x52, 0x0f, 0x49, 0x11, 0x06, 0xc0, 0xdf, 0x35, 0xc4, 0x76, 0x31,
+    0x0f, 0x49, 0x21, 0xc4, 0xe4, 0xb3, 0x0f, 0x49, 0x29, 0x04, 0xc0, 0xdf,
+    0x41, 0x15, 0xc0, 0xdf, 0x4b, 0xc2, 0x00, 0x67, 0x0f, 0x49, 0x41, 0xc2,
+    0x00, 0x39, 0x0f, 0x49, 0x51, 0x87, 0x0f, 0x49, 0x59, 0xc2, 0x00, 0x87,
+    0x0f, 0x49, 0x61, 0x8b, 0x0f, 0x49, 0x69, 0x91, 0x0f, 0x49, 0x71, 0x1b,
+    0xc0, 0xdf, 0x57, 0xc3, 0x7e, 0x89, 0x0f, 0x49, 0x89, 0x10, 0xc0, 0xdf,
+    0x61, 0x0d, 0xc0, 0xdf, 0x73, 0x97, 0x0f, 0x49, 0xa9, 0xc4, 0xe1, 0x4b,
+    0x0f, 0x49, 0xb1, 0xc3, 0x11, 0xee, 0x0f, 0x49, 0xb9, 0xc2, 0x00, 0xd0,
+    0x0f, 0x49, 0xc1, 0xc4, 0xd8, 0x3a, 0x0f, 0x49, 0xc9, 0x09, 0xc0, 0xdf,
+    0x85, 0xc2, 0x00, 0x16, 0x0f, 0x49, 0xe1, 0xc2, 0x02, 0x41, 0x0f, 0x49,
+    0xf1, 0xc3, 0xa9, 0xfc, 0x0f, 0x4a, 0x08, 0xc8, 0x01, 0xbf, 0x0f, 0x4a,
+    0x31, 0xd4, 0x3d, 0x2c, 0x0f, 0x4a, 0x48, 0xc4, 0x33, 0x5e, 0x0f, 0x4a,
+    0x51, 0xd0, 0x56, 0xc9, 0x0f, 0x4a, 0x58, 0xc4, 0x15, 0xe7, 0x0f, 0x4a,
+    0x81, 0xc3, 0x05, 0x14, 0x0f, 0x4a, 0x89, 0x16, 0xc0, 0xdf, 0x8f, 0x08,
+    0xc0, 0xdf, 0x9b, 0x15, 0xc0, 0xdf, 0xa7, 0xc5, 0x06, 0xdb, 0x0f, 0x4a,
+    0xc1, 0xc4, 0x26, 0x78, 0x0f, 0x4a, 0xc8, 0xd0, 0x0f, 0x09, 0x0f, 0x4a,
+    0xf1, 0xcd, 0x2c, 0xb2, 0x0f, 0x4a, 0xf8, 0x47, 0xc5, 0x21, 0xc0, 0xdf,
+    0xb3, 0xc4, 0xe4, 0x63, 0x0f, 0xba, 0x13, 0x00, 0xdf, 0xbf, 0xcb, 0x8c,
+    0xd4, 0x0f, 0xb8, 0x79, 0xca, 0x9a, 0xfe, 0x0f, 0xb9, 0xf1, 0xc4, 0x1a,
+    0xa8, 0x0f, 0xba, 0xc8, 0x14, 0xc0, 0xdf, 0xc3, 0xc7, 0xc8, 0xe0, 0x0f,
+    0xb8, 0x99, 0x46, 0x4c, 0x4a, 0xc0, 0xdf, 0xd2, 0x03, 0x40, 0xdf, 0xde,
+    0x42, 0x00, 0xfa, 0xc0, 0xdf, 0xf0, 0xc8, 0xbe, 0x7a, 0x0f, 0xbb, 0x80,
+    0x11, 0xc0, 0xdf, 0xff, 0xd2, 0x4e, 0x1d, 0x0f, 0xb8, 0x71, 0xca, 0xa1,
+    0x52, 0x0f, 0xba, 0xf9, 0x17, 0x40, 0xe0, 0x0e, 0xc5, 0xd7, 0x13, 0x0f,
+    0xb9, 0xfb, 0x00, 0xe0, 0x1a, 0x42, 0x00, 0x74, 0xc0, 0xe0, 0x20, 0xc4,
+    0xdf, 0x17, 0x0f, 0xba, 0x69, 0xc6, 0x7b, 0x50, 0x0f, 0xba, 0x88, 0x07,
+    0xc0, 0xe0, 0x2c, 0xc8, 0xba, 0xfa, 0x0f, 0xb8, 0xc2, 0x00, 0xe0, 0x44,
+    0x0b, 0xc0, 0xe0, 0x4a, 0xc8, 0xbb, 0x32, 0x0f, 0xb9, 0x40, 0x17, 0xc0,
+    0xe0, 0x5c, 0x42, 0x00, 0x65, 0xc0, 0xe0, 0x68, 0xc5, 0xd4, 0x93, 0x0f,
+    0xb8, 0xd9, 0xc5, 0xac, 0x22, 0x0f, 0xba, 0x39, 0xce, 0x6f, 0x62, 0x0f,
+    0xba, 0x79, 0x16, 0xc0, 0xe0, 0x75, 0xc3, 0xc9, 0x9a, 0x0f, 0xba, 0xa0,
+    0xcb, 0x97, 0xb3, 0x0f, 0xb9, 0x59, 0x43, 0x00, 0xe3, 0xc0, 0xe0, 0x84,
+    0xc2, 0x01, 0x29, 0x0f, 0xb8, 0x09, 0x0e, 0xc0, 0xe0, 0x8e, 0xc6, 0xcd,
+    0xd3, 0x0f, 0xb9, 0xd1, 0xca, 0x9a, 0xcc, 0x0f, 0xb9, 0xe9, 0xc4, 0x04,
+    0x65, 0x0f, 0xba, 0xb9, 0xc6, 0xd2, 0x4d, 0x0f, 0xba, 0xd8, 0xc7, 0xc2,
+    0xb9, 0x0f, 0xb9, 0x51, 0xc8, 0xba, 0xe2, 0x0f, 0xba, 0x98, 0xc3, 0x04,
+    0xe4, 0x0f, 0xb8, 0xa9, 0xc3, 0x00, 0x2e, 0x0f, 0xbb, 0x78, 0xd0, 0x5d,
+    0x22, 0x0f, 0xb8, 0x83, 0x00, 0xe0, 0xa3, 0xc8, 0xbe, 0xc2, 0x0f, 0xb9,
+    0xc1, 0xc4, 0x97, 0x51, 0x0f, 0xbb, 0x88, 0xc3, 0x02, 0x11, 0x0f, 0xb8,
+    0x21, 0x9a, 0x0f, 0xba, 0x50, 0xc9, 0xaf, 0xed, 0x0f, 0xb8, 0x01, 0xc7,
+    0xc8, 0x62, 0x0f, 0xba, 0x08, 0xc3, 0x1a, 0x7c, 0x0f, 0xb8, 0xd1, 0xc2,
+    0x01, 0xdf, 0x0f, 0xba, 0x48, 0xc4, 0x91, 0x3d, 0x0f, 0xb8, 0xe3, 0x00,
+    0xe0, 0xa7, 0xcb, 0x91, 0x36, 0x0f, 0xb9, 0x08, 0x11, 0xc0, 0xe0, 0xad,
+    0x44, 0x01, 0xcf, 0x40, 0xe0, 0xb9, 0xd7, 0x08, 0xf0, 0x01, 0x53, 0x78,
+    0xd3, 0x43, 0xab, 0x0f, 0x9f, 0x39, 0xc5, 0x46, 0x98, 0x0f, 0xb4, 0xb8,
+    0x1d, 0xc0, 0xe0, 0xc5, 0x1e, 0xc0, 0xe0, 0xed, 0x1f, 0xc0, 0xe1, 0x15,
+    0x20, 0xc0, 0xe1, 0x3d, 0x21, 0xc0, 0xe1, 0x65, 0x22, 0x40, 0xe1, 0x8d,
+    0xd3, 0x41, 0x97, 0x01, 0x3f, 0x91, 0x05, 0xc0, 0xe1, 0x9f, 0xd1, 0x05,
+    0x75, 0x01, 0x0d, 0xd1, 0x16, 0xc0, 0xe1, 0xab, 0x48, 0x03, 0xc8, 0xc0,
+    0xe1, 0xb7, 0xcb, 0x87, 0x8d, 0x01, 0x50, 0x88, 0x46, 0x00, 0x8b, 0x40,
+    0xe1, 0xbd, 0xda, 0x19, 0xc8, 0x01, 0x37, 0x11, 0xc3, 0x92, 0x53, 0x01,
+    0x5e, 0xc8, 0x8d, 0x00, 0x01, 0x53, 0x00, 0xe1, 0xc9, 0x8f, 0x01, 0x02,
+    0x10, 0xc2, 0x00, 0xdb, 0x08, 0xba, 0x31, 0x83, 0x08, 0xb8, 0x70, 0xc2,
+    0x00, 0xc1, 0x08, 0xba, 0x29, 0xc2, 0x19, 0x2c, 0x08, 0xb8, 0x81, 0x83,
+    0x08, 0xb8, 0x19, 0xc2, 0x01, 0x30, 0x08, 0xb8, 0x10, 0x06, 0xc0, 0xe1,
+    0xcf, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0xa1, 0x83, 0x08, 0xb8, 0x98, 0x16,
+    0xc0, 0xe1, 0xd9, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0x61, 0x83, 0x08, 0xb8,
+    0x20, 0x83, 0x08, 0xba, 0x01, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0x58, 0x49,
+    0x0c, 0x8d, 0x40, 0xe1, 0xe3, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0xc9, 0x83,
+    0x08, 0xb8, 0x50, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0xc1, 0x83, 0x08, 0xb8,
+    0x40, 0xc2, 0x00, 0xd0, 0x08, 0xb8, 0xb9, 0x83, 0x08, 0xb8, 0xa8, 0xc2,
+    0x00, 0xd0, 0x08, 0xb8, 0x39, 0x83, 0x08, 0xb8, 0x30, 0xc2, 0x00, 0xd0,
+    0x08, 0xb8, 0x09, 0x83, 0x08, 0xb8, 0x00, 0xc5, 0xdd, 0x08, 0x08, 0xb9,
+    0xf1, 0x15, 0xc0, 0xe1, 0xf5, 0xc6, 0xd0, 0xeb, 0x08, 0xb9, 0x58, 0xc4,
+    0x18, 0x10, 0x08, 0xb9, 0xb9, 0xc2, 0x22, 0xcc, 0x08, 0xb9, 0xb0, 0xc3,
+    0x0d, 0x14, 0x08, 0xb9, 0xa9, 0xc3, 0x09, 0x9e, 0x08, 0xb9, 0xa0, 0xc4,
+    0x02, 0xde, 0x08, 0xb9, 0x99, 0xc2, 0x02, 0xa0, 0x08, 0xb9, 0x90, 0x8f,
+    0x08, 0xb9, 0x51, 0x8b, 0x08, 0xb9, 0x49, 0x99, 0x08, 0xb9, 0x39, 0x83,
+    0x08, 0xb9, 0x08, 0x97, 0x08, 0xb9, 0x28, 0x8b, 0x08, 0xb9, 0x18, 0xca,
+    0x9f, 0x04, 0x08, 0xb8, 0xf9, 0x83, 0x08, 0xb8, 0xe8, 0xc2, 0x01, 0x9d,
+    0x01, 0x1c, 0xab, 0x00, 0xe2, 0x01, 0x44, 0x48, 0xaa, 0x40, 0xe2, 0x05,
+    0xc9, 0x52, 0x08, 0x01, 0x1b, 0xb0, 0xc9, 0x52, 0x08, 0x01, 0x1b, 0xc8,
+    0xc3, 0x01, 0xbb, 0x01, 0x1b, 0x9b, 0x00, 0xe2, 0x11, 0xc5, 0xd8, 0xf3,
+    0x01, 0x19, 0xb0, 0xc2, 0x01, 0x23, 0x01, 0x1b, 0xa1, 0xce, 0x6c, 0xde,
+    0x01, 0x1a, 0x30, 0x00, 0xc0, 0xe2, 0x17, 0xca, 0x6c, 0xe2, 0x01, 0x1a,
+    0x78, 0x43, 0x01, 0x47, 0xc0, 0xe2, 0x29, 0x42, 0x05, 0x03, 0xc0, 0xe2,
+    0x33, 0xcf, 0x67, 0xdd, 0x01, 0x1a, 0xd0, 0xd1, 0x52, 0x00, 0x01, 0x1b,
+    0x71, 0x16, 0xc0, 0xe2, 0x3d, 0xc8, 0x7d, 0xf2, 0x01, 0x19, 0xf9, 0xca,
+    0x9a, 0x9a, 0x01, 0x19, 0xb8, 0xc8, 0xb5, 0xea, 0x01, 0x1b, 0x51, 0x46,
+    0x02, 0xd2, 0x40, 0xe2, 0x49, 0xcb, 0x94, 0xf3, 0x01, 0x1b, 0x39, 0xca,
+    0x6c, 0xe2, 0x01, 0x1a, 0x28, 0xc9, 0x20, 0xa8, 0x01, 0x1b, 0x21, 0xc8,
+    0x52, 0x09, 0x01, 0x1a, 0xd8, 0x49, 0x07, 0x49, 0xc0, 0xe2, 0x67, 0xcf,
+    0x6a, 0x53, 0x01, 0x12, 0x80, 0x0a, 0xc0, 0xe2, 0x73, 0x15, 0xc0, 0xe2,
+    0x7d, 0xc2, 0x00, 0x5f, 0x08, 0x59, 0x61, 0x1b, 0xc0, 0xe2, 0x8b, 0xc2,
+    0x00, 0x4e, 0x08, 0x59, 0x41, 0x10, 0xc0, 0xe2, 0x95, 0x06, 0xc0, 0xe2,
+    0xa9, 0x16, 0xc0, 0xe2, 0xb3, 0xc2, 0x1c, 0x52, 0x08, 0x58, 0xc1, 0xc2,
+    0x00, 0x89, 0x08, 0x58, 0xb9, 0x09, 0xc0, 0xe2, 0xc3, 0x1a, 0xc0, 0xe2,
+    0xd3, 0xc2, 0x00, 0x3c, 0x08, 0x58, 0x81, 0x97, 0x08, 0x58, 0x73, 0x00,
+    0xe2, 0xe3, 0x8b, 0x08, 0x58, 0x63, 0x00, 0xe2, 0xe7, 0x91, 0x08, 0x58,
+    0x53, 0x00, 0xe2, 0xeb, 0x87, 0x08, 0x58, 0x43, 0x00, 0xe2, 0xef, 0x83,
+    0x08, 0x58, 0x03, 0x00, 0xe2, 0xf3, 0xc2, 0x00, 0x67, 0x08, 0x58, 0xf1,
+    0xc2, 0x14, 0xda, 0x08, 0x58, 0xf9, 0x04, 0xc0, 0xe3, 0x09, 0xc2, 0x01,
+    0x19, 0x08, 0x59, 0x69, 0xc2, 0x00, 0x49, 0x08, 0x59, 0x71, 0x1c, 0x40,
+    0xe3, 0x13, 0xc3, 0x05, 0x14, 0x08, 0x08, 0x3b, 0x00, 0xe3, 0x1d, 0x16,
+    0xc0, 0xe3, 0x21, 0x08, 0xc0, 0xe3, 0x32, 0x15, 0xc0, 0xe3, 0x3a, 0xc5,
+    0x06, 0xdb, 0x08, 0x08, 0x73, 0x00, 0xe3, 0x4c, 0xc4, 0x26, 0x78, 0x08,
+    0x08, 0x7a, 0x00, 0xe3, 0x57, 0x46, 0x0f, 0x88, 0xc0, 0xe3, 0x64, 0x4e,
+    0x72, 0x02, 0x40, 0xe3, 0x7a, 0xce, 0x71, 0x22, 0x08, 0x09, 0xf1, 0xcd,
+    0x7d, 0xb9, 0x08, 0x09, 0xf8, 0x0e, 0xc0, 0xe3, 0x86, 0x46, 0x11, 0x39,
+    0xc0, 0xe3, 0x92, 0x42, 0x00, 0x58, 0xc0, 0xe3, 0xcb, 0x49, 0x07, 0xbb,
+    0xc0, 0xe3, 0xd7, 0x43, 0x11, 0x49, 0xc0, 0xe3, 0xef, 0x46, 0x00, 0x2c,
+    0x40, 0xe4, 0x07, 0xc6, 0x0b, 0x09, 0x0f, 0xbc, 0x81, 0xc6, 0x02, 0xd1,
+    0x0f, 0xbc, 0x30, 0xc6, 0x13, 0x52, 0x0f, 0xbd, 0x59, 0xd2, 0x4d, 0x57,
+    0x0f, 0xbd, 0xb8, 0xd6, 0x08, 0x88, 0x01, 0x1f, 0x09, 0xcd, 0x00, 0x32,
+    0x01, 0x1e, 0xf9, 0xcb, 0x1a, 0x50, 0x01, 0x1e, 0xe9, 0xce, 0x25, 0xad,
+    0x01, 0x1d, 0xab, 0x00, 0xe4, 0x1f, 0x45, 0x01, 0xce, 0xc0, 0xe4, 0x25,
+    0x46, 0x00, 0x2c, 0xc0, 0xe4, 0x3d, 0x45, 0x00, 0x49, 0xc0, 0xe4, 0x47,
+    0xd7, 0x15, 0x64, 0x01, 0x49, 0xd8, 0x46, 0x00, 0x8b, 0x40, 0xe4, 0x51,
+    0x00, 0xc0, 0xe4, 0x5d, 0xc3, 0x00, 0x74, 0x0f, 0x9d, 0x98, 0xc4, 0x01,
+    0xc3, 0x0f, 0xa8, 0xb3, 0x00, 0xe4, 0x69, 0x95, 0x0f, 0xa6, 0xd0, 0x84,
+    0x01, 0x88, 0x2b, 0x00, 0xe4, 0x6f, 0x92, 0x01, 0x88, 0x31, 0x8f, 0x01,
+    0x88, 0x39, 0x88, 0x01, 0x88, 0x41, 0x86, 0x01, 0x88, 0x49, 0x96, 0x01,
+    0x88, 0x51, 0x90, 0x01, 0x88, 0x5b, 0x00, 0xe4, 0x73, 0x8e, 0x01, 0x88,
+    0x63, 0x00, 0xe4, 0x7e, 0x89, 0x01, 0x88, 0x6b, 0x00, 0xe4, 0x82, 0x8d,
+    0x01, 0x88, 0x73, 0x00, 0xe4, 0x92, 0x8a, 0x01, 0x88, 0x79, 0x8c, 0x01,
+    0x88, 0x83, 0x00, 0xe4, 0x96, 0x93, 0x01, 0x88, 0x89, 0x9a, 0x01, 0x88,
+    0x91, 0x9c, 0x01, 0x88, 0xbb, 0x00, 0xe4, 0x9a, 0x85, 0x01, 0x88, 0xc3,
+    0x00, 0xe4, 0xa6, 0x95, 0x01, 0x88, 0xcb, 0x00, 0xe4, 0xaa, 0x94, 0x01,
+    0x88, 0xb1, 0x83, 0x01, 0x88, 0xd3, 0x00, 0xe4, 0xae, 0x91, 0x01, 0x88,
+    0xdb, 0x00, 0xe4, 0xcb, 0x87, 0x01, 0x88, 0xe3, 0x00, 0xe4, 0xe5, 0x8b,
+    0x01, 0x89, 0x3b, 0x00, 0xe4, 0xfc, 0x97, 0x01, 0x89, 0x43, 0x00, 0xe5,
+    0x15, 0x98, 0x01, 0x89, 0x50, 0x92, 0x01, 0x8d, 0xa1, 0x96, 0x01, 0x8d,
+    0xa9, 0x8d, 0x01, 0x8d, 0xb1, 0x8a, 0x01, 0x8d, 0xb9, 0x89, 0x01, 0x8d,
+    0xd8, 0x9e, 0x0f, 0xd8, 0x03, 0x00, 0xe5, 0x1b, 0xa0, 0x0f, 0xd8, 0x1b,
+    0x00, 0xe5, 0x3b, 0x9f, 0x0f, 0xd8, 0x0b, 0x00, 0xe5, 0x4d, 0xa2, 0x0f,
+    0xd8, 0x7b, 0x00, 0xe5, 0x66, 0xa1, 0x0f, 0xd8, 0x3b, 0x00, 0xe5, 0x6a,
+    0xa3, 0x0f, 0xd8, 0xf0, 0x00, 0xc0, 0xe5, 0x75, 0x02, 0x40, 0xe5, 0xbf,
+    0xc4, 0xe3, 0x33, 0x0f, 0xa6, 0xc1, 0xc5, 0x1c, 0xae, 0x0f, 0xa4, 0xc8,
+    0x4a, 0xa5, 0x3a, 0x40, 0xe5, 0xcb, 0xc8, 0xb5, 0x7a, 0x0f, 0xd3, 0x81,
+    0xc8, 0xb8, 0x02, 0x0f, 0xcf, 0xb1, 0x11, 0x40, 0xe5, 0xe3, 0x42, 0x00,
+    0xb0, 0xc0, 0xe5, 0xf2, 0x4f, 0x2a, 0x5c, 0xc0, 0xe5, 0xff, 0x46, 0xcd,
+    0x25, 0xc0, 0xe6, 0x15, 0xc5, 0xd5, 0x56, 0x00, 0xda, 0xe1, 0x46, 0x09,
+    0x97, 0xc0, 0xe6, 0x21, 0x47, 0x02, 0x0e, 0xc0, 0xe6, 0x45, 0xc9, 0xb3,
+    0x3b, 0x00, 0xda, 0x21, 0x4b, 0x6f, 0xc7, 0xc0, 0xe6, 0xe9, 0x45, 0x00,
+    0xba, 0x40, 0xe7, 0x1a, 0xcd, 0x7e, 0x6f, 0x0f, 0x9e, 0x00, 0xc9, 0x11,
+    0xf6, 0x0b, 0x57, 0xa9, 0x4a, 0x51, 0x89, 0xc0, 0xe7, 0x38, 0x47, 0x02,
+    0x0e, 0x40, 0xe7, 0x4a, 0xc6, 0x00, 0x91, 0x0f, 0xb5, 0xe1, 0xc5, 0xd4,
+    0x66, 0x0f, 0xa3, 0xe1, 0xc6, 0x50, 0xe2, 0x0f, 0x9b, 0xe1, 0xc5, 0x55,
+    0x91, 0x0f, 0xa1, 0x20, 0x12, 0xc0, 0xe7, 0xc2, 0x83, 0x05, 0x35, 0x01,
+    0x0d, 0xc0, 0xe7, 0xd8, 0x97, 0x05, 0x35, 0x11, 0xc2, 0x02, 0xe0, 0x05,
+    0x35, 0x21, 0x14, 0xc0, 0xe7, 0xfb, 0x16, 0xc0, 0xe8, 0x0d, 0x91, 0x05,
+    0x35, 0x39, 0x10, 0xc0, 0xe8, 0x19, 0x8b, 0x05, 0x35, 0x49, 0x0e, 0xc0,
+    0xe8, 0x46, 0x8f, 0x05, 0x35, 0x9b, 0x00, 0xe8, 0x5e, 0x15, 0xc0, 0xe8,
+    0x76, 0x1b, 0xc0, 0xe8, 0x90, 0x19, 0xc0, 0xe8, 0xa0, 0x08, 0x40, 0xe8,
+    0xaa, 0x0f, 0xc0, 0xe8, 0xc0, 0xc3, 0x0d, 0xe5, 0x05, 0x37, 0xa0, 0x47,
+    0x01, 0xeb, 0xc0, 0xe8, 0xcc, 0x00, 0xc0, 0xe8, 0xd2, 0x15, 0x40, 0xe8,
+    0xde, 0x15, 0xc0, 0xe8, 0xea, 0x43, 0x0c, 0xe0, 0xc0, 0xe8, 0xf6, 0x4f,
+    0x30, 0x90, 0xc0, 0xe9, 0x02, 0x4b, 0x6f, 0xc7, 0xc0, 0xe9, 0x0c, 0x47,
+    0x02, 0x0e, 0x40, 0xe9, 0x2e, 0xc3, 0x82, 0x4c, 0x0f, 0xb6, 0x08, 0xc5,
+    0xb5, 0x75, 0x0f, 0xa6, 0x51, 0xc7, 0xc9, 0x96, 0x0f, 0xcf, 0xe0, 0xcf,
+    0x67, 0x38, 0x01, 0x33, 0x61, 0xcc, 0x82, 0xdd, 0x01, 0x33, 0x59, 0xd8,
+    0x23, 0x1b, 0x0f, 0x9c, 0xe9, 0xd7, 0x29, 0xca, 0x0f, 0x9c, 0xe0, 0xc5,
+    0x11, 0x55, 0x0f, 0xa1, 0xd9, 0xca, 0xa5, 0x76, 0x0f, 0xce, 0xa0, 0xcc,
+    0x20, 0x76, 0x01, 0x1f, 0x18, 0x47, 0x02, 0x0e, 0xc0, 0xe9, 0x91, 0x15,
+    0xc0, 0xe9, 0xf4, 0x4b, 0x6f, 0xc7, 0xc0, 0xea, 0x00, 0x03, 0xc0, 0xea,
+    0x20, 0x46, 0x09, 0x97, 0xc0, 0xea, 0x32, 0x46, 0x76, 0x52, 0xc0, 0xea,
+    0x56, 0x49, 0x3a, 0xd4, 0xc0, 0xea, 0x62, 0xc6, 0xd2, 0xcb, 0x00, 0x4f,
+    0xd1, 0xca, 0x9f, 0xae, 0x00, 0x4f, 0xd8, 0xc5, 0xd9, 0xb6, 0x0f, 0x9b,
+    0x89, 0x49, 0x03, 0x37, 0x40, 0xea, 0x6e, 0xc6, 0x00, 0x91, 0x01, 0x1b,
+    0xf1, 0xd8, 0x23, 0xc3, 0x0f, 0xa8, 0xa9, 0xc6, 0xcd, 0x19, 0x0f, 0xd6,
+    0x88, 0xcf, 0x62, 0x6a, 0x0f, 0xa3, 0x29, 0xce, 0x2f, 0xbc, 0x0f, 0xa3,
+    0x20, 0xc9, 0x18, 0x66, 0x01, 0x10, 0xc8, 0xd1, 0x51, 0xab, 0x0f, 0xab,
+    0x60, 0xce, 0x6f, 0x0e, 0x00, 0xd0, 0xf9, 0xc7, 0xc9, 0xd5, 0x00, 0xd0,
+    0xf1, 0x4b, 0x6f, 0xc7, 0xc0, 0xea, 0x74, 0x47, 0x02, 0x0e, 0x40, 0xea,
+    0x8a, 0x97, 0x00, 0xba, 0x99, 0x8b, 0x00, 0xba, 0x90, 0xc2, 0x00, 0xd0,
+    0x00, 0xba, 0x89, 0xc2, 0x0d, 0xf6, 0x00, 0xba, 0x81, 0xc2, 0x01, 0x4a,
+    0x00, 0xba, 0x79, 0xc2, 0x00, 0xdb, 0x00, 0xba, 0x71, 0xc2, 0x00, 0x39,
+    0x00, 0xba, 0x69, 0xc2, 0x19, 0x2c, 0x00, 0xba, 0x61, 0xc2, 0x01, 0xc3,
+    0x00, 0xba, 0x59, 0xc2, 0x01, 0x5d, 0x00, 0xba, 0x51, 0xc2, 0x00, 0xb0,
+    0x00, 0xba, 0x49, 0x10, 0xc0, 0xea, 0xea, 0xc2, 0x0e, 0x9a, 0x00, 0xba,
+    0x39, 0xc2, 0x01, 0x6f, 0x00, 0xba, 0x31, 0xc2, 0x01, 0x30, 0x00, 0xba,
+    0x21, 0xc2, 0x02, 0x2b, 0x00, 0xba, 0x19, 0x97, 0x00, 0xba, 0x11, 0x8b,
+    0x00, 0xba, 0x09, 0x83, 0x00, 0xba, 0x00, 0xcb, 0x8c, 0xa8, 0x0f, 0xa3,
+    0x81, 0xcb, 0x91, 0xdb, 0x0f, 0x98, 0x48, 0xc4, 0xe3, 0x0f, 0x0f, 0xa5,
+    0xe1, 0x95, 0x0f, 0xd3, 0x90, 0x4c, 0x83, 0x49, 0xc0, 0xea, 0xf4, 0x90,
+    0x0f, 0xcf, 0x00, 0x47, 0x34, 0x2f, 0xc0, 0xeb, 0x00, 0x47, 0x02, 0x0e,
+    0xc0, 0xeb, 0x2d, 0x18, 0xc0, 0xeb, 0x95, 0x45, 0x00, 0xba, 0xc0, 0xeb,
+    0xa1, 0x06, 0xc0, 0xeb, 0xc5, 0x4c, 0x11, 0xe2, 0x40, 0xeb, 0xd7, 0xdb,
+    0x15, 0x96, 0x01, 0x1c, 0x59, 0xc5, 0x1c, 0xae, 0x0f, 0xa4, 0xa1, 0xc3,
+    0x01, 0x5d, 0x00, 0x05, 0x30, 0x86, 0x0f, 0x9a, 0xf1, 0xd0, 0x5b, 0x62,
+    0x00, 0x04, 0x11, 0xca, 0xa7, 0x10, 0x0f, 0xc9, 0x88, 0x42, 0x00, 0xbf,
+    0xc0, 0xeb, 0xe7, 0x46, 0xd0, 0xd9, 0xc0, 0xeb, 0xf3, 0xcb, 0x97, 0x50,
+    0x0e, 0x82, 0x28, 0xc5, 0x87, 0x64, 0x0e, 0x81, 0x23, 0x00, 0xeb, 0xff,
+    0x46, 0xd1, 0xa5, 0xc0, 0xec, 0x03, 0x11, 0xc0, 0xec, 0x10, 0x14, 0xc0,
+    0xec, 0x25, 0x42, 0x00, 0xfe, 0xc0, 0xec, 0x31, 0xc6, 0xc8, 0x94, 0x0e,
+    0x83, 0x08, 0x14, 0xc0, 0xec, 0x3d, 0x12, 0xc0, 0xec, 0x49, 0x45, 0xd8,
+    0x4e, 0xc0, 0xec, 0x59, 0x10, 0x40, 0xec, 0x71, 0x16, 0xc0, 0xec, 0x7d,
+    0x48, 0xbc, 0x8a, 0xc0, 0xec, 0x92, 0xc5, 0xd9, 0x02, 0x0e, 0x81, 0x4b,
+    0x00, 0xec, 0xa4, 0x1b, 0xc0, 0xec, 0xaa, 0xc7, 0xc0, 0x9e, 0x0e, 0x80,
+    0xe8, 0x0b, 0xc0, 0xec, 0xb7, 0xc2, 0x42, 0xcd, 0x0e, 0x81, 0x79, 0xc5,
+    0xd7, 0x27, 0x0e, 0x80, 0x08, 0x42, 0x14, 0xda, 0xc0, 0xec, 0xd4, 0x12,
+    0x40, 0xec, 0xe0, 0x46, 0x3d, 0xd7, 0xc0, 0xec, 0xea, 0xda, 0x19, 0xfc,
+    0x0e, 0x86, 0x29, 0x49, 0xb5, 0x21, 0x40, 0xed, 0x15, 0x44, 0xdf, 0x57,
+    0xc0, 0xed, 0x27, 0x47, 0xc8, 0x2a, 0xc0, 0xed, 0x39, 0x44, 0x56, 0x2e,
+    0x40, 0xed, 0x45, 0x42, 0x02, 0x2f, 0xc0, 0xed, 0x4f, 0x15, 0xc0, 0xed,
+    0x59, 0xc6, 0xcd, 0xf1, 0x0e, 0x81, 0xf8, 0x10, 0xc0, 0xed, 0x65, 0x46,
+    0xd1, 0x69, 0xc0, 0xed, 0x71, 0xc7, 0xc7, 0x5f, 0x0e, 0x83, 0x41, 0xc9,
+    0xac, 0x9f, 0x0e, 0x83, 0x21, 0xc6, 0xd0, 0x9d, 0x0e, 0x82, 0xa9, 0xce,
+    0x6d, 0x08, 0x0e, 0x80, 0x70, 0x48, 0xbd, 0x2a, 0xc0, 0xed, 0x7d, 0xca,
+    0x9e, 0x32, 0x0e, 0x82, 0xb8, 0x14, 0xc0, 0xed, 0x9d, 0x07, 0xc0, 0xed,
+    0xa7, 0x0a, 0xc0, 0xed, 0xb9, 0xc6, 0xd1, 0x51, 0x0e, 0x81, 0x38, 0x07,
+    0xc0, 0xed, 0xc3, 0xc6, 0xc4, 0xab, 0x0e, 0x82, 0xe8, 0x49, 0xab, 0x64,
+    0xc0, 0xed, 0xcf, 0xc5, 0xda, 0x92, 0x0e, 0x82, 0xd9, 0x44, 0xdf, 0x27,
+    0xc0, 0xed, 0xdb, 0x46, 0xce, 0x7b, 0x40, 0xed, 0xe5, 0x42, 0x00, 0xba,
+    0xc0, 0xed, 0xf1, 0x42, 0x00, 0xb1, 0xc0, 0xed, 0xfb, 0x46, 0xce, 0xf3,
+    0xc0, 0xee, 0x07, 0x07, 0x40, 0xee, 0x13, 0x44, 0xe4, 0xaf, 0xc0, 0xee,
+    0x28, 0xc3, 0x4e, 0x10, 0x0e, 0x80, 0xc8, 0xc6, 0xcd, 0x1f, 0x0e, 0x81,
+    0xe1, 0xc4, 0xc8, 0x2c, 0x0e, 0x81, 0x28, 0xc2, 0x0d, 0x10, 0x08, 0xe3,
+    0x58, 0x9b, 0x08, 0xe3, 0x50, 0xc4, 0x18, 0x10, 0x08, 0xe3, 0x03, 0x00,
+    0xee, 0x32, 0xc2, 0x22, 0xcc, 0x08, 0xe2, 0xfa, 0x00, 0xee, 0x38, 0x0b,
+    0xc0, 0xee, 0x3e, 0x11, 0x40, 0xee, 0x4a, 0x0a, 0xc0, 0xee, 0x56, 0x19,
+    0xc0, 0xee, 0x62, 0xc2, 0x00, 0xc4, 0x08, 0xe3, 0x18, 0xc4, 0x26, 0x78,
+    0x08, 0xe2, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0xe2, 0xc1, 0x15, 0xc0, 0xee,
+    0x6c, 0x08, 0xc0, 0xee, 0x78, 0x16, 0xc0, 0xee, 0x84, 0xc3, 0x05, 0x14,
+    0x08, 0xe2, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0xe2, 0x80, 0xc7, 0x7a, 0x7f,
+    0x08, 0xe2, 0x01, 0xc7, 0x14, 0x39, 0x08, 0xe1, 0xe8, 0xc4, 0x1e, 0x97,
+    0x08, 0xe1, 0xf9, 0xc5, 0x40, 0xe7, 0x08, 0xe1, 0xf0, 0x97, 0x08, 0xe1,
+    0xd9, 0x8b, 0x08, 0xe1, 0xc9, 0x83, 0x08, 0xe1, 0x78, 0x8e, 0x08, 0xe1,
+    0xb1, 0x94, 0x08, 0xe1, 0xa2, 0x00, 0xee, 0x90, 0x97, 0x08, 0xe1, 0x98,
+    0x8b, 0x08, 0xe1, 0x88, 0x83, 0x08, 0xe1, 0x69, 0xc2, 0x0d, 0xf6, 0x08,
+    0xe1, 0x61, 0xc2, 0x00, 0xd0, 0x08, 0xe1, 0x58, 0x83, 0x08, 0xe1, 0x51,
+    0x47, 0xb2, 0x2e, 0x40, 0xee, 0x94, 0xc2, 0x00, 0xd0, 0x08, 0xe1, 0x29,
+    0x83, 0x08, 0xe1, 0x20, 0xc2, 0x00, 0xd0, 0x08, 0xe1, 0x19, 0x83, 0x08,
+    0xe1, 0x10, 0x83, 0x08, 0xe1, 0x09, 0xc2, 0x00, 0xc1, 0x08, 0xe0, 0xe1,
+    0xc2, 0x19, 0x2c, 0x08, 0xe0, 0xb9, 0xc2, 0x01, 0x30, 0x08, 0xe0, 0x90,
+    0xc2, 0x00, 0xd0, 0x08, 0xe1, 0x01, 0x83, 0x08, 0xe0, 0xf9, 0x06, 0x40,
+    0xee, 0x9f, 0xc2, 0x00, 0xd0, 0x08, 0xe0, 0xf1, 0x83, 0x08, 0xe0, 0xe9,
+    0x16, 0x40, 0xee, 0xa9, 0xc2, 0x00, 0xd0, 0x08, 0xe0, 0xb1, 0x83, 0x08,
+    0xe0, 0xa8, 0xc2, 0x00, 0xd0, 0x08, 0xe0, 0xa1, 0x83, 0x08, 0xe0, 0x98,
+    0xc2, 0x00, 0xd0, 0x08, 0xe0, 0x89, 0x83, 0x08, 0xe0, 0x80, 0xc2, 0x00,
+    0xd0, 0x08, 0xe0, 0x79, 0x83, 0x08, 0xe0, 0x70, 0x97, 0x08, 0xe0, 0x69,
+    0x8b, 0x08, 0xe0, 0x59, 0x83, 0x08, 0xe0, 0x08, 0x97, 0x08, 0xe0, 0x28,
+    0x8b, 0x08, 0xe0, 0x18, 0x45, 0x00, 0x49, 0xc0, 0xee, 0xb3, 0x46, 0x00,
+    0x2c, 0xc0, 0xee, 0xd9, 0x16, 0xc0, 0xef, 0x01, 0xce, 0x6b, 0x9c, 0x01,
+    0x38, 0x19, 0x45, 0x01, 0xce, 0xc0, 0xef, 0x0d, 0xd3, 0x3f, 0xe2, 0x01,
+    0x2c, 0x39, 0xd2, 0x4a, 0x75, 0x01, 0x2c, 0x29, 0x44, 0x05, 0x14, 0x40,
+    0xef, 0x25, 0x04, 0xc0, 0xef, 0x31, 0xc8, 0x0a, 0xff, 0x01, 0x02, 0x71,
+    0xc4, 0x02, 0x6d, 0x00, 0x02, 0xf9, 0xc6, 0x4a, 0x9f, 0x01, 0x72, 0x3b,
+    0x00, 0xef, 0x3d, 0xdb, 0x18, 0x1e, 0x01, 0x80, 0xf8, 0x46, 0x01, 0x4a,
+    0xc0, 0xef, 0x43, 0xc5, 0x32, 0xbb, 0x01, 0x3e, 0xe8, 0x46, 0x01, 0x4a,
+    0xc0, 0xef, 0x5b, 0x00, 0x40, 0xef, 0x73, 0xc7, 0x30, 0xf2, 0x01, 0x3e,
+    0x61, 0x47, 0xc3, 0x14, 0xc0, 0xef, 0x7f, 0xc3, 0x17, 0x99, 0x0f, 0xd4,
+    0xc0, 0x00, 0x40, 0xef, 0x85, 0x46, 0x00, 0x8b, 0x40, 0xef, 0x91, 0xc4,
+    0x15, 0xe7, 0x00, 0x00, 0x79, 0xc3, 0x05, 0x14, 0x00, 0x00, 0x70, 0x03,
+    0xc0, 0xef, 0xa9, 0x42, 0x00, 0xd0, 0xc0, 0xef, 0xb1, 0x14, 0xc0, 0xef,
+    0xbd, 0xc8, 0x6e, 0xdc, 0x01, 0x3e, 0xe1, 0x11, 0xc0, 0xef, 0xc9, 0x15,
+    0xc0, 0xef, 0xd5, 0x05, 0xc0, 0xef, 0xf8, 0x16, 0xc0, 0xf0, 0x13, 0x08,
+    0xc0, 0xf0, 0x27, 0x4a, 0x07, 0xbb, 0xc0, 0xf0, 0x31, 0xcb, 0x1a, 0x50,
+    0x00, 0x01, 0x43, 0x00, 0xf0, 0x3d, 0xe0, 0x05, 0xa7, 0x01, 0x16, 0x49,
+    0x42, 0x00, 0x58, 0xc0, 0xf0, 0x41, 0x19, 0xc0, 0xf0, 0x4d, 0x04, 0xc0,
+    0xf0, 0x5f, 0x0e, 0x40, 0xf0, 0x6b, 0x19, 0xc0, 0xf0, 0x77, 0x16, 0xc0,
+    0xf0, 0x86, 0xd0, 0x58, 0x62, 0x0f, 0xc1, 0xe1, 0xc5, 0x01, 0xa2, 0x01,
+    0x0c, 0x83, 0x00, 0xf0, 0x98, 0x14, 0xc0, 0xf0, 0xa2, 0xd1, 0x55, 0x30,
+    0x01, 0x0f, 0xe9, 0x06, 0xc0, 0xf0, 0xae, 0x15, 0xc0, 0xf0, 0xba, 0x0a,
+    0xc0, 0xf0, 0xc6, 0xcd, 0x7c, 0xa8, 0x01, 0x0e, 0x39, 0x04, 0xc0, 0xf0,
+    0xd0, 0xcf, 0x61, 0x4d, 0x01, 0x5a, 0x29, 0x08, 0xc0, 0xf0, 0xe2, 0xd7,
+    0x26, 0xbc, 0x0f, 0xc5, 0x20, 0x49, 0x01, 0xaa, 0xc0, 0xf0, 0xee, 0x15,
+    0xc0, 0xf1, 0x06, 0xdb, 0x16, 0x1d, 0x01, 0x37, 0x31, 0x49, 0x3c, 0xe1,
+    0xc0, 0xf1, 0x12, 0x47, 0x55, 0x85, 0x40, 0xf1, 0x2a, 0xca, 0x37, 0x4e,
+    0x01, 0x17, 0x31, 0xc5, 0x07, 0x62, 0x01, 0x13, 0x40, 0xc3, 0x02, 0xa3,
+    0x01, 0x16, 0xb1, 0xcd, 0x78, 0x30, 0x01, 0x53, 0xc9, 0xd3, 0x43, 0x39,
+    0x01, 0x53, 0xd8, 0x42, 0x00, 0x2a, 0xc0, 0xf1, 0x3f, 0xcc, 0x88, 0x7d,
+    0x01, 0x13, 0x30, 0x45, 0x00, 0xd5, 0xc0, 0xf1, 0x5a, 0x43, 0x02, 0x9c,
+    0x40, 0xf1, 0x70, 0xd4, 0x00, 0xd3, 0x01, 0x55, 0x40, 0x06, 0xc0, 0xf1,
+    0x7c, 0x16, 0xc0, 0xf1, 0x8c, 0x83, 0x00, 0xe1, 0x19, 0xc2, 0x01, 0x4a,
+    0x00, 0xe1, 0x11, 0x15, 0xc0, 0xf1, 0x9e, 0xc2, 0x02, 0x41, 0x00, 0xe0,
+    0xf9, 0x0a, 0xc0, 0xf1, 0xa8, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0xe1, 0xc2,
+    0x00, 0x39, 0x00, 0xe0, 0xd9, 0xc2, 0x19, 0x2c, 0x00, 0xe0, 0xd1, 0x0f,
+    0xc0, 0xf1, 0xb2, 0x04, 0xc0, 0xf1, 0xbc, 0x08, 0xc0, 0xf1, 0xc6, 0x12,
+    0xc0, 0xf1, 0xd0, 0x10, 0xc0, 0xf1, 0xe0, 0xc2, 0x25, 0x3b, 0x00, 0xe0,
+    0x41, 0x05, 0xc0, 0xf1, 0xf0, 0x09, 0xc0, 0xf1, 0xfa, 0x0d, 0x40, 0xf2,
+    0x04, 0xc4, 0x26, 0x78, 0x00, 0xe2, 0x49, 0xc5, 0x06, 0xdb, 0x00, 0xe2,
+    0x41, 0x15, 0xc0, 0xf2, 0x14, 0x08, 0xc0, 0xf2, 0x20, 0x16, 0xc0, 0xf2,
+    0x2c, 0xc3, 0x05, 0x14, 0x00, 0xe2, 0x09, 0xc4, 0x15, 0xe7, 0x00, 0xe2,
+    0x00, 0x16, 0xc0, 0xf2, 0x38, 0xc6, 0xc0, 0x98, 0x00, 0xe1, 0xe9, 0xd2,
+    0x4e, 0x0b, 0x00, 0xe1, 0xe0, 0x44, 0x00, 0xbb, 0xc0, 0xf2, 0x47, 0x50,
+    0x5c, 0xf2, 0x40, 0xf2, 0x53, 0x8d, 0x00, 0xe1, 0x6b, 0x00, 0xf2, 0x5f,
+    0x90, 0x00, 0xe1, 0x83, 0x00, 0xf2, 0x65, 0x96, 0x00, 0xe1, 0x99, 0x94,
+    0x00, 0xe1, 0x91, 0x92, 0x00, 0xe1, 0x89, 0x8e, 0x00, 0xe1, 0x79, 0x8f,
+    0x00, 0xe1, 0x70, 0x87, 0x00, 0xe1, 0x61, 0x97, 0x00, 0xe1, 0x53, 0x00,
+    0xf2, 0x6b, 0x91, 0x00, 0xe1, 0x43, 0x00, 0xf2, 0x6f, 0x8b, 0x00, 0xe1,
+    0x39, 0xc2, 0x04, 0xc6, 0x00, 0xe1, 0x30, 0x00, 0xc0, 0xf2, 0x73, 0xc4,
+    0x03, 0x0e, 0x01, 0x30, 0x3a, 0x00, 0xf2, 0xa7, 0x1b, 0xc0, 0xf2, 0xb0,
+    0xc2, 0x01, 0x5d, 0x05, 0x26, 0x81, 0x12, 0xc0, 0xf2, 0xba, 0x06, 0xc0,
+    0xf2, 0xc4, 0x16, 0xc0, 0xf2, 0xce, 0x09, 0xc0, 0xf2, 0xe2, 0x0d, 0xc0,
+    0xf2, 0xec, 0xc2, 0x25, 0x3b, 0x05, 0x26, 0xc9, 0x05, 0xc0, 0xf2, 0xf6,
+    0xc2, 0x01, 0xc3, 0x05, 0x26, 0xf9, 0x10, 0xc0, 0xf3, 0x00, 0xc2, 0x00,
+    0xdb, 0x05, 0x27, 0x09, 0x15, 0xc0, 0xf3, 0x0a, 0x1c, 0xc0, 0xf3, 0x14,
+    0x0a, 0xc0, 0xf3, 0x1e, 0xc2, 0x8d, 0x8f, 0x05, 0x27, 0x39, 0xc2, 0x00,
+    0x87, 0x05, 0x27, 0x49, 0xc2, 0x01, 0x4a, 0x05, 0x27, 0x51, 0x83, 0x05,
+    0x27, 0x73, 0x00, 0xf3, 0x28, 0x87, 0x05, 0x27, 0x83, 0x00, 0xf3, 0x2c,
+    0x8b, 0x05, 0x27, 0x91, 0x91, 0x05, 0x27, 0x9b, 0x00, 0xf3, 0x30, 0x97,
+    0x05, 0x27, 0xa2, 0x00, 0xf3, 0x34, 0xc5, 0x0a, 0x8a, 0x05, 0x27, 0xf1,
+    0xc9, 0x11, 0xf6, 0x05, 0x27, 0xf8, 0x00, 0xc0, 0xf3, 0x3c, 0x43, 0x02,
+    0xe8, 0x40, 0xf3, 0x57, 0xcd, 0x7b, 0xd8, 0x0f, 0xac, 0x39, 0xc7, 0x00,
+    0x90, 0x0f, 0xa8, 0xb8, 0x46, 0x09, 0x97, 0xc0, 0xf3, 0x63, 0xcd, 0x2c,
+    0xb2, 0x00, 0xca, 0x29, 0xd0, 0x0f, 0x09, 0x00, 0xca, 0x21, 0x15, 0xc0,
+    0xf3, 0x87, 0x45, 0x34, 0x6f, 0xc0, 0xf3, 0x99, 0x47, 0x02, 0x0e, 0x40,
+    0xf3, 0xa5, 0x85, 0x08, 0x49, 0xc9, 0x90, 0x08, 0x49, 0x5b, 0x00, 0xf3,
+    0xf4, 0x8e, 0x08, 0x49, 0x4b, 0x00, 0xf3, 0xf8, 0x87, 0x08, 0x49, 0x23,
+    0x00, 0xf3, 0xfc, 0x83, 0x08, 0x49, 0x03, 0x00, 0xf4, 0x00, 0x96, 0x08,
+    0x49, 0x7b, 0x00, 0xf4, 0x04, 0x95, 0x08, 0x49, 0x9b, 0x00, 0xf4, 0x08,
+    0x93, 0x08, 0x49, 0x91, 0x88, 0x08, 0x49, 0x89, 0x97, 0x08, 0x49, 0x81,
+    0x94, 0x08, 0x49, 0x69, 0x91, 0x08, 0x49, 0x61, 0x8f, 0x08, 0x49, 0x51,
+    0x8d, 0x08, 0x49, 0x41, 0x9b, 0x08, 0x49, 0x39, 0x8b, 0x08, 0x49, 0x31,
+    0x98, 0x08, 0x49, 0x29, 0x86, 0x08, 0x49, 0x19, 0x89, 0x08, 0x49, 0x11,
+    0x84, 0x08, 0x49, 0x08, 0x90, 0x08, 0x14, 0xc8, 0x90, 0x08, 0x14, 0xd0,
+    0x8a, 0x08, 0x14, 0x18, 0x8a, 0x08, 0x14, 0x49, 0x96, 0x08, 0x14, 0xc0,
+    0x8d, 0x08, 0x14, 0xa0, 0x8f, 0x08, 0x14, 0x80, 0x90, 0x08, 0x14, 0x88,
+    0x00, 0xc0, 0xf4, 0x0c, 0xc6, 0xc1, 0xfd, 0x01, 0x55, 0x5a, 0x00, 0xf4,
+    0x48, 0x45, 0x03, 0x14, 0xc0, 0xf4, 0x4e, 0x56, 0x2c, 0xde, 0x40, 0xf4,
+    0x58, 0x15, 0xc0, 0xf4, 0x9f, 0xd5, 0x32, 0xd5, 0x00, 0x14, 0xb3, 0x00,
+    0xf4, 0xb4, 0x42, 0x01, 0x19, 0xc0, 0xf4, 0xba, 0x03, 0xc0, 0xf4, 0xc9,
+    0xd8, 0x21, 0x0b, 0x00, 0xe9, 0x21, 0xcc, 0x23, 0x33, 0x00, 0x14, 0xa3,
+    0x00, 0xf4, 0xd5, 0xdb, 0x17, 0xb2, 0x00, 0x14, 0xa9, 0x42, 0x01, 0x2d,
+    0xc0, 0xf4, 0xdb, 0xc2, 0x1d, 0xc1, 0x00, 0x0d, 0x31, 0xcf, 0x65, 0xfd,
+    0x00, 0x0d, 0xd9, 0xc4, 0x95, 0x50, 0x00, 0x0d, 0xf9, 0xcc, 0x83, 0xe5,
+    0x00, 0x0e, 0x01, 0xcd, 0x79, 0x0d, 0x00, 0x0e, 0x08, 0xc4, 0x0d, 0x21,
+    0x01, 0x38, 0xe9, 0x48, 0x0b, 0x18, 0x40, 0xf4, 0xe7, 0xca, 0xa6, 0xe8,
+    0x05, 0x3f, 0xb9, 0x49, 0x11, 0x74, 0xc0, 0xf4, 0xf3, 0x0b, 0xc0, 0xf4,
+    0xfb, 0xc9, 0xa8, 0x9d, 0x05, 0x3f, 0xf8, 0xc9, 0xb2, 0xa2, 0x0f, 0x98,
+    0xe1, 0xc6, 0x00, 0x91, 0x0f, 0x98, 0xb8, 0x0d, 0xc0, 0xf5, 0x07, 0x12,
+    0xc0, 0xf5, 0x0f, 0x10, 0xc0, 0xf5, 0x1f, 0xc2, 0x00, 0x99, 0x00, 0x74,
+    0x41, 0x15, 0xc0, 0xf5, 0x2f, 0xc2, 0x00, 0x58, 0x00, 0x74, 0xa1, 0x16,
+    0xc0, 0xf5, 0x3b, 0xc2, 0x00, 0x6b, 0x00, 0x74, 0xd1, 0x43, 0xc9, 0xe0,
+    0xc0, 0xf5, 0x45, 0xc2, 0x00, 0xa2, 0x00, 0x75, 0x09, 0xc2, 0x42, 0xcd,
+    0x00, 0x75, 0x11, 0xc2, 0x00, 0x79, 0x00, 0x75, 0x19, 0xc2, 0x01, 0xc8,
+    0x00, 0x75, 0x2b, 0x00, 0xf5, 0x55, 0xc2, 0x02, 0xa0, 0x00, 0x75, 0x39,
+    0x43, 0x60, 0xe8, 0xc0, 0xf5, 0x5b, 0x91, 0x00, 0x75, 0x68, 0x83, 0x00,
+    0x75, 0x83, 0x00, 0xf5, 0x67, 0x45, 0xdb, 0x96, 0xc0, 0xf5, 0x77, 0x8b,
+    0x00, 0x75, 0xa3, 0x00, 0xf5, 0x83, 0x9b, 0x00, 0x75, 0xb3, 0x00, 0xf5,
+    0x87, 0x97, 0x00, 0x75, 0xc3, 0x00, 0xf5, 0x8b, 0x87, 0x00, 0x76, 0x03,
+    0x00, 0xf5, 0x8f, 0x91, 0x00, 0x76, 0x10, 0xcf, 0x67, 0xfb, 0x00, 0x75,
+    0xd1, 0x4e, 0x6f, 0xc4, 0x40, 0xf5, 0x93, 0xc2, 0x13, 0x4c, 0x00, 0x76,
+    0x41, 0x16, 0xc0, 0xf5, 0x9f, 0xc6, 0xcd, 0x31, 0x00, 0x76, 0x58, 0xc4,
+    0x15, 0xe7, 0x00, 0x76, 0x81, 0xc3, 0x05, 0x14, 0x00, 0x76, 0x89, 0x16,
+    0xc0, 0xf5, 0xa9, 0x08, 0xc0, 0xf5, 0xb5, 0x15, 0xc0, 0xf5, 0xc1, 0xc5,
+    0x06, 0xdb, 0x00, 0x76, 0xc1, 0xc4, 0x26, 0x78, 0x00, 0x76, 0xc8, 0xc2,
+    0x00, 0x10, 0x00, 0x76, 0xe1, 0xc2, 0x00, 0xa2, 0x00, 0x76, 0xe8, 0x16,
+    0xc0, 0xf5, 0xcd, 0x4f, 0x60, 0x6c, 0xc0, 0xf5, 0xd9, 0x4f, 0x01, 0xf3,
+    0xc0, 0xf5, 0xe5, 0xda, 0x1a, 0x7e, 0x01, 0x3a, 0x81, 0xc6, 0xcd, 0x8b,
+    0x01, 0x38, 0x81, 0xd5, 0x37, 0x6d, 0x01, 0x2e, 0xe9, 0x43, 0x05, 0xb2,
+    0x40, 0xf5, 0xf1, 0x16, 0xc0, 0xf5, 0xf7, 0x4f, 0x60, 0x6c, 0xc0, 0xf6,
+    0x03, 0xcf, 0x68, 0x37, 0x01, 0x3e, 0xa1, 0xd5, 0x37, 0x6d, 0x01, 0x2e,
+    0xe1, 0x44, 0x20, 0xe8, 0x40, 0xf6, 0x0f, 0x0e, 0xc0, 0xf6, 0x15, 0x4f,
+    0x2c, 0x4a, 0x40, 0xf6, 0x21, 0x48, 0x01, 0xd3, 0xc0, 0xf6, 0x27, 0xc5,
+    0x06, 0xe2, 0x01, 0x2c, 0x03, 0x00, 0xf6, 0x31, 0xc6, 0x02, 0xd1, 0x01,
+    0x2f, 0x01, 0xcc, 0x01, 0xdb, 0x0f, 0xdc, 0x70, 0xcc, 0x06, 0xdb, 0x01,
+    0x2c, 0xa1, 0xcd, 0x15, 0x02, 0x0f, 0xdc, 0x10, 0xdb, 0x14, 0xf4, 0x0f,
+    0xdb, 0x69, 0x45, 0x02, 0xde, 0x40, 0xf6, 0x37, 0xc5, 0x01, 0xa2, 0x01,
+    0x0f, 0x3b, 0x00, 0xf6, 0x43, 0xcc, 0x82, 0x35, 0x01, 0x0f, 0x72, 0x00,
+    0xf6, 0x47, 0x42, 0x00, 0x2c, 0xc0, 0xf6, 0x4d, 0x42, 0x02, 0xa0, 0x40,
+    0xf6, 0x59, 0xcf, 0x5b, 0xc3, 0x0f, 0xc2, 0x89, 0xcc, 0x88, 0xdd, 0x0f,
+    0xc1, 0xc8, 0xc4, 0x01, 0xa3, 0x01, 0x0c, 0x8b, 0x00, 0xf6, 0x65, 0xc5,
+    0xdb, 0x50, 0x01, 0x70, 0xa8, 0xcb, 0x82, 0xba, 0x01, 0x0f, 0x09, 0xcb,
+    0x82, 0x36, 0x01, 0x0e, 0x88, 0x51, 0x01, 0x51, 0xc0, 0xf6, 0x69, 0x45,
+    0x11, 0x3a, 0x40, 0xf6, 0x75, 0xc5, 0x01, 0xa2, 0x01, 0x58, 0x31, 0xd3,
+    0x43, 0xe4, 0x01, 0x5c, 0x48, 0xc8, 0x2e, 0x20, 0x0f, 0xb7, 0x41, 0xcc,
+    0x4e, 0x35, 0x0f, 0xa9, 0xe0, 0xd0, 0x5d, 0x52, 0x01, 0x2f, 0x71, 0xcf,
+    0x66, 0x66, 0x01, 0x2f, 0x68, 0xd2, 0x4c, 0xd9, 0x01, 0x3e, 0xf8, 0xc4,
+    0x01, 0x9b, 0x01, 0x18, 0x1b, 0x00, 0xf6, 0x81, 0xcf, 0x6a, 0xda, 0x01,
+    0x4d, 0xe8, 0xcb, 0x01, 0xfc, 0x01, 0x0f, 0x99, 0xcc, 0x82, 0x35, 0x01,
+    0x0e, 0xa9, 0xc5, 0x01, 0xa2, 0x01, 0x0c, 0xab, 0x00, 0xf6, 0x85, 0xcb,
+    0x94, 0x22, 0x01, 0x58, 0x69, 0xd5, 0x01, 0x92, 0x01, 0x5b, 0x29, 0xd0,
+    0x5b, 0xc2, 0x0f, 0xc2, 0xc8, 0x4f, 0x66, 0x48, 0xc0, 0xf6, 0x8b, 0x50,
+    0x5c, 0xd2, 0x40, 0xf6, 0x97, 0x00, 0x40, 0xf6, 0xa3, 0xca, 0x1b, 0x09,
+    0x00, 0x00, 0xf9, 0xc9, 0x6b, 0xaf, 0x01, 0x5f, 0xd0, 0xc3, 0xa1, 0xa2,
+    0x08, 0x1c, 0x01, 0xc2, 0x00, 0x74, 0x08, 0x1c, 0x98, 0xc4, 0xe2, 0x57,
+    0x08, 0x1c, 0x11, 0xc4, 0x92, 0x76, 0x08, 0x1c, 0xc8, 0xc2, 0x00, 0xd0,
+    0x08, 0x1c, 0x19, 0xc2, 0x0f, 0x9b, 0x08, 0x1c, 0x58, 0xc4, 0xdb, 0x4c,
+    0x08, 0x1c, 0x21, 0xc3, 0x01, 0xce, 0x08, 0x1c, 0x78, 0xc2, 0x01, 0x6f,
+    0x08, 0x1c, 0x40, 0xc3, 0x04, 0x87, 0x08, 0x1c, 0x39, 0x97, 0x08, 0x1c,
+    0x88, 0xc2, 0x00, 0x3d, 0x08, 0x1c, 0x49, 0xc5, 0xd6, 0xaf, 0x08, 0x1c,
+    0xc1, 0x91, 0x08, 0x1c, 0xd0, 0xc3, 0x11, 0xef, 0x08, 0x1c, 0x61, 0x03,
+    0xc0, 0xf6, 0xb5, 0xc2, 0x06, 0x62, 0x08, 0x1c, 0xe8, 0x0a, 0xc0, 0xf6,
+    0xc1, 0x07, 0xc0, 0xf6, 0xcd, 0x19, 0xc0, 0xf6, 0xdf, 0x15, 0xc0, 0xf6,
+    0xf1, 0x46, 0x06, 0x1d, 0xc0, 0xf7, 0x0b, 0x0e, 0xc0, 0xf7, 0x17, 0x16,
+    0xc0, 0xf7, 0x2d, 0x04, 0xc0, 0xf7, 0x3f, 0x42, 0x02, 0xae, 0xc0, 0xf7,
+    0x4b, 0x05, 0xc0, 0xf7, 0x57, 0x06, 0xc0, 0xf7, 0x6c, 0x14, 0xc0, 0xf7,
+    0x7c, 0x0f, 0xc0, 0xf7, 0x88, 0xc9, 0x60, 0xf3, 0x01, 0x3c, 0xa9, 0xcc,
+    0x07, 0xbb, 0x01, 0x3a, 0xd1, 0x03, 0xc0, 0xf7, 0x94, 0x11, 0xc0, 0xf7,
+    0xa6, 0x08, 0xc0, 0xf7, 0xb8, 0xcb, 0x58, 0xc7, 0x01, 0x38, 0xd1, 0xd4,
+    0x10, 0xc9, 0x0f, 0xb3, 0xc8, 0xc5, 0xaf, 0x07, 0x0f, 0xd5, 0x33, 0x00,
+    0xf7, 0xc4, 0xc5, 0x36, 0xb7, 0x0f, 0x9d, 0x38, 0x42, 0x00, 0x30, 0xc0,
+    0xf7, 0xca, 0xcf, 0x6b, 0x34, 0x0f, 0xb2, 0x48, 0xd3, 0x43, 0x85, 0x01,
+    0x36, 0x89, 0xc7, 0x00, 0x90, 0x01, 0x1c, 0x40, 0x42, 0x36, 0xa2, 0xc0,
+    0xf7, 0xdc, 0x42, 0x2f, 0xf9, 0xc0, 0xf7, 0xf4, 0x42, 0x14, 0x7d, 0xc0,
+    0xf8, 0x10, 0x42, 0x28, 0x5b, 0xc0, 0xf8, 0x20, 0x42, 0x01, 0x99, 0x40,
+    0xf8, 0x38, 0x42, 0x28, 0x5b, 0xc0, 0xf8, 0x48, 0x42, 0x01, 0x99, 0xc0,
+    0xf8, 0x68, 0x42, 0x36, 0xa2, 0xc0, 0xf8, 0x84, 0x42, 0x2f, 0xf9, 0xc0,
+    0xf8, 0x90, 0x42, 0x14, 0x7d, 0x40, 0xf8, 0xac, 0x42, 0x28, 0x5b, 0xc0,
+    0xf8, 0xd3, 0x42, 0x01, 0x99, 0xc0, 0xf8, 0xe7, 0x42, 0x36, 0xa2, 0xc0,
+    0xf9, 0x05, 0x42, 0x2f, 0xf9, 0xc0, 0xf9, 0x11, 0x42, 0x14, 0x7d, 0xc0,
+    0xf9, 0x33, 0x47, 0xc1, 0x15, 0x40, 0xf9, 0x57, 0x42, 0x28, 0x5b, 0xc0,
+    0xf9, 0x5f, 0x42, 0x01, 0x99, 0xc0, 0xf9, 0x71, 0x42, 0x36, 0xa2, 0xc0,
+    0xf9, 0x89, 0x42, 0x2f, 0xf9, 0xc0, 0xf9, 0xa5, 0x42, 0x14, 0x7d, 0x40,
+    0xf9, 0xc5, 0xa0, 0x0d, 0x80, 0xb1, 0x9f, 0x0d, 0x80, 0xa9, 0x9e, 0x0d,
+    0x80, 0xa0, 0xa3, 0x0d, 0x80, 0x99, 0xa2, 0x0d, 0x80, 0x91, 0xa1, 0x0d,
+    0x80, 0x89, 0xa0, 0x0d, 0x80, 0x81, 0x9f, 0x0d, 0x80, 0x79, 0x9e, 0x0d,
+    0x80, 0x08, 0xa2, 0x0d, 0x80, 0x71, 0xa1, 0x0d, 0x80, 0x69, 0xa0, 0x0d,
+    0x80, 0x61, 0x9f, 0x0d, 0x80, 0x59, 0x9e, 0x0d, 0x80, 0x50, 0xa1, 0x0d,
+    0x80, 0x49, 0xa0, 0x0d, 0x80, 0x41, 0x9f, 0x0d, 0x80, 0x39, 0x9e, 0x0d,
+    0x80, 0x30, 0xc2, 0x02, 0xa0, 0x0d, 0x80, 0x29, 0xa0, 0x0d, 0x80, 0x21,
+    0x9f, 0x0d, 0x80, 0x19, 0x9e, 0x0d, 0x80, 0x10, 0x42, 0x28, 0x5b, 0xc0,
+    0xf9, 0xf2, 0x42, 0x01, 0x99, 0xc0, 0xfa, 0x0e, 0x42, 0x2f, 0xf9, 0xc0,
+    0xfa, 0x1e, 0x42, 0x14, 0x7d, 0x40, 0xfa, 0x32, 0x42, 0x14, 0x7d, 0xc0,
+    0xfa, 0x46, 0x42, 0x36, 0xa2, 0xc0, 0xfa, 0x60, 0x42, 0x28, 0x5b, 0x40,
+    0xfa, 0x70, 0x42, 0x28, 0x5b, 0xc0, 0xfa, 0x88, 0x42, 0x01, 0x99, 0xc0,
+    0xfa, 0xa0, 0x42, 0x36, 0xa2, 0xc0, 0xfa, 0xae, 0x42, 0x2f, 0xf9, 0xc0,
+    0xfa, 0xbe, 0x42, 0x14, 0x7d, 0x40, 0xfa, 0xda, 0x42, 0x28, 0x5b, 0xc0,
+    0xfa, 0xf6, 0x42, 0x01, 0x99, 0xc0, 0xfb, 0x14, 0x42, 0x2f, 0xf9, 0xc0,
+    0xfb, 0x38, 0x42, 0x14, 0x7d, 0xc0, 0xfb, 0x54, 0x42, 0x36, 0xa2, 0x40,
+    0xfb, 0x64, 0x42, 0x28, 0x5b, 0xc0, 0xfb, 0x7a, 0x42, 0x01, 0x99, 0xc0,
+    0xfb, 0x96, 0x42, 0x36, 0xa2, 0xc0, 0xfb, 0xaa, 0x42, 0x2f, 0xf9, 0xc0,
+    0xfb, 0xca, 0x42, 0x14, 0x7d, 0x40, 0xfb, 0xe2, 0x48, 0x19, 0x9b, 0xc0,
+    0xfc, 0x02, 0x46, 0x02, 0x0f, 0x40, 0xfc, 0x0e, 0x45, 0x12, 0x5c, 0xc0,
+    0xfc, 0xa4, 0x4b, 0x11, 0xe3, 0x40, 0xfc, 0xd4, 0xc9, 0xaa, 0x3b, 0x00,
+    0x2e, 0x29, 0xc9, 0xb0, 0xbc, 0x00, 0x2e, 0x21, 0xcd, 0x79, 0x00, 0x00,
+    0x2d, 0x78, 0x1c, 0xc0, 0xfc, 0xf2, 0x06, 0xc0, 0xfc, 0xfc, 0xc4, 0xe1,
+    0x1b, 0x00, 0x2d, 0x61, 0xc3, 0x11, 0x14, 0x00, 0x2d, 0x59, 0x42, 0x0c,
+    0x43, 0xc0, 0xfd, 0x08, 0x16, 0xc0, 0xfd, 0x14, 0x42, 0x0f, 0x9a, 0xc0,
+    0xfd, 0x1e, 0xcc, 0x89, 0x6d, 0x00, 0x2d, 0x11, 0x42, 0x00, 0xb0, 0xc0,
+    0xfd, 0x2a, 0xc5, 0x48, 0x14, 0x00, 0x2c, 0xb9, 0x15, 0xc0, 0xfd, 0x36,
+    0xc7, 0xc9, 0xf1, 0x00, 0x2c, 0x89, 0x43, 0x09, 0x3b, 0xc0, 0xfd, 0x42,
+    0x0f, 0x40, 0xfd, 0x51, 0x43, 0x01, 0x7f, 0xc0, 0xfd, 0x66, 0xc7, 0x0c,
+    0x96, 0x02, 0x6e, 0x48, 0x0b, 0xc0, 0xfd, 0x96, 0xc7, 0xc7, 0xe4, 0x02,
+    0x6e, 0xf9, 0xd5, 0x35, 0xc9, 0x02, 0x6f, 0x19, 0x07, 0x40, 0xfd, 0xa2,
+    0xc6, 0x78, 0x44, 0x02, 0x6e, 0x21, 0xd2, 0x49, 0xd3, 0x02, 0x6e, 0x88,
+    0x10, 0xc0, 0xfd, 0xb4, 0xcc, 0x84, 0x39, 0x02, 0x6f, 0x58, 0x45, 0x03,
+    0x14, 0xc0, 0xfd, 0xc0, 0xc9, 0xaf, 0x54, 0x02, 0x6e, 0x59, 0xce, 0x6e,
+    0x82, 0x02, 0x6e, 0xb0, 0xc4, 0x12, 0x38, 0x02, 0x6e, 0x51, 0xc7, 0xc9,
+    0x18, 0x02, 0x6f, 0x11, 0xcd, 0x7e, 0x7c, 0x02, 0x6f, 0x68, 0xc9, 0xb4,
+    0xfd, 0x02, 0x6e, 0x61, 0xc8, 0xb6, 0x0a, 0x02, 0x6e, 0x80, 0x14, 0xc0,
+    0xfd, 0xcc, 0xd1, 0x55, 0xc9, 0x02, 0x6f, 0x60, 0xc5, 0xdb, 0x82, 0x02,
+    0x6e, 0x71, 0xcb, 0x93, 0xbf, 0x02, 0x6e, 0xd0, 0xc7, 0xc9, 0x73, 0x02,
+    0x6e, 0x91, 0xc8, 0xb6, 0x12, 0x02, 0x6f, 0xb1, 0xcf, 0x63, 0xb4, 0x02,
+    0x6f, 0xf0, 0xcd, 0x77, 0x12, 0x02, 0x6e, 0xa1, 0xcb, 0x98, 0x79, 0x02,
+    0x6f, 0x51, 0xd0, 0x5e, 0x72, 0x02, 0x6f, 0xf8, 0x16, 0xc0, 0xfd, 0xd8,
+    0xc8, 0xba, 0x72, 0x02, 0x6f, 0x80, 0x10, 0xc0, 0xfd, 0xe4, 0xc7, 0xc8,
+    0x7e, 0x02, 0x6e, 0xf1, 0xc6, 0xcc, 0x17, 0x02, 0x6f, 0x48, 0x42, 0x02,
+    0xaf, 0xc0, 0xfd, 0xf0, 0xca, 0x9b, 0x30, 0x02, 0x6f, 0x30, 0x51, 0x54,
+    0x86, 0xc0, 0xfd, 0xfc, 0x04, 0xc0, 0xfe, 0x1a, 0xd5, 0x37, 0x2e, 0x01,
+    0x35, 0x49, 0x4a, 0xa5, 0x4e, 0xc0, 0xfe, 0x26, 0xce, 0x71, 0x30, 0x01,
+    0x1d, 0x79, 0xc8, 0x22, 0x83, 0x01, 0x01, 0x31, 0x16, 0x40, 0xfe, 0x36,
+    0x00, 0x40, 0xfe, 0x42, 0xc7, 0xc1, 0x77, 0x01, 0x33, 0x41, 0xc8, 0xbd,
+    0xba, 0x01, 0x30, 0xa9, 0xc6, 0xcd, 0x19, 0x0f, 0x99, 0xb1, 0xc3, 0xcd,
+    0x94, 0x0f, 0x99, 0x68, 0xd2, 0x4a, 0xe1, 0x01, 0x1f, 0x98, 0x00, 0x40,
+    0xfe, 0x4e, 0xd0, 0x0d, 0xaa, 0x0f, 0xb3, 0x48, 0x83, 0x0f, 0xd5, 0x61,
+    0xc8, 0xbd, 0xfa, 0x0f, 0xa1, 0xc8, 0x45, 0x02, 0x9a, 0x40, 0xfe, 0x5d,
+    0x42, 0x01, 0x5d, 0xc0, 0xfe, 0x6f, 0xc5, 0xc4, 0x0a, 0x0f, 0xc8, 0xe9,
+    0x4c, 0x83, 0x79, 0x40, 0xfe, 0x79, 0x46, 0x09, 0x97, 0xc0, 0xfe, 0x85,
+    0x45, 0x00, 0xba, 0xc0, 0xfe, 0xa9, 0x45, 0x01, 0xc3, 0xc0, 0xfe, 0xb5,
+    0x46, 0x34, 0x6f, 0xc0, 0xfe, 0xc1, 0x47, 0x02, 0x0e, 0x40, 0xfe, 0xd5,
+    0xcd, 0x7a, 0x86, 0x00, 0xb9, 0xa1, 0x4b, 0x6f, 0xc7, 0xc0, 0xff, 0x3f,
+    0x47, 0x02, 0x0e, 0x40, 0xff, 0x47, 0x43, 0x4e, 0xaf, 0xc0, 0xff, 0xa5,
+    0x4d, 0x7b, 0xe5, 0x40, 0xff, 0xc7, 0x47, 0x34, 0x2f, 0xc0, 0xff, 0xe5,
+    0x47, 0x02, 0x0e, 0x40, 0xff, 0xf8, 0xc9, 0x11, 0xf6, 0x07, 0xfb, 0x09,
+    0xc5, 0x0a, 0x8a, 0x07, 0xfb, 0x20, 0xcf, 0x69, 0x63, 0x07, 0xfb, 0x11,
+    0xcb, 0x03, 0xbc, 0x07, 0xff, 0x48, 0xcf, 0x69, 0x63, 0x07, 0xfb, 0x19,
+    0xcb, 0x03, 0xbc, 0x07, 0xff, 0x58, 0x00, 0xc1, 0x00, 0x55, 0xde, 0x0d,
+    0xd8, 0x07, 0xfb, 0x80, 0xc6, 0x92, 0x0c, 0x07, 0xfd, 0x01, 0x47, 0x02,
+    0x0e, 0x41, 0x00, 0x6d, 0xcb, 0x90, 0x91, 0x0f, 0xb4, 0x23, 0x01, 0x00,
+    0xc7, 0xcb, 0x8d, 0xe7, 0x0f, 0xa3, 0x00, 0xcc, 0x80, 0x9d, 0x01, 0x35,
+    0x09, 0xd1, 0x54, 0xdb, 0x0f, 0xa8, 0x30, 0x83, 0x01, 0x82, 0x13, 0x01,
+    0x00, 0xcd, 0x15, 0xc1, 0x00, 0xd3, 0x8b, 0x01, 0x82, 0x21, 0x97, 0x01,
+    0x82, 0x31, 0x87, 0x01, 0x82, 0x41, 0x91, 0x01, 0x82, 0x51, 0x0d, 0xc1,
+    0x00, 0xed, 0x09, 0xc1, 0x01, 0x01, 0x1c, 0xc1, 0x01, 0x15, 0x16, 0xc1,
+    0x01, 0x29, 0x06, 0xc1, 0x01, 0x3d, 0x90, 0x01, 0x84, 0x9b, 0x01, 0x01,
+    0x51, 0x0a, 0xc1, 0x01, 0x65, 0x04, 0xc1, 0x01, 0x79, 0x12, 0xc1, 0x01,
+    0x8d, 0x0f, 0xc1, 0x01, 0xa1, 0x1b, 0xc1, 0x01, 0xb5, 0x14, 0xc1, 0x01,
+    0xc1, 0x19, 0xc1, 0x01, 0xd5, 0xc2, 0x5d, 0xb3, 0x01, 0x84, 0xa0, 0x00,
+    0xc1, 0x01, 0xe5, 0xcb, 0x9a, 0x52, 0x01, 0x01, 0x39, 0xc6, 0x89, 0xd3,
+    0x00, 0x01, 0x68, 0x43, 0x01, 0xd8, 0xc1, 0x01, 0xf1, 0x44, 0x00, 0xde,
+    0x41, 0x02, 0x0f, 0xc4, 0x25, 0xd5, 0x01, 0x03, 0x21, 0xc9, 0x1b, 0x0a,
+    0x01, 0x03, 0x19, 0xc5, 0x03, 0x4d, 0x01, 0x03, 0x10, 0xcf, 0x67, 0x29,
+    0x0f, 0xa9, 0x01, 0xc7, 0x67, 0x31, 0x0f, 0xa9, 0x21, 0xcd, 0x7d, 0x10,
+    0x0f, 0xa9, 0x08, 0x0e, 0xc1, 0x02, 0x37, 0xc6, 0xcd, 0x61, 0x01, 0x15,
+    0xd1, 0xc7, 0x00, 0x40, 0x01, 0x11, 0x4b, 0x01, 0x02, 0x43, 0xc6, 0x10,
+    0xce, 0x01, 0x01, 0xe9, 0xcb, 0x33, 0x33, 0x01, 0x51, 0xe0, 0x00, 0x41,
+    0x02, 0x47, 0x46, 0x62, 0x28, 0xc1, 0x02, 0x57, 0x47, 0xc5, 0x98, 0x41,
+    0x02, 0x63, 0xda, 0x1c, 0x38, 0x01, 0x4e, 0xf0, 0x15, 0xc1, 0x02, 0x6f,
+    0xcb, 0x99, 0xd9, 0x0f, 0xa4, 0x08, 0xc4, 0x00, 0xc3, 0x01, 0x10, 0x31,
+    0x43, 0x2c, 0xff, 0x41, 0x02, 0x7b, 0xcc, 0x87, 0x2d, 0x0f, 0xa7, 0x41,
+    0xce, 0x6e, 0x66, 0x01, 0x4e, 0xe0, 0xcd, 0x76, 0x4f, 0x01, 0x05, 0xc9,
+    0x48, 0xb7, 0x8a, 0x41, 0x02, 0x87, 0xd7, 0x28, 0x2c, 0x0f, 0xd7, 0xa8,
+    0xc2, 0x00, 0xf1, 0x01, 0x13, 0x0b, 0x01, 0x02, 0xab, 0xce, 0x33, 0xae,
+    0x01, 0x53, 0x38, 0x4a, 0xa7, 0x9c, 0xc1, 0x02, 0xb1, 0x49, 0xb4, 0x1c,
+    0x41, 0x02, 0xbf, 0x54, 0x3b, 0x88, 0xc1, 0x02, 0xcb, 0xd1, 0x2b, 0x57,
+    0x01, 0x81, 0x60, 0xc4, 0x0a, 0x8b, 0x01, 0x80, 0x09, 0xcb, 0x90, 0xa7,
+    0x01, 0x80, 0x30, 0xcc, 0x83, 0x25, 0x01, 0x8c, 0x81, 0xcc, 0x88, 0x71,
+    0x01, 0x8c, 0x89, 0xc8, 0x2b, 0x60, 0x01, 0x8c, 0x91, 0x16, 0xc1, 0x02,
+    0xe9, 0x08, 0xc1, 0x02, 0xf9, 0x0f, 0xc1, 0x03, 0x05, 0xcb, 0x97, 0x0e,
+    0x01, 0x8c, 0xc1, 0xcb, 0x93, 0x88, 0x01, 0x8c, 0xd1, 0xcb, 0x8e, 0x1e,
+    0x01, 0x8c, 0xe9, 0xca, 0xa3, 0x28, 0x01, 0x8c, 0xf0, 0x47, 0x34, 0x2f,
+    0xc1, 0x03, 0x11, 0xcc, 0x83, 0x19, 0x08, 0x42, 0xb9, 0x47, 0x02, 0x0e,
+    0x41, 0x03, 0x1e, 0xc6, 0x57, 0xec, 0x01, 0x03, 0x01, 0xd4, 0x3a, 0xfc,
+    0x01, 0x71, 0x88, 0x42, 0x00, 0x97, 0xc1, 0x03, 0x81, 0xd0, 0x5e, 0xc2,
+    0x0f, 0xa3, 0x78, 0x05, 0xc1, 0x03, 0x99, 0x0a, 0xc1, 0x03, 0xb7, 0x52,
+    0x48, 0x59, 0xc1, 0x03, 0xc5, 0x15, 0xc1, 0x03, 0xd1, 0x0e, 0xc1, 0x04,
+    0x05, 0x06, 0xc1, 0x04, 0x15, 0x16, 0xc1, 0x04, 0x2a, 0xd9, 0x0f, 0x09,
+    0x01, 0x3a, 0xa9, 0xd6, 0x2c, 0xb2, 0x01, 0x3a, 0xa1, 0x08, 0xc1, 0x04,
+    0x40, 0xc3, 0xe6, 0x74, 0x01, 0x38, 0x89, 0x14, 0xc1, 0x04, 0x50, 0x42,
+    0x02, 0xae, 0xc1, 0x04, 0x5c, 0x0f, 0xc1, 0x04, 0x68, 0xc6, 0x1c, 0xb4,
+    0x01, 0x2f, 0x31, 0x12, 0xc1, 0x04, 0x74, 0x43, 0x00, 0x5f, 0x41, 0x04,
+    0x80, 0x45, 0x15, 0xa7, 0xc1, 0x04, 0x8c, 0x45, 0x20, 0x6c, 0x41, 0x04,
+    0xaa, 0x45, 0x20, 0x6c, 0xc1, 0x04, 0xc8, 0x45, 0x15, 0xa7, 0x41, 0x04,
+    0xe6, 0xd5, 0x35, 0xde, 0x0f, 0xc4, 0x19, 0xca, 0x35, 0xe9, 0x0f, 0xc3,
+    0x59, 0xd0, 0x5c, 0x32, 0x0f, 0xc3, 0x19, 0xd1, 0x50, 0x46, 0x0f, 0xc3,
+    0x99, 0xd0, 0x35, 0xe3, 0x0f, 0xc3, 0xd8, 0xd5, 0x35, 0xde, 0x0f, 0xc4,
+    0x11, 0xd0, 0x35, 0xe3, 0x0f, 0xc3, 0xd1, 0xd0, 0x5c, 0x32, 0x0f, 0xc3,
+    0x11, 0xca, 0x35, 0xe9, 0x0f, 0xc3, 0x51, 0xd1, 0x50, 0x46, 0x0f, 0xc3,
+    0x90, 0xd5, 0x35, 0xde, 0x0f, 0xc4, 0x01, 0xd0, 0x5c, 0x32, 0x0f, 0xc3,
+    0x01, 0xca, 0x35, 0xe9, 0x0f, 0xc3, 0x41, 0xd1, 0x50, 0x46, 0x0f, 0xc3,
+    0x81, 0xd0, 0x35, 0xe3, 0x0f, 0xc3, 0xc0, 0xd0, 0x5c, 0x32, 0x0f, 0xc3,
+    0x09, 0xca, 0x35, 0xe9, 0x0f, 0xc3, 0x49, 0xd1, 0x50, 0x46, 0x0f, 0xc3,
+    0x89, 0xd0, 0x35, 0xe3, 0x0f, 0xc3, 0xc9, 0xd5, 0x35, 0xde, 0x0f, 0xc4,
+    0x08, 0x00, 0xc1, 0x05, 0x04, 0xc2, 0x00, 0x27, 0x0f, 0xd4, 0xf8, 0x00,
+    0xc1, 0x05, 0x10, 0xc5, 0xda, 0xf6, 0x0f, 0x9a, 0x48, 0xc9, 0xae, 0x4f,
+    0x0f, 0x17, 0xf9, 0x46, 0x09, 0x97, 0xc1, 0x05, 0x28, 0x45, 0x2b, 0x5f,
+    0xc1, 0x05, 0x4c, 0x47, 0x02, 0x0e, 0x41, 0x05, 0x5e, 0xd4, 0x39, 0x08,
+    0x0f, 0x98, 0xc1, 0xd3, 0x3f, 0x96, 0x0f, 0x98, 0xb0, 0xc2, 0x00, 0x7a,
+    0x08, 0xc7, 0xf9, 0x47, 0x34, 0x2f, 0xc1, 0x05, 0xe5, 0x46, 0x09, 0x97,
+    0xc1, 0x05, 0xfd, 0x4d, 0x29, 0xb9, 0xc1, 0x06, 0x21, 0x4f, 0x0b, 0x17,
+    0x41, 0x06, 0x80, 0x0e, 0xc1, 0x06, 0xdf, 0xc8, 0x7d, 0xa4, 0x07, 0xf2,
+    0x59, 0xc4, 0x0e, 0x9a, 0x01, 0x81, 0x80, 0xca, 0xa7, 0xf6, 0x0f, 0x9f,
+    0x99, 0xca, 0xa1, 0x7a, 0x0f, 0x9f, 0xa1, 0xc9, 0x42, 0xd1, 0x0f, 0xa2,
+    0x58, 0x58, 0x21, 0xb3, 0xc1, 0x06, 0xeb, 0xc4, 0x0e, 0x9a, 0x01, 0x80,
+    0xe0, 0xc8, 0x31, 0x90, 0x0f, 0xac, 0x29, 0xc6, 0xcb, 0xe1, 0x0f, 0xb7,
+    0xc1, 0xc4, 0x5c, 0x58, 0x0f, 0xca, 0x78, 0xc5, 0x8d, 0xed, 0x0f, 0xcb,
+    0xf9, 0xc4, 0x1d, 0xa8, 0x01, 0x1f, 0x29, 0xc5, 0x71, 0x71, 0x0f, 0xd6,
+    0x98, 0x42, 0x00, 0xaf, 0x41, 0x06, 0xf7, 0x00, 0xc1, 0x07, 0x03, 0xc7,
+    0x90, 0x53, 0x01, 0x10, 0xe1, 0xcd, 0x79, 0x41, 0x01, 0x00, 0x28, 0xca,
+    0xa0, 0xbc, 0x0f, 0x9b, 0xa3, 0x01, 0x07, 0x25, 0xc3, 0x00, 0x74, 0x01,
+    0x56, 0xe1, 0xce, 0x4a, 0x43, 0x01, 0x70, 0x80, 0x44, 0x00, 0x8c, 0xc1,
+    0x07, 0x2b, 0xc4, 0x3a, 0xb4, 0x0f, 0xc9, 0x31, 0xc7, 0xc2, 0x8f, 0x0f,
+    0xa4, 0x31, 0xcf, 0x64, 0x95, 0x0f, 0xb0, 0xc1, 0x15, 0xc1, 0x07, 0x35,
+    0xd2, 0x4c, 0x25, 0x0f, 0xcb, 0xc8, 0x4d, 0x27, 0x30, 0xc1, 0x07, 0x41,
+    0xc7, 0xc1, 0xbd, 0x0f, 0x9a, 0x10, 0xc8, 0xb6, 0x62, 0x01, 0x05, 0x19,
+    0xc3, 0x91, 0xe8, 0x0f, 0x9a, 0xf8, 0x46, 0x01, 0xec, 0xc1, 0x07, 0x4d,
+    0xd1, 0x55, 0x85, 0x0f, 0xa1, 0x28, 0xd8, 0x21, 0xfb, 0x0f, 0xb1, 0x30,
+    0xcd, 0x78, 0x64, 0x01, 0x0a, 0xf9, 0xc5, 0x03, 0x02, 0x01, 0x02, 0x20,
+    0xc4, 0xe2, 0x5f, 0x0f, 0xad, 0xf1, 0xc5, 0xd6, 0xcd, 0x0f, 0xad, 0xe9,
+    0xc7, 0x87, 0xc2, 0x0f, 0xad, 0xe0, 0xca, 0x9b, 0x76, 0x01, 0x3e, 0xb9,
+    0xc5, 0x06, 0xe2, 0x01, 0x2c, 0x41, 0x45, 0x15, 0xdb, 0xc1, 0x07, 0x53,
+    0xc4, 0x00, 0xf0, 0x00, 0x01, 0x70, 0x10, 0xc1, 0x07, 0x5f, 0x03, 0xc1,
+    0x07, 0x6b, 0x06, 0xc1, 0x07, 0x7d, 0x05, 0xc1, 0x07, 0x89, 0x15, 0xc1,
+    0x07, 0x99, 0x0e, 0xc1, 0x07, 0xa5, 0x07, 0xc1, 0x07, 0xb5, 0x42, 0x00,
+    0xb4, 0xc1, 0x07, 0xc1, 0x42, 0x00, 0xe3, 0xc1, 0x07, 0xcd, 0x14, 0xc1,
+    0x07, 0xd9, 0xc5, 0x1e, 0xc8, 0x07, 0xfa, 0xf1, 0x12, 0xc1, 0x07, 0xe5,
+    0xc6, 0x60, 0xb1, 0x07, 0xff, 0x19, 0xca, 0x9b, 0x58, 0x07, 0xff, 0x21,
+    0xc8, 0x77, 0x99, 0x07, 0xff, 0x29, 0xc8, 0xbe, 0x72, 0x07, 0xff, 0x31,
+    0xcc, 0x89, 0xcd, 0x07, 0xf8, 0x69, 0xc9, 0x11, 0xf6, 0x07, 0xf8, 0x71,
+    0xcd, 0x36, 0x86, 0x07, 0xfa, 0xe0, 0xcc, 0x68, 0xfd, 0x01, 0x31, 0xeb,
+    0x01, 0x07, 0xf7, 0xce, 0x6f, 0x46, 0x01, 0x03, 0x41, 0xcb, 0x62, 0xc8,
+    0x0f, 0xca, 0x38, 0x44, 0x3f, 0xf8, 0xc1, 0x07, 0xfb, 0x42, 0x00, 0xe1,
+    0xc1, 0x08, 0x05, 0xc7, 0xc1, 0x0e, 0x0f, 0xcf, 0x40, 0xc3, 0x17, 0x28,
+    0x01, 0x2e, 0x49, 0xd1, 0x55, 0x74, 0x0f, 0x9d, 0x19, 0xd7, 0x2a, 0x3d,
+    0x0f, 0x9b, 0x28, 0xc7, 0xc7, 0x89, 0x0f, 0xae, 0x21, 0xc6, 0x9e, 0xf4,
+    0x0f, 0xa6, 0x09, 0xc9, 0x1b, 0x0a, 0x00, 0x00, 0xe0, 0xc9, 0xae, 0x58,
+    0x0f, 0xa7, 0xe9, 0xc6, 0xd0, 0x25, 0x0f, 0x9c, 0xf0, 0xc6, 0xb7, 0xec,
+    0x0f, 0xd4, 0xb1, 0xc5, 0x62, 0xce, 0x0f, 0x9c, 0xb0, 0x14, 0xc1, 0x08,
+    0x11, 0x16, 0xc1, 0x08, 0x1d, 0x10, 0xc1, 0x08, 0x3b, 0x06, 0xc1, 0x08,
+    0x54, 0x15, 0xc1, 0x08, 0x68, 0x04, 0xc1, 0x08, 0x7e, 0x0a, 0xc1, 0x08,
+    0x88, 0x03, 0xc1, 0x08, 0x92, 0xc2, 0x01, 0x4a, 0x0b, 0x7a, 0x11, 0x1c,
+    0xc1, 0x08, 0x9c, 0x43, 0x70, 0x51, 0xc1, 0x08, 0xae, 0x09, 0xc1, 0x08,
+    0xca, 0xc2, 0x8d, 0x8f, 0x0b, 0x79, 0x39, 0x13, 0xc1, 0x08, 0xd2, 0xc2,
+    0x02, 0x2b, 0x0b, 0x78, 0xf1, 0x0e, 0xc1, 0x08, 0xdc, 0x18, 0xc1, 0x08,
+    0xea, 0xc2, 0x00, 0x87, 0x0b, 0x78, 0x39, 0x0f, 0xc1, 0x08, 0xf4, 0x12,
+    0x41, 0x08, 0xfe, 0xc5, 0x05, 0x02, 0x0b, 0x7c, 0x91, 0xc5, 0x00, 0xd4,
+    0x0b, 0x7c, 0x89, 0xc9, 0x63, 0x69, 0x0b, 0x7c, 0x81, 0xc5, 0x00, 0x2c,
+    0x0b, 0x7c, 0x78, 0x97, 0x0b, 0x7b, 0x53, 0x01, 0x09, 0x08, 0x8b, 0x0b,
+    0x7b, 0x0b, 0x01, 0x09, 0x29, 0x87, 0x0b, 0x7a, 0xeb, 0x01, 0x09, 0x4d,
+    0xc2, 0x00, 0x18, 0x0b, 0x7c, 0x19, 0x91, 0x0b, 0x7a, 0xcb, 0x01, 0x09,
+    0x63, 0x9b, 0x0b, 0x7b, 0x8b, 0x01, 0x09, 0x73, 0x90, 0x0b, 0x7b, 0xeb,
+    0x01, 0x09, 0x7d, 0x83, 0x0b, 0x7a, 0xa3, 0x01, 0x09, 0x81, 0xca, 0x9d,
+    0x7e, 0x0b, 0x7b, 0xc3, 0x01, 0x09, 0xa1, 0x99, 0x0b, 0x7a, 0xe2, 0x01,
+    0x09, 0xa5, 0x49, 0xaa, 0xc2, 0xc1, 0x09, 0xa9, 0xca, 0xa1, 0x84, 0x0b,
+    0x7a, 0x89, 0xd6, 0x2b, 0xec, 0x0b, 0x7a, 0x78, 0xcb, 0x95, 0xc4, 0x01,
+    0x22, 0x49, 0xcc, 0x8a, 0xbd, 0x01, 0x22, 0x40, 0xc5, 0xbc, 0xed, 0x0f,
+    0xa9, 0x61, 0xc5, 0x36, 0xb7, 0x0f, 0x9d, 0x21, 0xc5, 0x00, 0xb9, 0x00,
+    0x05, 0xa9, 0xc2, 0x00, 0x51, 0x0f, 0xcd, 0x00, 0xc3, 0x02, 0xa3, 0x00,
+    0x05, 0xb9, 0xe0, 0x06, 0x67, 0x0f, 0xde, 0x10, 0x00, 0xc1, 0x09, 0xb5,
+    0xcd, 0x79, 0x4e, 0x01, 0x10, 0x98, 0xc4, 0xd1, 0x89, 0x0f, 0xae, 0xa9,
+    0xc4, 0x5c, 0x58, 0x0f, 0xa5, 0xe9, 0xc3, 0x22, 0xd3, 0x0f, 0xb4, 0x80,
+    0x43, 0x01, 0xdf, 0xc1, 0x09, 0xc4, 0x45, 0xdc, 0xdb, 0x41, 0x0a, 0x00,
+    0xce, 0x72, 0x10, 0x0b, 0x74, 0xd1, 0x15, 0xc1, 0x0a, 0x12, 0xc9, 0x11,
+    0xf6, 0x0b, 0x74, 0xc1, 0x05, 0xc1, 0x0a, 0x1e, 0x46, 0x09, 0x97, 0xc1,
+    0x0a, 0x2a, 0x47, 0x34, 0x2f, 0x41, 0x0a, 0x51, 0xc9, 0xaf, 0x93, 0x01,
+    0x1e, 0xc9, 0x16, 0xc1, 0x0a, 0x67, 0x4a, 0xa4, 0x0e, 0xc1, 0x0a, 0x79,
+    0xcf, 0x67, 0xa1, 0x01, 0x1e, 0x99, 0xc5, 0x1d, 0x88, 0x01, 0x1e, 0x88,
+    0x4a, 0x9d, 0xf6, 0xc1, 0x0a, 0x85, 0x46, 0x09, 0x97, 0xc1, 0x0a, 0x8d,
+    0x51, 0x51, 0x89, 0x41, 0x0a, 0xab, 0x48, 0xbc, 0x6a, 0xc1, 0x0a, 0xbb,
+    0x4d, 0x75, 0xcd, 0x41, 0x0a, 0xcb, 0xc2, 0x07, 0xb8, 0x01, 0x12, 0xf1,
+    0xc5, 0x01, 0x95, 0x01, 0x11, 0x0b, 0x01, 0x0a, 0xda, 0xd4, 0x3f, 0x34,
+    0x01, 0x4c, 0xe8, 0xc4, 0x15, 0xe7, 0x05, 0x5f, 0x81, 0xc4, 0x26, 0x78,
+    0x05, 0x5f, 0xc9, 0xc3, 0x05, 0x14, 0x05, 0x5f, 0x89, 0x16, 0xc1, 0x0a,
+    0xde, 0x08, 0xc1, 0x0a, 0xea, 0x15, 0xc1, 0x0a, 0xf6, 0xc5, 0x06, 0xdb,
+    0x05, 0x5f, 0xc0, 0xc8, 0xbf, 0xd2, 0x05, 0x5f, 0x69, 0xc3, 0x7c, 0x50,
+    0x05, 0x57, 0x91, 0xcb, 0x8e, 0x6b, 0x05, 0x57, 0x88, 0x4a, 0x6f, 0xc8,
+    0xc1, 0x0b, 0x02, 0xc5, 0x1e, 0x96, 0x05, 0x57, 0xb0, 0x46, 0x02, 0x0f,
+    0xc1, 0x0b, 0x32, 0xc7, 0xc2, 0xc7, 0x05, 0x5f, 0x60, 0xc2, 0x00, 0xd1,
+    0x05, 0x57, 0x81, 0xc2, 0x06, 0xdb, 0x05, 0x5f, 0x58, 0x00, 0xc1, 0x0b,
+    0xa1, 0xc3, 0x1a, 0xd2, 0x0f, 0xb7, 0x19, 0xcf, 0x68, 0xaf, 0x0f, 0xcd,
+    0xe0, 0xc3, 0x03, 0x0c, 0x01, 0x37, 0x83, 0x01, 0x0b, 0xad, 0xc5, 0xd7,
+    0x86, 0x0f, 0xaf, 0xd8, 0x00, 0x41, 0x0b, 0xb1, 0x49, 0x89, 0xf4, 0xc1,
+    0x0b, 0xbd, 0xcd, 0x78, 0x98, 0x01, 0x1c, 0x69, 0xc4, 0x47, 0x02, 0x0f,
+    0xb4, 0xe8, 0x16, 0xc1, 0x0b, 0xc7, 0x15, 0xc1, 0x0b, 0xd9, 0xce, 0x6c,
+    0x1a, 0x08, 0xb3, 0x3b, 0x01, 0x0b, 0xe8, 0xcd, 0x76, 0x69, 0x08, 0xb3,
+    0x0b, 0x01, 0x0b, 0xee, 0xc5, 0x01, 0x2d, 0x00, 0xc0, 0x03, 0x01, 0x0b,
+    0xf4, 0x06, 0xc1, 0x0b, 0xfa, 0x47, 0x02, 0x0e, 0xc1, 0x0c, 0x06, 0x08,
+    0xc1, 0x0c, 0x91, 0xcf, 0x69, 0xbd, 0x00, 0xc0, 0x71, 0xc6, 0xcd, 0xc7,
+    0x00, 0xc0, 0x51, 0x47, 0xc2, 0x57, 0xc1, 0x0c, 0xa3, 0x42, 0x00, 0x99,
+    0xc1, 0x0c, 0xaf, 0xc8, 0x22, 0x83, 0x00, 0xc0, 0x08, 0x00, 0xc1, 0x0c,
+    0xbb, 0xcb, 0x5c, 0x17, 0x0f, 0xc8, 0x88, 0xc5, 0x11, 0x55, 0x0f, 0xa1,
+    0xa8, 0x00, 0xc1, 0x0c, 0xc7, 0x45, 0x02, 0x09, 0x41, 0x0c, 0xe3, 0xc2,
+    0x00, 0x96, 0x01, 0x15, 0x39, 0xcd, 0x7c, 0xcf, 0x0f, 0xc9, 0xd8, 0xd0,
+    0x57, 0xf2, 0x0f, 0x9c, 0x89, 0xc4, 0x2a, 0x3e, 0x0f, 0xcb, 0x70, 0xc3,
+    0x79, 0x83, 0x0f, 0xa7, 0xa1, 0xdd, 0x10, 0x4c, 0x0f, 0xa7, 0x90, 0x47,
+    0xc7, 0x4a, 0xc1, 0x0c, 0xef, 0x45, 0x58, 0xc2, 0xc1, 0x0d, 0x1d, 0x4a,
+    0xa3, 0x0a, 0xc1, 0x0d, 0x5b, 0x15, 0xc1, 0x0d, 0x6d, 0x4e, 0x73, 0x52,
+    0xc1, 0x0d, 0x79, 0x08, 0xc1, 0x0d, 0x8b, 0x42, 0x00, 0x2c, 0xc1, 0x0d,
+    0x97, 0x45, 0x00, 0x49, 0x41, 0x0d, 0xa3, 0xc4, 0x14, 0x09, 0x0e, 0x97,
+    0x98, 0xc4, 0x00, 0x2d, 0x0e, 0x97, 0x43, 0x01, 0x0d, 0xbb, 0xc5, 0x66,
+    0xb1, 0x0e, 0x97, 0x58, 0xc4, 0x18, 0x10, 0x0e, 0x97, 0x3b, 0x01, 0x0d,
+    0xc1, 0xc2, 0x22, 0xcc, 0x0e, 0x97, 0x32, 0x01, 0x0d, 0xc7, 0x0b, 0xc1,
+    0x0d, 0xcd, 0xc3, 0x09, 0x9e, 0x0e, 0x97, 0x22, 0x01, 0x0d, 0xd9, 0x0a,
+    0xc1, 0x0d, 0xdf, 0x19, 0xc1, 0x0d, 0xeb, 0xc2, 0x00, 0xc4, 0x0e, 0x97,
+    0x50, 0x91, 0x08, 0xf7, 0xb1, 0x87, 0x08, 0xf7, 0xa9, 0x97, 0x08, 0xf7,
+    0xa1, 0x8b, 0x08, 0xf7, 0x98, 0x83, 0x08, 0xf7, 0x89, 0xc2, 0x0d, 0xf6,
+    0x08, 0xf7, 0x81, 0xc2, 0x02, 0x41, 0x08, 0xf7, 0x79, 0xc2, 0x00, 0xdb,
+    0x08, 0xf7, 0x71, 0xc2, 0x00, 0x39, 0x08, 0xf7, 0x69, 0xc2, 0x19, 0x2c,
+    0x08, 0xf7, 0x61, 0x10, 0xc1, 0x0d, 0xf5, 0xc2, 0x25, 0x3b, 0x08, 0xf7,
+    0x51, 0xc2, 0x00, 0x64, 0x08, 0xf7, 0x49, 0xc2, 0x0e, 0x9a, 0x08, 0xf7,
+    0x39, 0xc2, 0x01, 0x6f, 0x08, 0xf7, 0x31, 0xc2, 0x01, 0xc3, 0x08, 0xf7,
+    0x29, 0xc2, 0x01, 0x5d, 0x08, 0xf7, 0x21, 0xc2, 0x00, 0xb0, 0x08, 0xf7,
+    0x19, 0xc2, 0x01, 0x30, 0x08, 0xf7, 0x09, 0xc2, 0x02, 0x2b, 0x08, 0xf7,
+    0x00, 0x46, 0x09, 0x97, 0xc1, 0x0e, 0x05, 0x14, 0xc1, 0x0e, 0x29, 0x18,
+    0xc1, 0x0e, 0x35, 0x45, 0x00, 0xba, 0xc1, 0x0e, 0x41, 0x47, 0x02, 0x0e,
+    0x41, 0x0e, 0x5f, 0x15, 0xc1, 0x0e, 0xc6, 0x4b, 0x6f, 0xc7, 0xc1, 0x0e,
+    0xd2, 0x47, 0x02, 0x0e, 0xc1, 0x0e, 0xe8, 0xc9, 0xaa, 0xa7, 0x08, 0xe3,
+    0x89, 0xc9, 0x15, 0xcc, 0x08, 0xe3, 0x80, 0x4c, 0x37, 0x33, 0xc1, 0x0f,
+    0x48, 0xcf, 0x20, 0xfc, 0x01, 0x35, 0x29, 0xc4, 0x00, 0xba, 0x01, 0x32,
+    0x10, 0x45, 0x00, 0xba, 0xc1, 0x0f, 0x54, 0x47, 0x02, 0x0e, 0xc1, 0x0f,
+    0x66, 0x4b, 0x6f, 0xc7, 0xc1, 0x0f, 0xcf, 0xce, 0x73, 0x0c, 0x00, 0x6a,
+    0xb9, 0x49, 0x53, 0xa9, 0xc1, 0x0f, 0xf5, 0x06, 0xc1, 0x10, 0x01, 0x47,
+    0x34, 0x2f, 0x41, 0x10, 0x0d, 0x4c, 0x11, 0xe2, 0xc1, 0x10, 0x19, 0x47,
+    0x34, 0x2f, 0xc1, 0x10, 0x37, 0x52, 0x48, 0x11, 0xc1, 0x10, 0x4a, 0x47,
+    0x02, 0x0e, 0xc1, 0x10, 0x56, 0xc7, 0xc3, 0xae, 0x08, 0x56, 0x40, 0xc7,
+    0xc3, 0xe6, 0x0f, 0xab, 0xd1, 0x43, 0x03, 0x35, 0xc1, 0x10, 0xbb, 0x45,
+    0x00, 0x8c, 0xc1, 0x10, 0xc7, 0xd7, 0x29, 0xf8, 0x0f, 0xa3, 0x58, 0xcb,
+    0x05, 0x1c, 0x00, 0x42, 0xf1, 0xcf, 0x63, 0xff, 0x00, 0x42, 0xd9, 0xd1,
+    0x4e, 0xbf, 0x00, 0x42, 0xd1, 0xd0, 0x58, 0x32, 0x00, 0x42, 0xc9, 0x47,
+    0x02, 0x0e, 0x41, 0x10, 0xd3, 0x0e, 0xc1, 0x10, 0xf3, 0x15, 0xc1, 0x10,
+    0xff, 0xd1, 0x50, 0xce, 0x08, 0x8b, 0xa0, 0xc5, 0x8d, 0x1c, 0x0f, 0x81,
+    0x51, 0x19, 0xc1, 0x11, 0x0b, 0x07, 0xc1, 0x11, 0x1d, 0x15, 0xc1, 0x11,
+    0x29, 0x10, 0xc1, 0x11, 0x47, 0xca, 0xa0, 0x9e, 0x0f, 0x80, 0x21, 0xcc,
+    0x87, 0xe1, 0x0f, 0x80, 0x29, 0x11, 0xc1, 0x11, 0x53, 0x16, 0xc1, 0x11,
+    0x5f, 0x08, 0xc1, 0x11, 0x6b, 0xc4, 0xe3, 0xc7, 0x0f, 0x81, 0x11, 0xcd,
+    0x78, 0x8b, 0x0f, 0x81, 0x29, 0x42, 0x01, 0x5d, 0xc1, 0x11, 0x77, 0xc6,
+    0xce, 0x39, 0x0f, 0x81, 0x40, 0x43, 0x00, 0xe5, 0xc1, 0x11, 0x83, 0x00,
+    0x41, 0x11, 0x96, 0x42, 0x0b, 0x26, 0xc1, 0x11, 0xa8, 0xc3, 0x64, 0xae,
+    0x01, 0x15, 0xc1, 0xc3, 0x0e, 0xa7, 0x01, 0x14, 0x62, 0x01, 0x11, 0xb4,
+    0xcc, 0x45, 0x8d, 0x08, 0x95, 0x49, 0x47, 0x02, 0x0e, 0x41, 0x11, 0xb8,
+    0xc4, 0x26, 0x78, 0x0b, 0x53, 0x49, 0xc5, 0x06, 0xdb, 0x0b, 0x53, 0x41,
+    0x15, 0xc1, 0x12, 0x14, 0x08, 0xc1, 0x12, 0x20, 0x16, 0xc1, 0x12, 0x2c,
+    0xc3, 0x05, 0x14, 0x0b, 0x53, 0x09, 0xc4, 0x15, 0xe7, 0x0b, 0x53, 0x00,
+    0xc2, 0x13, 0x4c, 0x0b, 0x52, 0xf1, 0xc3, 0x01, 0x9b, 0x0b, 0x52, 0xa9,
+    0x83, 0x0b, 0x52, 0x00, 0x8b, 0x0b, 0x52, 0xe9, 0x91, 0x0b, 0x52, 0x98,
+    0x8b, 0x0b, 0x52, 0xe1, 0x91, 0x0b, 0x52, 0x48, 0x90, 0x0b, 0x52, 0xd0,
+    0x91, 0x0b, 0x52, 0xc9, 0xc4, 0xe2, 0x77, 0x0b, 0x52, 0x61, 0xc3, 0x4d,
+    0xe7, 0x0b, 0x52, 0x40, 0x83, 0x0b, 0x52, 0xb0, 0x91, 0x0b, 0x52, 0x89,
+    0x8e, 0x0b, 0x52, 0x68, 0x83, 0x0b, 0x52, 0x81, 0xc2, 0x00, 0x0a, 0x0b,
+    0x52, 0x38, 0xc2, 0x00, 0x74, 0x0b, 0x52, 0x79, 0xc2, 0x04, 0x2b, 0x0b,
+    0x52, 0x08, 0xc3, 0x7c, 0x57, 0x0b, 0x52, 0x71, 0xc2, 0x03, 0x4e, 0x0b,
+    0x52, 0x18, 0x8b, 0x0b, 0x52, 0x50, 0x4f, 0x68, 0x91, 0xc1, 0x12, 0x38,
+    0xce, 0x6c, 0xc2, 0x05, 0x53, 0xd9, 0x15, 0xc1, 0x12, 0x40, 0x03, 0xc1,
+    0x12, 0x4c, 0xc9, 0x0e, 0x6e, 0x00, 0x81, 0xb9, 0x42, 0x07, 0xb2, 0xc1,
+    0x12, 0x58, 0xce, 0x70, 0xb2, 0x00, 0x82, 0x51, 0x57, 0x28, 0x9f, 0xc1,
+    0x12, 0x64, 0xd4, 0x38, 0x7c, 0x00, 0x84, 0x79, 0x4c, 0x8c, 0x31, 0x41,
+    0x12, 0x78, 0x03, 0xc1, 0x12, 0x80, 0xc8, 0xbb, 0xd2, 0x00, 0x82, 0x61,
+    0xc9, 0xb4, 0xe2, 0x00, 0x82, 0x69, 0xc8, 0xbf, 0x5a, 0x00, 0x82, 0x79,
+    0x45, 0x4d, 0x21, 0x41, 0x12, 0x8c, 0xc4, 0x15, 0xe7, 0x00, 0x84, 0x81,
+    0xc3, 0x05, 0x14, 0x00, 0x84, 0x89, 0x16, 0xc1, 0x12, 0x98, 0x08, 0xc1,
+    0x12, 0xa4, 0x15, 0xc1, 0x12, 0xb0, 0xc5, 0x06, 0xdb, 0x00, 0x84, 0xc1,
+    0xc4, 0x26, 0x78, 0x00, 0x84, 0xc8, 0x83, 0x00, 0x81, 0x0b, 0x01, 0x12,
+    0xbc, 0x0d, 0xc1, 0x12, 0xc6, 0x16, 0xc1, 0x12, 0xd3, 0x15, 0xc1, 0x12,
+    0xe4, 0x09, 0xc1, 0x12, 0xf8, 0x10, 0xc1, 0x13, 0x08, 0x05, 0xc1, 0x13,
+    0x1c, 0x0c, 0xc1, 0x13, 0x26, 0x06, 0xc1, 0x13, 0x30, 0x12, 0xc1, 0x13,
+    0x3e, 0x04, 0xc1, 0x13, 0x48, 0x0f, 0xc1, 0x13, 0x52, 0xc2, 0x19, 0x2c,
+    0x00, 0x80, 0xd1, 0x14, 0xc1, 0x13, 0x5c, 0x0e, 0xc1, 0x13, 0x66, 0x19,
+    0xc1, 0x13, 0x70, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0xf9, 0x8b, 0x00, 0x81,
+    0x1b, 0x01, 0x13, 0x7a, 0x97, 0x00, 0x81, 0x2b, 0x01, 0x13, 0x7e, 0x87,
+    0x00, 0x81, 0x3b, 0x01, 0x13, 0x82, 0x91, 0x00, 0x81, 0x49, 0x48, 0xb2,
+    0x2d, 0x41, 0x13, 0x88, 0xc2, 0x02, 0x2e, 0x05, 0x53, 0xb1, 0xc2, 0xc8,
+    0xd4, 0x05, 0x53, 0xa9, 0xc3, 0xe6, 0x17, 0x05, 0x53, 0xa0, 0xc4, 0x26,
+    0x78, 0x05, 0x4f, 0xc9, 0xc5, 0x06, 0xdb, 0x05, 0x4f, 0xc1, 0x15, 0xc1,
+    0x13, 0x96, 0x08, 0xc1, 0x13, 0xa2, 0x16, 0xc1, 0x13, 0xae, 0xc3, 0x05,
+    0x14, 0x05, 0x4f, 0x89, 0xc4, 0x15, 0xe7, 0x05, 0x4f, 0x80, 0xc5, 0xd6,
+    0x73, 0x00, 0x83, 0x19, 0xc6, 0xce, 0x57, 0x00, 0x83, 0x20, 0x83, 0x00,
+    0x81, 0x61, 0x8b, 0x00, 0x81, 0x92, 0x01, 0x13, 0xba, 0x8b, 0x00, 0x81,
+    0x70, 0x97, 0x00, 0x81, 0x80, 0xc6, 0x00, 0xd3, 0x00, 0x81, 0xa8, 0xc2,
+    0x25, 0x9f, 0x00, 0x81, 0x99, 0x91, 0x00, 0x81, 0xa0, 0x94, 0x00, 0x82,
+    0xb3, 0x01, 0x13, 0xc3, 0x8e, 0x00, 0x82, 0xc2, 0x01, 0x13, 0xc7, 0xcc,
+    0x85, 0xad, 0x00, 0x83, 0x11, 0x44, 0x00, 0xd0, 0x41, 0x13, 0xcb, 0xc2,
+    0x2c, 0x43, 0x00, 0x83, 0x39, 0xc2, 0x0f, 0xe1, 0x00, 0x83, 0x40, 0xc2,
+    0x49, 0x0c, 0x00, 0x83, 0x91, 0x97, 0x00, 0x83, 0x99, 0xc2, 0x02, 0xe0,
+    0x00, 0x83, 0xa0, 0x46, 0x30, 0xa0, 0xc1, 0x13, 0xde, 0x4a, 0xa6, 0x0c,
+    0x41, 0x13, 0xf6, 0xc2, 0x02, 0xa0, 0x00, 0x82, 0x11, 0xc4, 0x02, 0xde,
+    0x00, 0x82, 0x18, 0xc3, 0x09, 0x9e, 0x00, 0x82, 0x21, 0xc3, 0x0d, 0x14,
+    0x00, 0x82, 0x28, 0xc2, 0x22, 0xcc, 0x00, 0x82, 0x31, 0xc4, 0x18, 0x10,
+    0x00, 0x82, 0x38, 0xca, 0x9f, 0xfe, 0x0f, 0xad, 0x30, 0x47, 0x02, 0x0e,
+    0xc1, 0x14, 0x08, 0xca, 0x3b, 0x06, 0x01, 0x87, 0xd9, 0xce, 0x1c, 0x92,
+    0x01, 0x87, 0xe9, 0xd5, 0x34, 0xb8, 0x01, 0x87, 0xf1, 0xcc, 0x80, 0xfd,
+    0x01, 0x87, 0xf8, 0xd1, 0x2f, 0xfb, 0x01, 0x84, 0xd9, 0xd6, 0x2f, 0xf6,
+    0x01, 0x84, 0xe1, 0xcd, 0x77, 0x87, 0x01, 0x85, 0x01, 0xd4, 0x0d, 0xe2,
+    0x01, 0x87, 0xe0, 0xc6, 0x00, 0xd3, 0x08, 0x86, 0x68, 0xc9, 0xb2, 0x2d,
+    0x08, 0x86, 0x11, 0x03, 0xc1, 0x14, 0x5e, 0x91, 0x08, 0x85, 0xb9, 0x87,
+    0x08, 0x85, 0xa9, 0x97, 0x08, 0x85, 0x9b, 0x01, 0x14, 0x6a, 0x8b, 0x08,
+    0x85, 0x8a, 0x01, 0x14, 0x6e, 0x46, 0x00, 0x59, 0xc1, 0x14, 0x72, 0xc4,
+    0x19, 0x53, 0x08, 0x86, 0x00, 0xcb, 0x45, 0x8e, 0x08, 0x85, 0xf1, 0x44,
+    0x00, 0xbb, 0x41, 0x14, 0x7e, 0xc2, 0x00, 0xd0, 0x08, 0x85, 0x79, 0x15,
+    0xc1, 0x14, 0x96, 0xc2, 0x02, 0x41, 0x08, 0x85, 0x59, 0xc2, 0x00, 0xdb,
+    0x08, 0x85, 0x51, 0x14, 0xc1, 0x14, 0xa6, 0xc2, 0x19, 0x2c, 0x08, 0x85,
+    0x41, 0xc2, 0x01, 0xc3, 0x08, 0x85, 0x39, 0x04, 0xc1, 0x14, 0xb0, 0x12,
+    0xc1, 0x14, 0xba, 0x10, 0xc1, 0x14, 0xc4, 0x06, 0xc1, 0x14, 0xda, 0x16,
+    0xc1, 0x14, 0xe8, 0x0c, 0xc1, 0x14, 0xf6, 0x05, 0xc1, 0x15, 0x00, 0x09,
+    0xc1, 0x15, 0x0a, 0x0d, 0xc1, 0x15, 0x14, 0x83, 0x08, 0x84, 0x1b, 0x01,
+    0x15, 0x1e, 0x91, 0x08, 0x84, 0x59, 0x87, 0x08, 0x84, 0x49, 0x97, 0x08,
+    0x84, 0x3b, 0x01, 0x15, 0x2a, 0x8b, 0x08, 0x84, 0x2a, 0x01, 0x15, 0x2e,
+    0xc4, 0xde, 0x93, 0x05, 0x49, 0x79, 0xc3, 0xe4, 0xfd, 0x05, 0x49, 0x70,
+    0xc5, 0xde, 0x02, 0x05, 0x49, 0x63, 0x01, 0x15, 0x32, 0xc6, 0xca, 0x77,
+    0x05, 0x49, 0x58, 0x91, 0x05, 0x49, 0x51, 0x87, 0x05, 0x49, 0x3b, 0x01,
+    0x15, 0x38, 0x97, 0x05, 0x49, 0x42, 0x01, 0x15, 0x3c, 0x11, 0xc1, 0x15,
+    0x40, 0x8b, 0x05, 0x49, 0x21, 0x83, 0x05, 0x49, 0x11, 0xc2, 0x00, 0x64,
+    0x05, 0x49, 0x09, 0xc2, 0x02, 0x41, 0x05, 0x49, 0x01, 0x0a, 0xc1, 0x15,
+    0x48, 0x16, 0xc1, 0x15, 0x52, 0xc2, 0x01, 0x4a, 0x05, 0x48, 0xe9, 0xc2,
+    0x00, 0xdb, 0x05, 0x48, 0xe1, 0xc2, 0x19, 0x2c, 0x05, 0x48, 0xd9, 0xc2,
+    0x00, 0x39, 0x05, 0x48, 0xd1, 0xc2, 0x01, 0x5d, 0x05, 0x48, 0xc9, 0xc2,
+    0x0e, 0x9a, 0x05, 0x48, 0xc1, 0xc2, 0x01, 0xc3, 0x05, 0x48, 0xb9, 0x12,
+    0xc1, 0x15, 0x5c, 0x10, 0xc1, 0x15, 0x66, 0xc2, 0x02, 0x1c, 0x05, 0x48,
+    0x81, 0x15, 0xc1, 0x15, 0x76, 0xc2, 0x01, 0x30, 0x05, 0x48, 0x61, 0x0d,
+    0x41, 0x15, 0x80, 0xc4, 0x26, 0x78, 0x05, 0x48, 0x49, 0xc5, 0x06, 0xdb,
+    0x05, 0x48, 0x41, 0x15, 0xc1, 0x15, 0x8a, 0x08, 0xc1, 0x15, 0x96, 0x16,
+    0xc1, 0x15, 0xa2, 0xc3, 0x05, 0x14, 0x05, 0x48, 0x09, 0xc4, 0x15, 0xe7,
+    0x05, 0x48, 0x00, 0x45, 0x00, 0xba, 0xc1, 0x15, 0xae, 0x42, 0x00, 0x49,
+    0xc1, 0x15, 0xd4, 0x4b, 0x6f, 0xc7, 0xc1, 0x15, 0xe0, 0xce, 0x74, 0xcc,
+    0x00, 0x66, 0xb1, 0x46, 0x09, 0x97, 0x41, 0x16, 0x06, 0xc4, 0xe1, 0x83,
+    0x0f, 0xcc, 0xc1, 0x4b, 0x91, 0xfc, 0x41, 0x16, 0x2a, 0x05, 0xc1, 0x16,
+    0x8e, 0x04, 0x41, 0x16, 0xc6, 0xc4, 0x26, 0x78, 0x08, 0x97, 0xc9, 0x15,
+    0xc1, 0x17, 0x06, 0x08, 0xc1, 0x17, 0x12, 0x16, 0xc1, 0x17, 0x1e, 0xc3,
+    0x05, 0x14, 0x08, 0x97, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0x97, 0x81, 0xc5,
+    0x06, 0xdb, 0x08, 0x97, 0xc0, 0xc6, 0x1e, 0x95, 0x08, 0x97, 0x51, 0xc5,
+    0x33, 0x5d, 0x08, 0x97, 0x49, 0xc8, 0x14, 0x38, 0x08, 0x96, 0xf8, 0x91,
+    0x08, 0x97, 0x39, 0x03, 0xc1, 0x17, 0x2a, 0x87, 0x08, 0x97, 0x29, 0x97,
+    0x08, 0x97, 0x1b, 0x01, 0x17, 0x36, 0x8b, 0x08, 0x97, 0x0a, 0x01, 0x17,
+    0x3a, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0xf1, 0x15, 0xc1, 0x17, 0x3e, 0xc2,
+    0x02, 0x41, 0x08, 0x96, 0xd9, 0xc2, 0x00, 0xdb, 0x08, 0x96, 0xd1, 0x14,
+    0xc1, 0x17, 0x48, 0xc2, 0x19, 0x2c, 0x08, 0x96, 0xc1, 0xc2, 0x01, 0xc3,
+    0x08, 0x96, 0xb9, 0x04, 0xc1, 0x17, 0x52, 0x12, 0xc1, 0x17, 0x62, 0x10,
+    0xc1, 0x17, 0x6c, 0x06, 0xc1, 0x17, 0x82, 0x16, 0xc1, 0x17, 0x90, 0x0c,
+    0xc1, 0x17, 0x9e, 0x05, 0xc1, 0x17, 0xae, 0x09, 0xc1, 0x17, 0xb8, 0x0d,
+    0xc1, 0x17, 0xc8, 0x83, 0x08, 0x95, 0x83, 0x01, 0x17, 0xd2, 0x91, 0x08,
+    0x95, 0xc1, 0x87, 0x08, 0x95, 0xb1, 0x97, 0x08, 0x95, 0xa3, 0x01, 0x17,
+    0xde, 0x8b, 0x08, 0x95, 0x92, 0x01, 0x17, 0xe2, 0x44, 0x00, 0xbb, 0xc1,
+    0x17, 0xe6, 0xcb, 0x45, 0x8e, 0x08, 0x91, 0xd8, 0x46, 0x00, 0x59, 0xc1,
+    0x17, 0xfc, 0xc4, 0x19, 0x53, 0x08, 0x91, 0xc0, 0x03, 0xc1, 0x18, 0x08,
+    0x91, 0x08, 0x91, 0x91, 0x87, 0x08, 0x91, 0x81, 0x97, 0x08, 0x91, 0x79,
+    0x8b, 0x08, 0x91, 0x6a, 0x01, 0x18, 0x14, 0x0e, 0xc1, 0x18, 0x18, 0xc2,
+    0x00, 0xd0, 0x08, 0x91, 0x51, 0xc2, 0x0d, 0xf6, 0x08, 0x91, 0x49, 0xc2,
+    0x02, 0x41, 0x08, 0x91, 0x41, 0xc2, 0x00, 0x39, 0x08, 0x91, 0x31, 0xc2,
+    0x19, 0x2c, 0x08, 0x91, 0x29, 0xc2, 0x01, 0xc3, 0x08, 0x91, 0x21, 0x04,
+    0xc1, 0x18, 0x22, 0x12, 0xc1, 0x18, 0x32, 0x10, 0xc1, 0x18, 0x3c, 0x06,
+    0xc1, 0x18, 0x52, 0x16, 0xc1, 0x18, 0x60, 0x0c, 0xc1, 0x18, 0x6e, 0x05,
+    0xc1, 0x18, 0x78, 0x09, 0xc1, 0x18, 0x82, 0x0d, 0xc1, 0x18, 0x92, 0x83,
+    0x08, 0x90, 0x03, 0x01, 0x18, 0x9c, 0x91, 0x08, 0x90, 0x31, 0x87, 0x08,
+    0x90, 0x21, 0x97, 0x08, 0x90, 0x19, 0x8b, 0x08, 0x90, 0x10, 0x46, 0x10,
+    0x79, 0xc1, 0x18, 0xa8, 0x44, 0x00, 0xbb, 0x41, 0x18, 0xc8, 0xc4, 0x26,
+    0x78, 0x00, 0xbf, 0x49, 0xc5, 0x06, 0xdb, 0x00, 0xbf, 0x41, 0x15, 0xc1,
+    0x19, 0x0a, 0x08, 0xc1, 0x19, 0x16, 0x16, 0xc1, 0x19, 0x22, 0xc3, 0x05,
+    0x14, 0x00, 0xbf, 0x09, 0xc4, 0x15, 0xe7, 0x00, 0xbf, 0x00, 0x45, 0x00,
+    0xba, 0xc1, 0x19, 0x2e, 0x4a, 0x9f, 0xf4, 0x41, 0x19, 0x4f, 0x13, 0xc1,
+    0x19, 0x57, 0xc2, 0x00, 0x35, 0x00, 0xbd, 0x6b, 0x01, 0x19, 0x73, 0xc2,
+    0x14, 0x98, 0x00, 0xbd, 0x5a, 0x01, 0x19, 0x77, 0xc2, 0x0f, 0x9a, 0x00,
+    0xbd, 0x11, 0x0e, 0xc1, 0x19, 0x7b, 0xc2, 0x00, 0xd0, 0x00, 0xbd, 0x01,
+    0x15, 0xc1, 0x19, 0x83, 0xc2, 0x17, 0xbd, 0x00, 0xbc, 0xe1, 0xc2, 0x00,
+    0x79, 0x00, 0xbc, 0xd1, 0xc2, 0x42, 0xcd, 0x00, 0xbc, 0xc9, 0xc2, 0x00,
+    0xa2, 0x00, 0xbc, 0xc1, 0x12, 0xc1, 0x19, 0x93, 0xc2, 0x01, 0x5d, 0x00,
+    0xbc, 0xa1, 0x10, 0xc1, 0x19, 0x9b, 0x16, 0xc1, 0x19, 0xb1, 0x06, 0xc1,
+    0x19, 0xc3, 0x05, 0xc1, 0x19, 0xcb, 0x0d, 0x41, 0x19, 0xd7, 0x0e, 0xc1,
+    0x19, 0xe3, 0x06, 0xc1, 0x19, 0xef, 0xc8, 0xb9, 0xf2, 0x08, 0x52, 0xa1,
+    0x05, 0xc1, 0x19, 0xf9, 0xcc, 0x12, 0x2d, 0x08, 0x52, 0x88, 0x44, 0x05,
+    0x14, 0xc1, 0x1a, 0x05, 0x16, 0x41, 0x1a, 0x11, 0xc4, 0x09, 0x9d, 0x08,
+    0x52, 0x19, 0x16, 0xc1, 0x1a, 0x1d, 0xc3, 0x05, 0x14, 0x08, 0x52, 0x00,
+    0xc5, 0x1e, 0x96, 0x08, 0x51, 0xf9, 0x45, 0x34, 0x70, 0x41, 0x1a, 0x29,
+    0x42, 0x00, 0x58, 0xc1, 0x1a, 0x35, 0xc5, 0xdc, 0xd1, 0x08, 0x51, 0xc9,
+    0xc9, 0x31, 0x98, 0x08, 0x51, 0xc1, 0xc7, 0x40, 0xe5, 0x08, 0x50, 0x79,
+    0xc8, 0x14, 0x38, 0x08, 0x50, 0x70, 0x18, 0xc1, 0x1a, 0x41, 0x16, 0xc1,
+    0x1a, 0x4b, 0xc2, 0x00, 0xdb, 0x08, 0x51, 0x59, 0xc2, 0x00, 0x39, 0x08,
+    0x51, 0x51, 0xc2, 0x19, 0x2c, 0x08, 0x51, 0x49, 0xc2, 0x01, 0xc3, 0x08,
+    0x51, 0x41, 0x04, 0xc1, 0x1a, 0x59, 0x12, 0xc1, 0x1a, 0x63, 0x10, 0xc1,
+    0x1a, 0x6d, 0x06, 0xc1, 0x1a, 0x7d, 0xc2, 0x25, 0x3b, 0x08, 0x50, 0xb9,
+    0x05, 0xc1, 0x1a, 0x8b, 0x09, 0xc1, 0x1a, 0x95, 0x0d, 0xc1, 0x1a, 0x9f,
+    0x83, 0x08, 0x50, 0x01, 0x15, 0xc1, 0x1a, 0xaf, 0xc2, 0x02, 0x1c, 0x08,
+    0x51, 0x81, 0xc2, 0x00, 0xd0, 0x08, 0x51, 0x88, 0xc4, 0x00, 0x87, 0x0f,
+    0xb0, 0xbb, 0x01, 0x1a, 0xbf, 0xd9, 0x20, 0x8f, 0x0f, 0xb1, 0xe8, 0xc9,
+    0xb0, 0x11, 0x0f, 0xd4, 0x31, 0xca, 0xa6, 0x3e, 0x0f, 0xd5, 0xd0, 0x46,
+    0xcc, 0x4d, 0xc1, 0x1a, 0xc5, 0xc4, 0x00, 0x87, 0x0f, 0xb0, 0x80, 0x15,
+    0xc1, 0x1a, 0xfc, 0x47, 0x02, 0x0e, 0xc1, 0x1b, 0x06, 0xce, 0x6c, 0x52,
+    0x08, 0xa2, 0xe9, 0xd0, 0x5f, 0x92, 0x08, 0xa2, 0xd9, 0x06, 0xc1, 0x1b,
+    0x6d, 0xd1, 0x50, 0xce, 0x08, 0xa2, 0x79, 0xca, 0x93, 0x30, 0x08, 0xa2,
+    0x71, 0xc5, 0x0a, 0x8a, 0x08, 0xa2, 0x69, 0xc2, 0x00, 0x7a, 0x08, 0xa2,
+    0x49, 0x4b, 0x6f, 0xc7, 0x41, 0x1b, 0x7f, 0xcb, 0x99, 0xe4, 0x01, 0x05,
+    0x51, 0x48, 0xb6, 0x82, 0xc1, 0x1b, 0x9f, 0x45, 0x15, 0xdb, 0xc1, 0x1b,
+    0xbe, 0xc4, 0x02, 0x6d, 0x00, 0x00, 0x50, 0xc4, 0x00, 0x49, 0x01, 0x5c,
+    0x91, 0xc5, 0x00, 0x2c, 0x01, 0x5c, 0x98, 0x48, 0x0b, 0x09, 0xc1, 0x1b,
+    0xca, 0x48, 0x20, 0x7c, 0xc1, 0x1b, 0xfa, 0xcb, 0x49, 0x4a, 0x00, 0x00,
+    0xa9, 0x49, 0x1e, 0x56, 0x41, 0x1c, 0x18, 0xe0, 0x05, 0x87, 0x01, 0x15,
+    0x78, 0x43, 0x07, 0x28, 0xc1, 0x1c, 0x2a, 0x42, 0x02, 0xaf, 0x41, 0x1c,
+    0x36, 0xc9, 0x00, 0xca, 0x01, 0x13, 0xc9, 0x43, 0x00, 0xe2, 0x41, 0x1c,
+    0x3c, 0xcc, 0x07, 0xc7, 0x01, 0x13, 0xc1, 0x43, 0x00, 0xe2, 0x41, 0x1c,
+    0x48, 0x4b, 0x6f, 0xc7, 0xc1, 0x1c, 0x54, 0xca, 0x9d, 0x56, 0x08, 0xcf,
+    0x19, 0x45, 0x00, 0xba, 0xc1, 0x1c, 0x7d, 0x47, 0x02, 0x0e, 0x41, 0x1c,
+    0x8d, 0x47, 0x34, 0x2f, 0xc1, 0x1c, 0xf0, 0xd5, 0x34, 0x25, 0x08, 0x45,
+    0x59, 0x47, 0x02, 0x0e, 0x41, 0x1d, 0x01, 0xd4, 0x3a, 0x48, 0x0f, 0xb5,
+    0x89, 0xcf, 0x67, 0x83, 0x01, 0x00, 0x88, 0x00, 0xc1, 0x1d, 0x6a, 0xd6,
+    0x2e, 0x12, 0x0f, 0xb7, 0x50, 0xcc, 0x23, 0x9f, 0x01, 0x15, 0xa0, 0xe0,
+    0x02, 0xc7, 0x0f, 0xaa, 0x21, 0x0e, 0xc1, 0x1d, 0x7c, 0x4b, 0x2c, 0x44,
+    0x41, 0x1d, 0x88, 0xca, 0xa7, 0xc4, 0x01, 0x1b, 0xd9, 0xd2, 0x4c, 0x01,
+    0x01, 0x17, 0x53, 0x01, 0x1d, 0x8e, 0x15, 0xc1, 0x1d, 0x94, 0x16, 0xc1,
+    0x1d, 0xa0, 0x03, 0xc1, 0x1d, 0xac, 0xcc, 0x07, 0xc7, 0x01, 0x13, 0x79,
+    0xc9, 0x00, 0xca, 0x01, 0x13, 0x71, 0x43, 0x00, 0xe2, 0xc1, 0x1d, 0xc4,
+    0xcc, 0x89, 0x0d, 0x01, 0x13, 0x11, 0xcb, 0x6b, 0x83, 0x01, 0x11, 0x30,
+    0x43, 0x00, 0xaf, 0xc1, 0x1d, 0xd0, 0xc4, 0xe3, 0x33, 0x0f, 0xa6, 0x9a,
+    0x01, 0x1d, 0xda, 0xc5, 0x00, 0xb9, 0x0f, 0xb5, 0x58, 0xc5, 0xd5, 0x1a,
+    0x0f, 0xab, 0x91, 0xca, 0xa2, 0x56, 0x0f, 0xb5, 0xb8, 0xc9, 0xa9, 0xa2,
+    0x00, 0x04, 0x19, 0xc7, 0xc9, 0x50, 0x0f, 0xb5, 0x98, 0x99, 0x0f, 0x09,
+    0x61, 0x87, 0x0f, 0x09, 0x53, 0x01, 0x1d, 0xe0, 0x91, 0x0f, 0x09, 0x43,
+    0x01, 0x1d, 0xe4, 0x97, 0x0f, 0x09, 0x39, 0x8b, 0x0f, 0x09, 0x31, 0x83,
+    0x0f, 0x09, 0x23, 0x01, 0x1d, 0xe8, 0x14, 0xc1, 0x1d, 0xec, 0xc2, 0x01,
+    0x30, 0x0f, 0x09, 0x11, 0x12, 0xc1, 0x1d, 0xf6, 0x0f, 0xc1, 0x1e, 0x00,
+    0xc2, 0x00, 0xd0, 0x0f, 0x08, 0x23, 0x01, 0x1e, 0x0a, 0x10, 0xc1, 0x1e,
+    0x0e, 0x06, 0xc1, 0x1e, 0x38, 0x1a, 0xc1, 0x1e, 0x42, 0xc2, 0x19, 0x2c,
+    0x0f, 0x08, 0xc1, 0xc2, 0x0f, 0x9a, 0x0f, 0x08, 0xb9, 0xc2, 0x00, 0x87,
+    0x0f, 0x08, 0xa9, 0x16, 0xc1, 0x1e, 0x4c, 0xc2, 0x02, 0x41, 0x0f, 0x08,
+    0x91, 0xc2, 0x02, 0x2b, 0x0f, 0x08, 0x71, 0xc2, 0x02, 0x1c, 0x0f, 0x08,
+    0x59, 0xc2, 0x0d, 0xf6, 0x0f, 0x08, 0x51, 0xc2, 0x00, 0xdb, 0x0f, 0x08,
+    0x49, 0xc2, 0x00, 0x64, 0x0f, 0x08, 0x40, 0xc4, 0x18, 0x10, 0x0f, 0x0a,
+    0x39, 0xc2, 0x22, 0xcc, 0x0f, 0x0a, 0x30, 0xc3, 0x0d, 0x14, 0x0f, 0x0a,
+    0x29, 0xc3, 0x09, 0x9e, 0x0f, 0x0a, 0x20, 0xc4, 0x02, 0xde, 0x0f, 0x0a,
+    0x19, 0xc2, 0x02, 0xa0, 0x0f, 0x0a, 0x10, 0xc5, 0xd7, 0xdb, 0x0f, 0x09,
+    0xe1, 0x44, 0x15, 0xec, 0x41, 0x1e, 0x5c, 0x1f, 0xc1, 0x1e, 0x7a, 0x1e,
+    0x41, 0x1e, 0xba, 0x16, 0xc1, 0x1e, 0xde, 0xd2, 0x4b, 0x5f, 0x01, 0x24,
+    0xd1, 0x07, 0xc1, 0x1e, 0xf0, 0x15, 0xc1, 0x1e, 0xfc, 0x08, 0x41, 0x1f,
+    0x06, 0xc4, 0x25, 0xd5, 0x01, 0x50, 0x21, 0xc3, 0x02, 0xa3, 0x01, 0x50,
+    0x18, 0xce, 0x6d, 0x24, 0x01, 0x50, 0x31, 0xd5, 0x33, 0x68, 0x01, 0x50,
+    0x28, 0xce, 0x72, 0xd4, 0x01, 0x50, 0x11, 0xcd, 0x7d, 0x51, 0x01, 0x50,
+    0x09, 0xcc, 0x83, 0x3d, 0x01, 0x50, 0x00, 0xc4, 0x26, 0x78, 0x00, 0x3e,
+    0x49, 0xc5, 0x06, 0xdb, 0x00, 0x3e, 0x41, 0x15, 0xc1, 0x1f, 0x12, 0x08,
+    0xc1, 0x1f, 0x1e, 0x16, 0xc1, 0x1f, 0x2a, 0xc3, 0x05, 0x14, 0x00, 0x3e,
+    0x09, 0xc4, 0x15, 0xe7, 0x00, 0x3e, 0x00, 0x0c, 0xc1, 0x1f, 0x36, 0x90,
+    0x00, 0x3e, 0x93, 0x01, 0x1f, 0x40, 0xc2, 0x19, 0x2c, 0x00, 0x3f, 0x31,
+    0xc2, 0x01, 0x4a, 0x00, 0x3f, 0x29, 0xc2, 0x00, 0xd0, 0x00, 0x3f, 0x21,
+    0xc2, 0x01, 0xc3, 0x00, 0x3f, 0x09, 0xc2, 0x00, 0xdb, 0x00, 0x3e, 0xf9,
+    0xc2, 0x02, 0x2b, 0x00, 0x3e, 0xf1, 0xc2, 0x00, 0x87, 0x00, 0x3e, 0xe9,
+    0xc3, 0x9f, 0x2c, 0x00, 0x3e, 0xe1, 0xc2, 0x0d, 0xf6, 0x00, 0x3e, 0xd9,
+    0x14, 0xc1, 0x1f, 0x50, 0xc2, 0x0e, 0x9a, 0x00, 0x3e, 0xc3, 0x01, 0x1f,
+    0x5a, 0xc3, 0x1c, 0x63, 0x00, 0x3e, 0xb9, 0xc2, 0x01, 0x6f, 0x00, 0x3e,
+    0xa9, 0xc2, 0x00, 0xb0, 0x00, 0x3e, 0xa1, 0xc2, 0x01, 0x5d, 0x00, 0x3e,
+    0x99, 0x91, 0x00, 0x3e, 0x83, 0x01, 0x1f, 0x60, 0x97, 0x00, 0x3e, 0x71,
+    0x87, 0x00, 0x3e, 0x6b, 0x01, 0x1f, 0x64, 0x8b, 0x00, 0x3e, 0x61, 0x83,
+    0x00, 0x3e, 0x50, 0xd0, 0x57, 0xd2, 0x00, 0x3f, 0x99, 0xd1, 0x56, 0xc8,
+    0x00, 0x3f, 0x91, 0x45, 0x2c, 0x86, 0xc1, 0x1f, 0x68, 0x46, 0x2e, 0xee,
+    0x41, 0x1f, 0x80, 0xc6, 0x52, 0xa4, 0x0f, 0xd3, 0x59, 0xc5, 0xd8, 0xda,
+    0x0f, 0xd3, 0x60, 0xc6, 0x52, 0xa4, 0x0f, 0xd3, 0x21, 0xc5, 0xd8, 0xda,
+    0x0f, 0xd3, 0x28, 0xc8, 0xbd, 0x32, 0x0f, 0xcd, 0x81, 0xca, 0xa5, 0xd0,
+    0x0f, 0xcd, 0x89, 0xc4, 0xe1, 0xeb, 0x0f, 0xcd, 0x91, 0xca, 0xa6, 0xb6,
+    0x0f, 0xcd, 0x98, 0xa3, 0x0f, 0x9f, 0xf9, 0xa2, 0x0f, 0x9f, 0xf1, 0xa1,
+    0x0f, 0x9f, 0xe9, 0xa0, 0x0f, 0x9f, 0xe1, 0xc3, 0xe5, 0xfc, 0x0f, 0x9f,
+    0xd8, 0xc3, 0x0e, 0xa7, 0x01, 0x10, 0x2b, 0x01, 0x1f, 0x92, 0xc4, 0x9b,
+    0xb8, 0x0f, 0xae, 0x63, 0x01, 0x1f, 0x98, 0xc8, 0xb9, 0xb2, 0x0f, 0xae,
+    0x59, 0x10, 0x41, 0x1f, 0x9c, 0x42, 0x09, 0xda, 0x41, 0x1f, 0xab, 0x43,
+    0x00, 0x55, 0xc1, 0x1f, 0xb7, 0xd0, 0x5e, 0x92, 0x0f, 0xcd, 0xd8, 0xca,
+    0xa5, 0x58, 0x09, 0xa1, 0xc1, 0x1d, 0x41, 0x1f, 0xc3, 0xcc, 0x82, 0x41,
+    0x09, 0xa1, 0xb9, 0x42, 0xcf, 0x41, 0x41, 0x1f, 0xd3, 0xcd, 0x76, 0x42,
+    0x09, 0xa1, 0xb1, 0x1d, 0x41, 0x1f, 0xfa, 0x49, 0xaf, 0xb7, 0xc1, 0x20,
+    0x12, 0x1d, 0x41, 0x20, 0x1e, 0xd0, 0x59, 0xc2, 0x09, 0xa1, 0x89, 0x42,
+    0xcf, 0x41, 0x41, 0x20, 0x26, 0xce, 0x70, 0x6c, 0x09, 0xa1, 0x81, 0x1d,
+    0x41, 0x20, 0x49, 0x42, 0xd1, 0x3e, 0xc1, 0x20, 0x62, 0x1d, 0x41, 0x20,
+    0x72, 0x1e, 0xc1, 0x20, 0x94, 0x1d, 0x41, 0x20, 0xb6, 0xa5, 0x09, 0x9f,
+    0x19, 0xa4, 0x09, 0x9f, 0x11, 0xa3, 0x09, 0x9f, 0x09, 0xa2, 0x09, 0x9f,
+    0x01, 0xa1, 0x09, 0x9e, 0xf9, 0xa0, 0x09, 0x9e, 0xf1, 0x9f, 0x09, 0x9e,
+    0xe9, 0x9e, 0x09, 0x9e, 0xda, 0x01, 0x20, 0xe6, 0xa5, 0x09, 0x9e, 0xcb,
+    0x01, 0x20, 0xea, 0xa4, 0x09, 0x9e, 0xc1, 0xa3, 0x09, 0x9e, 0xb3, 0x01,
+    0x20, 0xee, 0xa2, 0x09, 0x9e, 0xa9, 0xa1, 0x09, 0x9e, 0x93, 0x01, 0x20,
+    0xf2, 0xa0, 0x09, 0x9e, 0x89, 0x9f, 0x09, 0x9e, 0x81, 0x9e, 0x09, 0x9e,
+    0x78, 0x1f, 0xc1, 0x20, 0xfa, 0x1e, 0xc1, 0x21, 0x15, 0x1d, 0x41, 0x21,
+    0x49, 0x21, 0xc1, 0x21, 0x73, 0x20, 0xc1, 0x21, 0x7f, 0x1f, 0xc1, 0x21,
+    0xaa, 0x1e, 0xc1, 0x21, 0xd8, 0x1d, 0x41, 0x22, 0x00, 0x20, 0xc1, 0x22,
+    0x27, 0x1f, 0xc1, 0x22, 0x49, 0x1e, 0xc1, 0x22, 0x71, 0x1d, 0x41, 0x22,
+    0x9f, 0x21, 0xc1, 0x22, 0xcf, 0x20, 0xc1, 0x22, 0xeb, 0x1f, 0xc1, 0x23,
+    0x16, 0x1e, 0xc1, 0x23, 0x41, 0x1d, 0x41, 0x23, 0x6f, 0x1f, 0xc1, 0x23,
+    0x99, 0x1e, 0xc1, 0x23, 0xc1, 0x1d, 0x41, 0x23, 0xef, 0xa4, 0x09, 0x95,
+    0x71, 0xa3, 0x09, 0x95, 0x69, 0xa2, 0x09, 0x95, 0x61, 0xa1, 0x09, 0x95,
+    0x59, 0xa0, 0x09, 0x95, 0x51, 0x9f, 0x09, 0x95, 0x49, 0x9e, 0x09, 0x95,
+    0x40, 0x1e, 0xc1, 0x24, 0x19, 0x1d, 0x41, 0x24, 0x21, 0x42, 0xdd, 0x2f,
+    0xc1, 0x24, 0x4b, 0x42, 0x8c, 0xff, 0xc1, 0x24, 0x57, 0x1d, 0x41, 0x24,
+    0x65, 0x21, 0xc1, 0x24, 0x79, 0x20, 0xc1, 0x24, 0x90, 0x1f, 0xc1, 0x24,
+    0xbe, 0x1e, 0xc1, 0x24, 0xef, 0x1d, 0x41, 0x25, 0x26, 0xa5, 0x09, 0x8d,
+    0x61, 0xa4, 0x09, 0x8d, 0x59, 0xa3, 0x09, 0x8d, 0x4b, 0x01, 0x25, 0x50,
+    0xa2, 0x09, 0x8d, 0x41, 0xa1, 0x09, 0x8d, 0x39, 0xa0, 0x09, 0x8d, 0x31,
+    0x9f, 0x09, 0x8d, 0x23, 0x01, 0x25, 0x54, 0x9e, 0x09, 0x8d, 0x18, 0xa5,
+    0x09, 0x8d, 0x11, 0xa4, 0x09, 0x8d, 0x09, 0xa3, 0x09, 0x8d, 0x01, 0xa2,
+    0x09, 0x8c, 0xf9, 0xa1, 0x09, 0x8c, 0xf1, 0xa0, 0x09, 0x8c, 0xe9, 0x9f,
+    0x09, 0x8c, 0xe1, 0x9e, 0x09, 0x8c, 0xd8, 0x22, 0xc1, 0x25, 0x58, 0x21,
+    0xc1, 0x25, 0x6c, 0x20, 0xc1, 0x25, 0x9a, 0x1f, 0xc1, 0x25, 0xc8, 0x1e,
+    0xc1, 0x25, 0xf6, 0x1d, 0x41, 0x26, 0x21, 0x22, 0xc1, 0x26, 0x4b, 0x21,
+    0xc1, 0x26, 0x5e, 0x20, 0xc1, 0x26, 0x8f, 0x1f, 0xc1, 0x26, 0xc0, 0x1e,
+    0xc1, 0x26, 0xeb, 0x1d, 0x41, 0x27, 0x16, 0x23, 0xc1, 0x27, 0x3d, 0x22,
+    0xc1, 0x27, 0x60, 0x21, 0xc1, 0x27, 0x91, 0x20, 0xc1, 0x27, 0xbf, 0x1f,
+    0xc1, 0x27, 0xed, 0x1e, 0xc1, 0x28, 0x18, 0x1d, 0x41, 0x28, 0x40, 0x1f,
+    0xc1, 0x28, 0x67, 0x1e, 0xc1, 0x28, 0x7b, 0x1d, 0x41, 0x28, 0xa6, 0x4c,
+    0x84, 0x69, 0xc1, 0x28, 0xcd, 0xd2, 0x48, 0x35, 0x0f, 0xa3, 0xe8, 0xc4,
+    0x26, 0x78, 0x00, 0x37, 0xc9, 0xc5, 0x06, 0xdb, 0x00, 0x37, 0xc1, 0x15,
+    0xc1, 0x28, 0xe3, 0x08, 0xc1, 0x28, 0xef, 0x16, 0xc1, 0x28, 0xfb, 0xc3,
+    0x05, 0x14, 0x00, 0x37, 0x89, 0xc4, 0x15, 0xe7, 0x00, 0x37, 0x80, 0xcd,
+    0x2c, 0xb2, 0x01, 0x02, 0x49, 0xc4, 0x01, 0xc3, 0x00, 0x01, 0x08, 0x09,
+    0xc1, 0x29, 0x07, 0x0a, 0xc1, 0x29, 0x39, 0x04, 0xc1, 0x29, 0x5a, 0x05,
+    0xc1, 0x29, 0x7f, 0x06, 0xc1, 0x29, 0xaa, 0x16, 0xc1, 0x29, 0xd5, 0x0e,
+    0xc1, 0x2a, 0x0a, 0x0f, 0xc1, 0x2a, 0x2d, 0x15, 0xc1, 0x2a, 0x54, 0x14,
+    0xc1, 0x2a, 0x83, 0x13, 0xc1, 0x2a, 0xac, 0x18, 0xc1, 0x2a, 0xd5, 0x1a,
+    0xc1, 0x2a, 0xf5, 0x10, 0xc1, 0x2b, 0x1a, 0x0d, 0xc1, 0x2b, 0x41, 0x19,
+    0xc1, 0x2b, 0x6a, 0x12, 0xc1, 0x2b, 0x87, 0x1c, 0xc1, 0x2b, 0xac, 0x1b,
+    0xc1, 0x2b, 0xd7, 0x0c, 0xc1, 0x2b, 0xf4, 0x08, 0x41, 0x2c, 0x17, 0xca,
+    0x45, 0x8f, 0x00, 0x9b, 0x01, 0xc7, 0x52, 0x01, 0x00, 0x9b, 0x20, 0x47,
+    0x1d, 0xd4, 0xc1, 0x2c, 0x3b, 0xc2, 0x01, 0xc3, 0x00, 0x9b, 0x18, 0xc2,
+    0x02, 0xa0, 0x00, 0x9b, 0x51, 0xc4, 0x02, 0xde, 0x00, 0x9b, 0x58, 0xc3,
+    0x09, 0x9e, 0x00, 0x9b, 0x61, 0xc3, 0x0d, 0x14, 0x00, 0x9b, 0x68, 0xc2,
+    0x22, 0xcc, 0x00, 0x9b, 0x71, 0xc4, 0x18, 0x10, 0x00, 0x9b, 0x78, 0xc2,
+    0x00, 0xc4, 0x00, 0x9b, 0x93, 0x01, 0x2c, 0x47, 0xc5, 0x28, 0xee, 0x00,
+    0x9b, 0x99, 0xc5, 0x0d, 0x0d, 0x00, 0x9b, 0xa0, 0xc4, 0x4a, 0x2e, 0x00,
+    0x9b, 0xa9, 0xc4, 0x45, 0x6a, 0x00, 0x9b, 0xb0, 0xc4, 0xd2, 0x1d, 0x00,
+    0x9b, 0xb9, 0xc6, 0x18, 0x10, 0x00, 0x9b, 0xc0, 0xc4, 0xb4, 0x50, 0x00,
+    0x9c, 0x8b, 0x01, 0x2c, 0x4d, 0xc4, 0xe1, 0x33, 0x00, 0x9c, 0xa0, 0xc4,
+    0x59, 0x96, 0x00, 0x9c, 0xa9, 0xc3, 0x34, 0x38, 0x00, 0x9c, 0xc8, 0x00,
+    0x41, 0x2c, 0x53, 0xcf, 0x44, 0x5a, 0x01, 0x1f, 0x39, 0x00, 0x41, 0x2c,
+    0x5f, 0x16, 0xc1, 0x2c, 0x77, 0x15, 0xc1, 0x2c, 0x83, 0xc4, 0x5d, 0xe2,
+    0x08, 0x7f, 0x99, 0xc4, 0xb9, 0x7e, 0x08, 0x7f, 0x91, 0xc2, 0x00, 0x67,
+    0x08, 0x7f, 0x81, 0xc3, 0x20, 0x18, 0x08, 0x7f, 0x69, 0xc3, 0x00, 0x4e,
+    0x08, 0x7f, 0x61, 0xc6, 0xcf, 0xd7, 0x08, 0x7f, 0x59, 0xc4, 0xe0, 0xe7,
+    0x08, 0x7f, 0x51, 0xc4, 0x4a, 0xb9, 0x08, 0x7f, 0x49, 0xc2, 0x01, 0x7f,
+    0x08, 0x7f, 0x23, 0x01, 0x2c, 0x8d, 0xc5, 0x4a, 0xb3, 0x08, 0x7f, 0x31,
+    0xc3, 0x7e, 0x89, 0x08, 0x7f, 0x29, 0xc6, 0x40, 0x9a, 0x08, 0x7f, 0x19,
+    0xc5, 0x9c, 0xa2, 0x08, 0x7f, 0x11, 0xc4, 0xe3, 0x27, 0x08, 0x7f, 0x09,
+    0x03, 0x41, 0x2c, 0x93, 0x87, 0x08, 0x28, 0x11, 0xc2, 0x01, 0x7f, 0x08,
+    0x28, 0x18, 0x87, 0x08, 0x28, 0x21, 0xc2, 0x01, 0x7f, 0x08, 0x28, 0x30,
+    0xc2, 0x00, 0x06, 0x08, 0x28, 0x29, 0x87, 0x08, 0x28, 0x99, 0x83, 0x08,
+    0x28, 0xa1, 0xc2, 0x1c, 0x52, 0x08, 0x28, 0xa8, 0x8b, 0x08, 0x28, 0x38,
+    0x87, 0x08, 0x28, 0x51, 0xc2, 0x1c, 0x52, 0x08, 0x28, 0x59, 0x0a, 0x41,
+    0x2c, 0x9f, 0x87, 0x08, 0x28, 0x79, 0xc2, 0x01, 0x7f, 0x08, 0x29, 0x38,
+    0x87, 0x08, 0x28, 0x81, 0xc2, 0x00, 0x49, 0x08, 0x28, 0x88, 0x87, 0x08,
+    0x28, 0xc9, 0xc2, 0x01, 0x19, 0x08, 0x28, 0xd0, 0x87, 0x08, 0x28, 0xd9,
+    0xc2, 0x01, 0x7f, 0x08, 0x28, 0xe0, 0x87, 0x08, 0x28, 0xe9, 0xc2, 0x01,
+    0x7f, 0x08, 0x28, 0xf0, 0x87, 0x08, 0x29, 0x19, 0xc2, 0x01, 0x7f, 0x08,
+    0x29, 0x20, 0xe0, 0x0a, 0xe7, 0x01, 0x3a, 0x50, 0xdf, 0x0c, 0x46, 0x01,
+    0x3a, 0x09, 0x47, 0x0a, 0xaa, 0x41, 0x2c, 0xa9, 0xc9, 0xad, 0xe3, 0x0f,
+    0xac, 0x21, 0xd5, 0x31, 0xd9, 0x0f, 0xa7, 0x48, 0x43, 0x05, 0xc0, 0xc1,
+    0x2c, 0xbb, 0xc6, 0x01, 0xdb, 0x00, 0x00, 0xc9, 0x16, 0xc1, 0x2c, 0xc7,
+    0xc4, 0x02, 0x6d, 0x00, 0x00, 0x51, 0xcd, 0x7e, 0x48, 0x00, 0x04, 0x39,
+    0xcc, 0x87, 0xc9, 0x00, 0x04, 0xb8, 0xc6, 0x02, 0xd1, 0x01, 0x4f, 0x99,
+    0xc7, 0x3a, 0x19, 0x01, 0x4f, 0x89, 0xc6, 0x0b, 0x09, 0x01, 0x4f, 0x78,
+    0xc6, 0x02, 0xd1, 0x01, 0x4f, 0x91, 0xc7, 0x3a, 0x19, 0x01, 0x4f, 0x81,
+    0xc6, 0x0b, 0x09, 0x01, 0x4f, 0x70, 0x43, 0x01, 0x7b, 0xc1, 0x2c, 0xd6,
+    0xcf, 0x6b, 0x7f, 0x01, 0x16, 0xa8, 0xc5, 0x33, 0x24, 0x01, 0x12, 0xa9,
+    0xc4, 0x00, 0xba, 0x00, 0x01, 0xeb, 0x01, 0x2c, 0xe2, 0xcd, 0x7c, 0x33,
+    0x01, 0x53, 0x70, 0xc2, 0x00, 0xf1, 0x01, 0x12, 0x69, 0xd4, 0x3b, 0x74,
+    0x01, 0x53, 0xc0, 0xcb, 0x95, 0x6c, 0x0f, 0x9f, 0x21, 0xc6, 0xcd, 0x2b,
+    0x0f, 0x9f, 0x80, 0xc4, 0x26, 0x78, 0x08, 0xed, 0x49, 0xc5, 0x06, 0xdb,
+    0x08, 0xed, 0x41, 0x15, 0xc1, 0x2c, 0xe6, 0x08, 0xc1, 0x2c, 0xf2, 0x16,
+    0xc1, 0x2c, 0xfe, 0xc3, 0x05, 0x14, 0x08, 0xed, 0x09, 0xc4, 0x15, 0xe7,
+    0x08, 0xed, 0x00, 0xc5, 0x1e, 0x96, 0x08, 0xec, 0xb9, 0x4a, 0x6f, 0xc8,
+    0x41, 0x2d, 0x0a, 0xc7, 0x40, 0xe5, 0x08, 0xec, 0xb1, 0xc8, 0x14, 0x38,
+    0x08, 0xec, 0xa8, 0xc2, 0x0d, 0xf6, 0x08, 0xec, 0x49, 0xc2, 0x00, 0x39,
+    0x08, 0xec, 0x41, 0xc2, 0x00, 0xd0, 0x08, 0xec, 0x39, 0x12, 0xc1, 0x2d,
+    0x28, 0x10, 0xc1, 0x2d, 0x32, 0x06, 0xc1, 0x2d, 0x3c, 0x0c, 0xc1, 0x2d,
+    0x4a, 0x0e, 0xc1, 0x2d, 0x54, 0x16, 0xc1, 0x2d, 0x5e, 0x05, 0xc1, 0x2d,
+    0x6c, 0x09, 0xc1, 0x2d, 0x76, 0x0d, 0xc1, 0x2d, 0x80, 0xc2, 0x01, 0xc3,
+    0x08, 0xeb, 0x81, 0x04, 0xc1, 0x2d, 0x8a, 0xc2, 0x02, 0x41, 0x08, 0xeb,
+    0x69, 0xc2, 0x19, 0x2c, 0x08, 0xeb, 0x61, 0x83, 0x08, 0xeb, 0x03, 0x01,
+    0x2d, 0x94, 0xc2, 0x01, 0x24, 0x08, 0xeb, 0x51, 0xc2, 0x02, 0xe0, 0x08,
+    0xeb, 0x39, 0x97, 0x08, 0xeb, 0x23, 0x01, 0x2d, 0xa0, 0x8b, 0x08, 0xeb,
+    0x12, 0x01, 0x2d, 0xa4, 0xca, 0xa6, 0x2a, 0x00, 0x50, 0x09, 0xc5, 0x60,
+    0x30, 0x00, 0x50, 0x11, 0x42, 0x07, 0xb2, 0xc1, 0x2d, 0xa8, 0xc5, 0x33,
+    0x5d, 0x00, 0x51, 0xe1, 0xc5, 0xd9, 0x5c, 0x00, 0x52, 0x89, 0xc6, 0xd3,
+    0x85, 0x00, 0x53, 0xa8, 0x83, 0x00, 0x50, 0x2b, 0x01, 0x2d, 0xb4, 0x8b,
+    0x00, 0x50, 0x3b, 0x01, 0x2d, 0xc0, 0x97, 0x00, 0x50, 0x4b, 0x01, 0x2d,
+    0xc4, 0xc2, 0x02, 0xe0, 0x00, 0x50, 0x79, 0xc2, 0x01, 0x24, 0x00, 0x50,
+    0x99, 0x0d, 0xc1, 0x2d, 0xc8, 0x09, 0xc1, 0x2d, 0xd0, 0x10, 0xc1, 0x2d,
+    0xd8, 0x05, 0xc1, 0x2d, 0xee, 0x0c, 0xc1, 0x2d, 0xf8, 0x16, 0xc1, 0x2e,
+    0x02, 0x06, 0xc1, 0x2e, 0x10, 0x12, 0xc1, 0x2e, 0x1e, 0x04, 0xc1, 0x2e,
+    0x28, 0xc2, 0x01, 0xc3, 0x00, 0x51, 0x71, 0xc2, 0x19, 0x2c, 0x00, 0x51,
+    0x79, 0x14, 0xc1, 0x2e, 0x32, 0x0e, 0xc1, 0x2e, 0x3c, 0xc2, 0x02, 0x41,
+    0x00, 0x51, 0xa9, 0x15, 0xc1, 0x2e, 0x46, 0xc2, 0x00, 0xd0, 0x00, 0x51,
+    0xc9, 0xc2, 0x02, 0x1c, 0x00, 0x52, 0xd9, 0xc2, 0x00, 0x87, 0x00, 0x52,
+    0xf0, 0x03, 0xc1, 0x2e, 0x50, 0x8b, 0x00, 0x51, 0xfb, 0x01, 0x2e, 0x5c,
+    0x97, 0x00, 0x52, 0x0b, 0x01, 0x2e, 0x60, 0xc2, 0x02, 0xe0, 0x00, 0x52,
+    0x39, 0xc2, 0x01, 0x24, 0x00, 0x52, 0x58, 0xc4, 0x15, 0xe7, 0x00, 0x53,
+    0x31, 0xc3, 0x05, 0x14, 0x00, 0x53, 0x39, 0x16, 0xc1, 0x2e, 0x64, 0x08,
+    0xc1, 0x2e, 0x70, 0x15, 0xc1, 0x2e, 0x7c, 0xc5, 0x06, 0xdb, 0x00, 0x53,
+    0x71, 0xc4, 0x26, 0x78, 0x00, 0x53, 0x78, 0xc4, 0xe3, 0x57, 0x00, 0x53,
+    0x89, 0xd0, 0x50, 0xcf, 0x00, 0x53, 0xb0, 0x05, 0xc1, 0x2e, 0x88, 0x03,
+    0xc1, 0x2e, 0x94, 0x42, 0x07, 0xb2, 0xc1, 0x2e, 0xa0, 0xc5, 0x33, 0x5d,
+    0x00, 0x55, 0xe1, 0x15, 0xc1, 0x2e, 0xac, 0xc6, 0xd2, 0x2f, 0x00, 0x57,
+    0xe1, 0x16, 0x41, 0x2e, 0xb8, 0x83, 0x00, 0x54, 0x2b, 0x01, 0x2e, 0xc4,
+    0x8b, 0x00, 0x54, 0x3b, 0x01, 0x2e, 0xd0, 0x97, 0x00, 0x54, 0x4b, 0x01,
+    0x2e, 0xd4, 0x18, 0xc1, 0x2e, 0xd8, 0x87, 0x00, 0x54, 0x79, 0x91, 0x00,
+    0x54, 0x99, 0x0d, 0xc1, 0x2e, 0xe2, 0x09, 0xc1, 0x2e, 0xec, 0x10, 0xc1,
+    0x2e, 0xf6, 0x05, 0xc1, 0x2f, 0x0c, 0x0c, 0xc1, 0x2f, 0x16, 0x16, 0xc1,
+    0x2f, 0x20, 0x06, 0xc1, 0x2f, 0x2e, 0x12, 0xc1, 0x2f, 0x3c, 0x04, 0xc1,
+    0x2f, 0x46, 0xc2, 0x01, 0xc3, 0x00, 0x55, 0x71, 0xc2, 0x19, 0x2c, 0x00,
+    0x55, 0x79, 0xc2, 0x00, 0x39, 0x00, 0x55, 0x81, 0x0e, 0xc1, 0x2f, 0x50,
+    0x15, 0xc1, 0x2f, 0x5a, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0xc9, 0xc3, 0xb4,
+    0xa6, 0x00, 0x57, 0xc8, 0x47, 0xc7, 0x7b, 0xc1, 0x2f, 0x6a, 0x45, 0x00,
+    0xba, 0x41, 0x2f, 0x72, 0xc4, 0x15, 0xe7, 0x00, 0x57, 0x31, 0xc3, 0x05,
+    0x14, 0x00, 0x57, 0x39, 0x16, 0xc1, 0x2f, 0x98, 0x08, 0xc1, 0x2f, 0xa4,
+    0x15, 0xc1, 0x2f, 0xb0, 0xc5, 0x06, 0xdb, 0x00, 0x57, 0x71, 0xc4, 0x26,
+    0x78, 0x00, 0x57, 0x78, 0xc5, 0xd7, 0xc2, 0x08, 0x19, 0xa1, 0xc3, 0x84,
+    0xf8, 0x08, 0x19, 0x80, 0xc3, 0xb6, 0x96, 0x08, 0x19, 0xb1, 0xc4, 0xe0,
+    0x9b, 0x08, 0x1a, 0x38, 0xc3, 0xdb, 0xd3, 0x08, 0x19, 0xb9, 0xc4, 0xde,
+    0xa3, 0x08, 0x1a, 0x40, 0xc5, 0xd5, 0x8d, 0x08, 0x19, 0xc1, 0xc4, 0xe2,
+    0xf3, 0x08, 0x1a, 0x20, 0xc5, 0xd6, 0x46, 0x08, 0x19, 0xe9, 0x43, 0x02,
+    0x6e, 0x41, 0x2f, 0xbc, 0x42, 0x01, 0x12, 0xc1, 0x2f, 0xc8, 0x42, 0x00,
+    0xbd, 0x41, 0x30, 0x32, 0x04, 0xc1, 0x30, 0x4a, 0xd5, 0x34, 0xe2, 0x01,
+    0x16, 0xd9, 0x45, 0x00, 0x8c, 0xc1, 0x30, 0x56, 0x11, 0xc1, 0x30, 0x68,
+    0x03, 0xc1, 0x30, 0x74, 0xc4, 0x00, 0xba, 0x00, 0x01, 0xf1, 0xcf, 0x69,
+    0x18, 0x01, 0x55, 0x3a, 0x01, 0x30, 0x80, 0x4b, 0x6f, 0xc7, 0xc1, 0x30,
+    0x86, 0x47, 0x02, 0x0e, 0xc1, 0x30, 0xaa, 0x45, 0x00, 0xba, 0xc1, 0x31,
+    0x13, 0xce, 0x73, 0x0c, 0x08, 0x9a, 0xb9, 0xc2, 0x00, 0x7a, 0x08, 0x9a,
+    0x80, 0xc4, 0x00, 0x87, 0x0f, 0xb0, 0x03, 0x01, 0x31, 0x2d, 0xda, 0x1d,
+    0x3c, 0x0f, 0xb1, 0xc0, 0xc9, 0x1b, 0x0a, 0x00, 0x00, 0xe9, 0xc4, 0x01,
+    0xc3, 0x01, 0x5e, 0x90, 0xc8, 0xbd, 0xd2, 0x01, 0x37, 0x71, 0xc7, 0xc5,
+    0x9f, 0x01, 0x37, 0x68, 0x48, 0x07, 0x5a, 0xc1, 0x31, 0x33, 0xcb, 0x94,
+    0x6f, 0x01, 0x11, 0xd0, 0x58, 0x22, 0x13, 0xc1, 0x31, 0x3f, 0x4f, 0x0b,
+    0x17, 0xc1, 0x31, 0xc5, 0x47, 0x02, 0x0e, 0xc1, 0x32, 0x49, 0xd3, 0x45,
+    0xf8, 0x00, 0x87, 0xd9, 0x4d, 0x29, 0xb9, 0x41, 0x32, 0xcf, 0xc8, 0x2f,
+    0x03, 0x0f, 0xb6, 0x50, 0x4f, 0x0b, 0x17, 0xc1, 0x33, 0x53, 0x4d, 0x29,
+    0xb9, 0x41, 0x33, 0xbc, 0xc4, 0xe3, 0x33, 0x0f, 0xa6, 0xc9, 0xc5, 0x1c,
+    0xae, 0x0f, 0xcf, 0x08, 0x45, 0x00, 0xba, 0xc1, 0x34, 0x25, 0x47, 0x02,
+    0x0e, 0xc1, 0x34, 0x41, 0x4b, 0x6f, 0xc7, 0xc1, 0x34, 0xa8, 0x03, 0xc1,
+    0x34, 0xc8, 0x46, 0x09, 0x97, 0xc1, 0x34, 0xd4, 0xc6, 0xd2, 0xcb, 0x00,
+    0x5b, 0x81, 0x49, 0x53, 0xa9, 0x41, 0x34, 0xf8, 0xc5, 0xd3, 0x5b, 0x0f,
+    0x69, 0xe9, 0xc4, 0x01, 0xce, 0x0f, 0x69, 0xe0, 0x16, 0xc1, 0x35, 0x04,
+    0x08, 0xc1, 0x35, 0x15, 0xc3, 0x05, 0x14, 0x0f, 0x68, 0x0b, 0x01, 0x35,
+    0x1d, 0x15, 0xc1, 0x35, 0x21, 0xc5, 0x06, 0xdb, 0x0f, 0x68, 0x43, 0x01,
+    0x35, 0x33, 0xc4, 0x26, 0x78, 0x0f, 0x68, 0x4a, 0x01, 0x35, 0x3e, 0x16,
+    0xc1, 0x35, 0x4b, 0x08, 0xc1, 0x35, 0x63, 0x15, 0xc1, 0x35, 0x72, 0xc5,
+    0x06, 0xdb, 0x0f, 0x69, 0xa9, 0xc4, 0x26, 0x78, 0x0f, 0x69, 0xb0, 0x44,
+    0x05, 0x18, 0xc1, 0x35, 0x81, 0xcc, 0x86, 0xfd, 0x0f, 0xad, 0x78, 0x00,
+    0xc1, 0x35, 0x8d, 0x02, 0x41, 0x35, 0xb5, 0xc5, 0xd7, 0xa4, 0x0f, 0xad,
+    0xc0, 0x48, 0xb5, 0xda, 0xc1, 0x35, 0xc1, 0x47, 0xc9, 0x88, 0xc1, 0x35,
+    0xcd, 0x42, 0x00, 0xfb, 0xc1, 0x35, 0xdf, 0x4a, 0x9d, 0xa6, 0xc1, 0x35,
+    0xeb, 0x4e, 0x70, 0xf8, 0xc1, 0x35, 0xfd, 0x4e, 0x72, 0x3a, 0xc1, 0x36,
+    0x09, 0xc3, 0x19, 0x2a, 0x0f, 0xae, 0xe9, 0x43, 0x00, 0x67, 0xc1, 0x36,
+    0x15, 0x47, 0xc7, 0x4a, 0x41, 0x36, 0x1f, 0xc5, 0x29, 0xfc, 0x0f, 0xa3,
+    0xa9, 0xc3, 0x12, 0xb8, 0x0f, 0xa3, 0xa1, 0xc5, 0xda, 0xa1, 0x0f, 0xce,
+    0x98, 0x4b, 0x11, 0xe3, 0xc1, 0x36, 0x2b, 0xc7, 0xc2, 0x42, 0x00, 0xe3,
+    0xe0, 0xd1, 0x4f, 0x36, 0x00, 0xe3, 0xd1, 0xc8, 0xb9, 0x9a, 0x00, 0xe3,
+    0xc0, 0x11, 0xc1, 0x36, 0x37, 0x0e, 0xc1, 0x36, 0x49, 0x07, 0xc1, 0x36,
+    0x60, 0x17, 0xc1, 0x36, 0x74, 0x0b, 0xc1, 0x36, 0x86, 0x03, 0x41, 0x36,
+    0x98, 0xc4, 0x26, 0x78, 0x00, 0xe2, 0xc9, 0xc5, 0x06, 0xdb, 0x00, 0xe2,
+    0xc1, 0x15, 0xc1, 0x36, 0xae, 0x08, 0xc1, 0x36, 0xba, 0x16, 0xc1, 0x36,
+    0xc6, 0xc3, 0x05, 0x14, 0x00, 0xe2, 0x89, 0xc4, 0x15, 0xe7, 0x00, 0xe2,
+    0x80, 0xca, 0x22, 0x51, 0x01, 0x39, 0x69, 0xcb, 0x8e, 0x08, 0x01, 0x38,
+    0xf9, 0xcb, 0x58, 0xc7, 0x01, 0x38, 0xc9, 0xca, 0x28, 0xc3, 0x01, 0x34,
+    0xe8, 0xcf, 0x63, 0x0f, 0x01, 0x22, 0x51, 0xc3, 0x02, 0x2c, 0x01, 0x22,
+    0x40, 0xd6, 0x2f, 0x1a, 0x01, 0x22, 0x49, 0xc4, 0x68, 0xba, 0x01, 0x22,
+    0x08, 0xd9, 0x1e, 0xcd, 0x01, 0x22, 0x31, 0xc6, 0xcb, 0x8d, 0x01, 0x22,
+    0x29, 0xca, 0xa5, 0xda, 0x01, 0x22, 0x20, 0xc4, 0x03, 0xc8, 0x01, 0x4d,
+    0x39, 0xc2, 0x02, 0xae, 0x01, 0x4d, 0x30, 0x45, 0x2a, 0xa0, 0x41, 0x36,
+    0xd2, 0xc5, 0xd4, 0x84, 0x00, 0xb4, 0xd1, 0x42, 0x01, 0x9c, 0xc1, 0x36,
+    0xde, 0x0b, 0xc1, 0x36, 0xf0, 0x17, 0xc1, 0x36, 0xfc, 0x11, 0xc1, 0x37,
+    0x0c, 0xc4, 0xe2, 0x6b, 0x00, 0xb4, 0x81, 0xc4, 0xde, 0x7f, 0x00, 0xb4,
+    0x79, 0x15, 0xc1, 0x37, 0x16, 0x10, 0xc1, 0x37, 0x22, 0xc4, 0xe0, 0x67,
+    0x00, 0xb4, 0x61, 0xc4, 0xe4, 0x13, 0x00, 0xb4, 0x59, 0x05, 0xc1, 0x37,
+    0x2e, 0xc5, 0xd6, 0xb4, 0x00, 0xb4, 0x41, 0xc4, 0xe3, 0x4f, 0x00, 0xb4,
+    0x39, 0xc5, 0xd3, 0xf3, 0x00, 0xb4, 0x19, 0xc4, 0xe4, 0xcb, 0x00, 0xb4,
+    0x11, 0xc5, 0xd7, 0x9a, 0x00, 0xb4, 0x08, 0x83, 0x08, 0x24, 0xb3, 0x01,
+    0x37, 0x3a, 0xc2, 0x01, 0x5d, 0x08, 0x24, 0x09, 0xc2, 0x01, 0x6f, 0x08,
+    0x24, 0x11, 0xc2, 0x25, 0x3b, 0x08, 0x24, 0x19, 0xc2, 0x8d, 0x8f, 0x08,
+    0x24, 0x21, 0x0d, 0xc1, 0x37, 0x44, 0x06, 0xc1, 0x37, 0x50, 0xc2, 0x00,
+    0x39, 0x08, 0x24, 0x39, 0x15, 0xc1, 0x37, 0x5c, 0xc4, 0xe3, 0x13, 0x08,
+    0x24, 0x59, 0xc2, 0x01, 0x30, 0x08, 0x24, 0x61, 0xc2, 0x00, 0x87, 0x08,
+    0x24, 0x69, 0xc4, 0xd8, 0x3a, 0x08, 0x24, 0x71, 0xc4, 0xe0, 0xd7, 0x08,
+    0x24, 0x81, 0xc4, 0xe4, 0xbb, 0x08, 0x24, 0x89, 0xc4, 0xb9, 0x50, 0x08,
+    0x24, 0x91, 0xc3, 0x7e, 0x89, 0x08, 0x24, 0x99, 0xc2, 0x00, 0xd0, 0x08,
+    0x24, 0xa1, 0xc2, 0x19, 0x2c, 0x08, 0x24, 0xa9, 0x87, 0x08, 0x24, 0xbb,
+    0x01, 0x37, 0x66, 0x8b, 0x08, 0x24, 0xc1, 0x91, 0x08, 0x24, 0xcb, 0x01,
+    0x37, 0x6a, 0x97, 0x08, 0x24, 0xd0, 0xc4, 0x15, 0xe7, 0x08, 0x25, 0x01,
+    0xc3, 0x05, 0x14, 0x08, 0x25, 0x09, 0x16, 0xc1, 0x37, 0x6e, 0x08, 0xc1,
+    0x37, 0x7a, 0x15, 0xc1, 0x37, 0x86, 0xc5, 0x06, 0xdb, 0x08, 0x25, 0x41,
+    0xc4, 0x26, 0x78, 0x08, 0x25, 0x48, 0x83, 0x08, 0x25, 0x83, 0x01, 0x37,
+    0x92, 0xc3, 0x00, 0x38, 0x08, 0x25, 0xa1, 0xc3, 0x1c, 0x63, 0x08, 0x25,
+    0xa9, 0x87, 0x08, 0x25, 0xbb, 0x01, 0x37, 0x9d, 0x0a, 0xc1, 0x37, 0xa7,
+    0x8b, 0x08, 0x25, 0xd9, 0x0d, 0xc1, 0x37, 0xb1, 0xc2, 0x00, 0xdb, 0x08,
+    0x25, 0xf9, 0xc2, 0x01, 0xc3, 0x08, 0x26, 0x01, 0xc2, 0x00, 0xc1, 0x08,
+    0x26, 0x09, 0x91, 0x08, 0x26, 0x13, 0x01, 0x37, 0xc1, 0xc2, 0x00, 0xb0,
+    0x08, 0x26, 0x21, 0x15, 0xc1, 0x37, 0xc7, 0x16, 0xc1, 0x37, 0xd1, 0xc3,
+    0x40, 0xe2, 0x08, 0x26, 0x69, 0x97, 0x08, 0x26, 0x71, 0xc2, 0x01, 0x4a,
+    0x08, 0x26, 0x79, 0xc3, 0x91, 0x00, 0x08, 0x26, 0x89, 0x1c, 0x41, 0x37,
+    0xd9, 0x83, 0x08, 0x26, 0xc3, 0x01, 0x37, 0xe3, 0xc3, 0x00, 0x38, 0x08,
+    0x26, 0xe1, 0xc3, 0x1c, 0x63, 0x08, 0x26, 0xe9, 0x87, 0x08, 0x26, 0xfb,
+    0x01, 0x37, 0xee, 0x0a, 0xc1, 0x37, 0xf8, 0x8b, 0x08, 0x27, 0x19, 0x0d,
+    0xc1, 0x38, 0x02, 0xc2, 0x00, 0xdb, 0x08, 0x27, 0x39, 0xc2, 0x01, 0xc3,
+    0x08, 0x27, 0x41, 0xc2, 0x00, 0xc1, 0x08, 0x27, 0x49, 0x91, 0x08, 0x27,
+    0x53, 0x01, 0x38, 0x12, 0xc2, 0x00, 0xb0, 0x08, 0x27, 0x61, 0x15, 0xc1,
+    0x38, 0x18, 0x16, 0xc1, 0x38, 0x22, 0xc3, 0x40, 0xe2, 0x08, 0x27, 0xa9,
+    0x97, 0x08, 0x27, 0xb1, 0xc2, 0x01, 0x4a, 0x08, 0x27, 0xb9, 0xc3, 0x91,
+    0x00, 0x08, 0x27, 0xc9, 0x1c, 0x41, 0x38, 0x2a, 0x03, 0xc1, 0x38, 0x34,
+    0x11, 0xc1, 0x38, 0x46, 0xc8, 0xbb, 0x2a, 0x0e, 0x7a, 0xc2, 0x01, 0x38,
+    0x52, 0xc3, 0x74, 0xc6, 0x0e, 0x7e, 0x09, 0x07, 0xc1, 0x38, 0x58, 0xcf,
+    0x58, 0xe3, 0x0e, 0x7b, 0x59, 0xcb, 0x95, 0x77, 0x0e, 0x7a, 0x98, 0xc5,
+    0xd5, 0x5b, 0x0e, 0x7e, 0x01, 0xc4, 0xde, 0xf7, 0x0e, 0x7d, 0x7a, 0x01,
+    0x38, 0x64, 0xc6, 0xad, 0x17, 0x0e, 0x7d, 0xf9, 0xc5, 0xdd, 0x8a, 0x0e,
+    0x7c, 0x21, 0x42, 0x14, 0x98, 0xc1, 0x38, 0x68, 0xc6, 0xd2, 0xd1, 0x0e,
+    0x7b, 0x71, 0xc5, 0x5f, 0x8d, 0x0e, 0x7a, 0xa0, 0x16, 0xc1, 0x38, 0x77,
+    0xc8, 0xb9, 0x2a, 0x0e, 0x7b, 0xeb, 0x01, 0x38, 0x8f, 0x49, 0xad, 0x77,
+    0x41, 0x38, 0x93, 0x00, 0x41, 0x38, 0xaf, 0xc6, 0xad, 0x79, 0x0e, 0x7c,
+    0x29, 0x03, 0x41, 0x38, 0xbb, 0xc2, 0x13, 0x38, 0x0e, 0x7c, 0x11, 0xd2,
+    0x47, 0xff, 0x0e, 0x7b, 0x60, 0xc5, 0xd2, 0xae, 0x0e, 0x7b, 0x79, 0xc8,
+    0x48, 0x09, 0x0e, 0x7a, 0xd8, 0x4c, 0x8b, 0x35, 0xc1, 0x38, 0xc7, 0xcb,
+    0x93, 0x7d, 0x0e, 0x7b, 0x31, 0xc8, 0x4e, 0x4b, 0x0e, 0x7b, 0x29, 0xc9,
+    0xa9, 0x48, 0x0e, 0x7b, 0x21, 0xc8, 0xbf, 0x6a, 0x0e, 0x7b, 0x18, 0x16,
+    0xc1, 0x38, 0xdf, 0xc6, 0xbf, 0x8c, 0x0e, 0x7b, 0x09, 0xc7, 0xc2, 0x96,
+    0x0e, 0x7b, 0x01, 0xc5, 0xd4, 0xd4, 0x0e, 0x7a, 0xf0, 0xa0, 0x0e, 0x7a,
+    0x19, 0x9f, 0x0e, 0x7a, 0x10, 0x0d, 0xc1, 0x38, 0xeb, 0x05, 0xc1, 0x39,
+    0x00, 0x06, 0xc1, 0x39, 0x0f, 0x16, 0xc1, 0x39, 0x1b, 0x15, 0xc1, 0x39,
+    0x2d, 0x11, 0xc1, 0x39, 0x45, 0x42, 0x01, 0x53, 0xc1, 0x39, 0x55, 0x1c,
+    0xc1, 0x39, 0x5f, 0x42, 0x00, 0x39, 0xc1, 0x39, 0x69, 0xc5, 0xd9, 0x43,
+    0x0e, 0x79, 0x39, 0xc6, 0xcf, 0xb3, 0x0e, 0x79, 0x29, 0xc7, 0xc9, 0x8f,
+    0x0e, 0x79, 0x21, 0x48, 0xbd, 0xca, 0xc1, 0x39, 0x75, 0x4d, 0x75, 0x8c,
+    0xc1, 0x39, 0x81, 0x47, 0xc2, 0x7a, 0xc1, 0x39, 0x8b, 0x46, 0xcd, 0xdf,
+    0x41, 0x39, 0x97, 0xc9, 0xb0, 0x62, 0x0e, 0x79, 0x91, 0xc6, 0xb0, 0x65,
+    0x0e, 0x79, 0x89, 0xc7, 0x6d, 0xa2, 0x0e, 0x79, 0x80, 0x42, 0x07, 0xb2,
+    0xc1, 0x39, 0xa3, 0xc8, 0x14, 0x38, 0x08, 0xd1, 0xc1, 0x46, 0x1e, 0x89,
+    0x41, 0x39, 0xaf, 0xd6, 0x2d, 0xe6, 0x08, 0xd2, 0x31, 0xc9, 0x15, 0xcc,
+    0x08, 0xd2, 0x00, 0x4d, 0x7f, 0x25, 0xc1, 0x39, 0xbe, 0xd1, 0x56, 0x1e,
+    0x08, 0xd1, 0xd0, 0xc3, 0x1d, 0x35, 0x08, 0xd1, 0x91, 0xc2, 0x00, 0xd0,
+    0x08, 0xd0, 0x61, 0x83, 0x08, 0xd0, 0x58, 0x83, 0x08, 0xd1, 0x81, 0xc2,
+    0x0d, 0xf6, 0x08, 0xd1, 0x79, 0xc2, 0x00, 0xd0, 0x08, 0xd1, 0x70, 0x83,
+    0x08, 0xd1, 0x41, 0xc2, 0x00, 0xd0, 0x08, 0xd1, 0x38, 0x1c, 0xc1, 0x39,
+    0xd6, 0xc2, 0x00, 0xd0, 0x08, 0xd0, 0xe1, 0x83, 0x08, 0xd0, 0xd9, 0x06,
+    0x41, 0x39, 0xe0, 0x15, 0xc1, 0x39, 0xea, 0xc2, 0x00, 0xd0, 0x08, 0xd0,
+    0xd1, 0x83, 0x08, 0xd0, 0xc9, 0x16, 0x41, 0x39, 0xf4, 0xc2, 0x00, 0xd0,
+    0x08, 0xd1, 0x09, 0x83, 0x08, 0xd1, 0x00, 0xc2, 0x00, 0xd0, 0x08, 0xd0,
+    0xf9, 0x83, 0x08, 0xd0, 0xf0, 0x83, 0x08, 0xd0, 0xe9, 0xc2, 0x00, 0xc1,
+    0x08, 0xd0, 0xc1, 0xc2, 0x19, 0x2c, 0x08, 0xd0, 0x99, 0xc2, 0x01, 0x30,
+    0x08, 0xd0, 0x78, 0xc2, 0x00, 0xd0, 0x08, 0xd0, 0x89, 0x83, 0x08, 0xd0,
+    0x80, 0xc2, 0x00, 0xd0, 0x08, 0xd0, 0x71, 0x83, 0x08, 0xd0, 0x68, 0xca,
+    0x9d, 0xe2, 0x08, 0xd0, 0x49, 0x03, 0xc1, 0x39, 0xfe, 0x91, 0x08, 0xd0,
+    0x33, 0x01, 0x3a, 0x06, 0x87, 0x08, 0xd0, 0x21, 0x97, 0x08, 0xd0, 0x1b,
+    0x01, 0x3a, 0x0a, 0x8b, 0x08, 0xd0, 0x08, 0xcf, 0x60, 0x30, 0x01, 0x4c,
+    0x51, 0xcd, 0x7d, 0x6b, 0x01, 0x4c, 0x40, 0x12, 0xc1, 0x3a, 0x0e, 0xcb,
+    0x34, 0xad, 0x01, 0x50, 0xf8, 0xc8, 0xb8, 0x8a, 0x01, 0x00, 0x61, 0xcc,
+    0x40, 0x81, 0x07, 0xf7, 0xf8, 0x43, 0x16, 0x55, 0xc1, 0x3a, 0x1a, 0x42,
+    0x00, 0x75, 0x41, 0x3a, 0x3e, 0x45, 0x02, 0x10, 0xc1, 0x3a, 0x4a, 0xcc,
+    0x86, 0x3d, 0x05, 0x4e, 0x08, 0x16, 0xc1, 0x3a, 0xd6, 0xc3, 0x05, 0x14,
+    0x05, 0x4e, 0x89, 0xc4, 0x15, 0xe7, 0x05, 0x4e, 0x81, 0x08, 0xc1, 0x3a,
+    0xe2, 0x15, 0xc1, 0x3a, 0xee, 0xc5, 0x06, 0xdb, 0x05, 0x4e, 0xc1, 0xc4,
+    0x26, 0x78, 0x05, 0x4e, 0xc8, 0xc5, 0xdd, 0x53, 0x05, 0x4d, 0xf9, 0xc7,
+    0xc6, 0xf6, 0x05, 0x4d, 0xf1, 0xc5, 0xdd, 0x12, 0x05, 0x4d, 0xe8, 0xc5,
+    0xd8, 0xbc, 0x05, 0x4d, 0xe1, 0xca, 0xa2, 0xf6, 0x05, 0x4d, 0xd9, 0x16,
+    0xc1, 0x3a, 0xfa, 0xc4, 0xc5, 0x6e, 0x05, 0x4d, 0xc3, 0x01, 0x3b, 0x04,
+    0xc4, 0xdf, 0x6f, 0x05, 0x4d, 0xb2, 0x01, 0x3b, 0x0a, 0xc5, 0xde, 0x11,
+    0x05, 0x4c, 0x0b, 0x01, 0x3b, 0x10, 0xc7, 0xc7, 0xd6, 0x05, 0x4c, 0x19,
+    0xc5, 0xd9, 0xcf, 0x05, 0x4c, 0x11, 0xc9, 0xaf, 0xff, 0x05, 0x4c, 0x00,
+    0x46, 0x02, 0xae, 0xc1, 0x3b, 0x16, 0x46, 0x01, 0xc8, 0x41, 0x3b, 0x28,
+    0xc5, 0x18, 0x25, 0x01, 0x02, 0xb9, 0xd1, 0x1e, 0x3f, 0x01, 0x50, 0x60,
+    0x10, 0xc1, 0x3b, 0x34, 0x0c, 0xc1, 0x3b, 0x73, 0x13, 0xc1, 0x3b, 0x93,
+    0x14, 0xc1, 0x3b, 0xaf, 0x15, 0xc1, 0x3b, 0xd6, 0x05, 0xc1, 0x3c, 0x08,
+    0x1c, 0xc1, 0x3c, 0x36, 0x19, 0xc1, 0x3c, 0x68, 0x0a, 0xc1, 0x3c, 0x84,
+    0x1b, 0xc1, 0x3c, 0xb6, 0x1a, 0xc1, 0x3c, 0xd2, 0x0f, 0xc1, 0x3c, 0xf0,
+    0x8b, 0x05, 0x00, 0x13, 0x01, 0x3d, 0x1e, 0x83, 0x05, 0x00, 0x53, 0x01,
+    0x3d, 0x34, 0xc2, 0x01, 0xba, 0x05, 0x00, 0x6b, 0x01, 0x3d, 0x40, 0x91,
+    0x05, 0x00, 0x8b, 0x01, 0x3d, 0x48, 0x87, 0x05, 0x00, 0xa3, 0x01, 0x3d,
+    0x54, 0x04, 0xc1, 0x3d, 0x58, 0x12, 0xc1, 0x3d, 0x86, 0x08, 0xc1, 0x3d,
+    0xa9, 0x18, 0xc1, 0x3d, 0xcc, 0x06, 0xc1, 0x3d, 0xf3, 0x16, 0xc1, 0x3e,
+    0x1a, 0x0e, 0xc1, 0x3e, 0x3d, 0x09, 0xc1, 0x3e, 0x67, 0x0d, 0x41, 0x3e,
+    0x8e, 0xc3, 0xe5, 0x75, 0x05, 0x24, 0x81, 0x0e, 0xc1, 0x3e, 0xb1, 0x0d,
+    0xc1, 0x3e, 0xbe, 0x10, 0xc1, 0x3e, 0xc8, 0x05, 0xc1, 0x3e, 0xd8, 0x15,
+    0xc1, 0x3e, 0xf1, 0x09, 0xc1, 0x3e, 0xfb, 0x0f, 0xc1, 0x3f, 0x0f, 0x0a,
+    0xc1, 0x3f, 0x19, 0x04, 0xc1, 0x3f, 0x23, 0x1b, 0xc1, 0x3f, 0x2f, 0x12,
+    0xc1, 0x3f, 0x39, 0x16, 0xc1, 0x3f, 0x45, 0x1c, 0xc1, 0x3f, 0x4f, 0x06,
+    0xc1, 0x3f, 0x63, 0xc2, 0x00, 0x11, 0x05, 0x25, 0x49, 0x0c, 0xc1, 0x3f,
+    0x6d, 0x18, 0xc1, 0x3f, 0x75, 0xc2, 0x02, 0xa0, 0x05, 0x25, 0xc0, 0xc3,
+    0xe5, 0xb4, 0x08, 0x75, 0x43, 0x01, 0x3f, 0x81, 0xc3, 0x0d, 0xff, 0x08,
+    0x75, 0x03, 0x01, 0x3f, 0x87, 0x07, 0xc1, 0x3f, 0x8d, 0x0a, 0xc1, 0x3f,
+    0xa1, 0xc2, 0x00, 0x27, 0x08, 0x75, 0x29, 0xc3, 0x7e, 0x89, 0x08, 0x75,
+    0x21, 0xc2, 0x01, 0xdf, 0x08, 0x75, 0x19, 0xc3, 0x20, 0x18, 0x08, 0x75,
+    0x11, 0xc3, 0x8c, 0x3f, 0x08, 0x75, 0x09, 0xc3, 0xb3, 0xa6, 0x08, 0x74,
+    0xf9, 0x0d, 0xc1, 0x3f, 0xad, 0xc3, 0x0f, 0x9a, 0x08, 0x74, 0xe1, 0xc2,
+    0x02, 0x41, 0x08, 0x74, 0xd3, 0x01, 0x3f, 0xb9, 0xc2, 0x00, 0x87, 0x08,
+    0x74, 0xc9, 0x1a, 0xc1, 0x3f, 0xbf, 0x1c, 0xc1, 0x3f, 0xc9, 0x16, 0xc1,
+    0x3f, 0xd4, 0x42, 0x0e, 0x9a, 0xc1, 0x3f, 0xde, 0x15, 0xc1, 0x3f, 0xe6,
+    0xc2, 0x25, 0x3b, 0x08, 0x74, 0x81, 0x14, 0xc1, 0x3f, 0xfc, 0x05, 0xc1,
+    0x40, 0x06, 0x12, 0xc1, 0x40, 0x10, 0xc2, 0x00, 0x51, 0x08, 0x74, 0x08,
+    0xca, 0xa8, 0x1e, 0x08, 0x75, 0x61, 0xca, 0x9c, 0xd4, 0x08, 0x75, 0x58,
+    0x00, 0xc1, 0x40, 0x1a, 0xc8, 0xbb, 0x3a, 0x0f, 0xae, 0xc8, 0x12, 0xc1,
+    0x40, 0x26, 0x83, 0x00, 0xa7, 0xa3, 0x01, 0x40, 0x36, 0x8a, 0x00, 0xa9,
+    0x2b, 0x01, 0x40, 0x44, 0x91, 0x00, 0xa7, 0x8b, 0x01, 0x40, 0x61, 0x99,
+    0x00, 0xa8, 0x3b, 0x01, 0x40, 0x6f, 0x87, 0x00, 0xa7, 0x69, 0x8b, 0x00,
+    0xa7, 0x7a, 0x01, 0x40, 0x88, 0x83, 0x00, 0xa6, 0x3b, 0x01, 0x40, 0x8c,
+    0x19, 0xc1, 0x40, 0xa3, 0x91, 0x00, 0xa6, 0x23, 0x01, 0x40, 0xbc, 0xc2,
+    0x00, 0x75, 0x00, 0xac, 0xb3, 0x01, 0x40, 0xc4, 0x89, 0x00, 0xac, 0xab,
+    0x01, 0x40, 0xd9, 0x44, 0xde, 0xaf, 0xc1, 0x40, 0xee, 0x48, 0xbc, 0x52,
+    0xc1, 0x40, 0xfd, 0x87, 0x00, 0xa6, 0x01, 0x8b, 0x00, 0xa6, 0x13, 0x01,
+    0x41, 0x08, 0x8a, 0x00, 0xa6, 0x90, 0x83, 0x00, 0xa4, 0x83, 0x01, 0x41,
+    0x0c, 0xc7, 0xc4, 0xf7, 0x00, 0xb3, 0x69, 0x19, 0xc1, 0x41, 0x19, 0x91,
+    0x00, 0xa4, 0x6b, 0x01, 0x41, 0x32, 0x8b, 0x00, 0xa4, 0x5b, 0x01, 0x41,
+    0x36, 0x87, 0x00, 0xa4, 0x48, 0x4b, 0x92, 0x54, 0xc1, 0x41, 0x3a, 0x49,
+    0xad, 0x4a, 0xc1, 0x41, 0x42, 0xcb, 0x92, 0x96, 0x00, 0xa9, 0xf8, 0x42,
+    0x07, 0x26, 0xc1, 0x41, 0x65, 0x16, 0xc1, 0x41, 0x7e, 0x8a, 0x00, 0xab,
+    0x53, 0x01, 0x41, 0x95, 0x83, 0x00, 0xa2, 0xab, 0x01, 0x41, 0xbb, 0x1b,
+    0xc1, 0x41, 0xc6, 0x19, 0xc1, 0x41, 0xd6, 0x91, 0x00, 0xa2, 0x83, 0x01,
+    0x41, 0xef, 0x8b, 0x00, 0xa2, 0x73, 0x01, 0x41, 0xf3, 0x87, 0x00, 0xa2,
+    0x60, 0x87, 0x00, 0xa0, 0x63, 0x01, 0x41, 0xf7, 0x83, 0x00, 0xa0, 0xbb,
+    0x01, 0x41, 0xfd, 0x91, 0x00, 0xa0, 0x93, 0x01, 0x42, 0x05, 0x8b, 0x00,
+    0xa0, 0x72, 0x01, 0x42, 0x0c, 0x47, 0xc0, 0xac, 0xc1, 0x42, 0x10, 0x19,
+    0xc1, 0x42, 0x1a, 0x83, 0x00, 0xaa, 0x5b, 0x01, 0x42, 0x35, 0x91, 0x00,
+    0xaa, 0x43, 0x01, 0x42, 0x40, 0x8b, 0x00, 0xaa, 0x33, 0x01, 0x42, 0x44,
+    0x87, 0x00, 0xaa, 0x10, 0x8b, 0x00, 0xaa, 0xab, 0x01, 0x42, 0x48, 0xc8,
+    0x11, 0xf7, 0x00, 0xb3, 0x71, 0xc3, 0x14, 0x72, 0x00, 0xaa, 0xd9, 0x83,
+    0x00, 0xaa, 0xcb, 0x01, 0x42, 0x52, 0x91, 0x00, 0xaa, 0xbb, 0x01, 0x42,
+    0x59, 0x87, 0x00, 0xaa, 0x98, 0xc8, 0xbc, 0x9a, 0x00, 0xc6, 0xe1, 0x90,
+    0x00, 0xa1, 0x58, 0x47, 0xc5, 0xb4, 0xc1, 0x42, 0x5d, 0x9b, 0x00, 0xc5,
+    0x81, 0x91, 0x00, 0xa0, 0x31, 0x90, 0x00, 0xa1, 0x68, 0x83, 0x00, 0xa9,
+    0x6b, 0x01, 0x42, 0x7f, 0x91, 0x00, 0xa9, 0x53, 0x01, 0x42, 0x8a, 0x19,
+    0xc1, 0x42, 0x92, 0x46, 0x92, 0x9a, 0xc1, 0x42, 0xab, 0x8b, 0x00, 0xa9,
+    0x43, 0x01, 0x42, 0xe9, 0x87, 0x00, 0xa9, 0x30, 0x83, 0x00, 0xa6, 0xd3,
+    0x01, 0x42, 0xed, 0x8a, 0x00, 0xad, 0x33, 0x01, 0x42, 0xf8, 0x87, 0x00,
+    0xa6, 0x99, 0x8b, 0x00, 0xa6, 0xab, 0x01, 0x43, 0x0d, 0x91, 0x00, 0xa6,
+    0xbb, 0x01, 0x43, 0x11, 0x19, 0x41, 0x43, 0x15, 0x83, 0x00, 0xa5, 0x53,
+    0x01, 0x43, 0x2e, 0x87, 0x00, 0xa5, 0x1b, 0x01, 0x43, 0x39, 0x91, 0x00,
+    0xa5, 0x3b, 0x01, 0x43, 0x3f, 0x8b, 0x00, 0xa5, 0x2b, 0x01, 0x43, 0x46,
+    0x19, 0xc1, 0x43, 0x4a, 0x8a, 0x00, 0xa5, 0xe8, 0x99, 0x00, 0xa4, 0x23,
+    0x01, 0x43, 0x63, 0x83, 0x00, 0xa3, 0x93, 0x01, 0x43, 0x7c, 0x87, 0x00,
+    0xa3, 0x59, 0x8b, 0x00, 0xa3, 0x6b, 0x01, 0x43, 0x87, 0x91, 0x00, 0xa3,
+    0x7a, 0x01, 0x43, 0x8b, 0x19, 0xc1, 0x43, 0x8f, 0x83, 0x00, 0xa1, 0xc3,
+    0x01, 0x43, 0xa8, 0x91, 0x00, 0xa1, 0x9b, 0x01, 0x43, 0xb3, 0x87, 0x00,
+    0xa1, 0x79, 0x8b, 0x00, 0xa1, 0x8a, 0x01, 0x43, 0xbb, 0x83, 0x00, 0xa0,
+    0x5b, 0x01, 0x43, 0xbf, 0x9b, 0x00, 0xc5, 0x89, 0x8b, 0x00, 0xa0, 0xe3,
+    0x01, 0x43, 0xc7, 0x4a, 0xa0, 0xa8, 0xc1, 0x43, 0xcd, 0x90, 0x00, 0xa1,
+    0x70, 0x83, 0x00, 0xac, 0x1b, 0x01, 0x43, 0xd5, 0x91, 0x00, 0xac, 0x0b,
+    0x01, 0x43, 0xe0, 0x8b, 0x00, 0xab, 0xfa, 0x01, 0x43, 0xe4, 0x8d, 0x00,
+    0xab, 0xe9, 0xc5, 0x59, 0x93, 0x00, 0xa0, 0x00, 0x8b, 0x00, 0xa0, 0x21,
+    0x90, 0x00, 0xa1, 0x60, 0xd0, 0x5a, 0x52, 0x01, 0x02, 0x08, 0xc9, 0x36,
+    0xe7, 0x0f, 0xae, 0x10, 0x97, 0x08, 0x15, 0xfa, 0x01, 0x43, 0xe8, 0x94,
+    0x08, 0x16, 0x48, 0x86, 0x08, 0x15, 0x32, 0x01, 0x43, 0xef, 0x9f, 0x08,
+    0x15, 0x38, 0x84, 0x08, 0x16, 0x52, 0x01, 0x43, 0xf3, 0x9f, 0x08, 0x15,
+    0x60, 0x96, 0x08, 0x16, 0x3a, 0x01, 0x43, 0xff, 0x8a, 0x08, 0x15, 0x73,
+    0x01, 0x44, 0x03, 0x95, 0x08, 0x15, 0xc1, 0x96, 0x08, 0x16, 0x12, 0x01,
+    0x44, 0x07, 0xc2, 0x8c, 0x53, 0x08, 0x15, 0x89, 0xc2, 0xe6, 0x81, 0x08,
+    0x16, 0x30, 0x90, 0x08, 0x15, 0x99, 0x86, 0x08, 0x15, 0xf1, 0x89, 0x08,
+    0x16, 0x20, 0x9f, 0x08, 0x15, 0x08, 0x8b, 0x08, 0x16, 0x28, 0x9f, 0x08,
+    0x16, 0x78, 0x9f, 0x08, 0x15, 0xe8, 0x9f, 0x08, 0x16, 0x08, 0x03, 0xc1,
+    0x44, 0x0b, 0xc3, 0x0b, 0xc8, 0x08, 0x29, 0x89, 0x09, 0xc1, 0x44, 0x17,
+    0x06, 0xc1, 0x44, 0x23, 0x07, 0xc1, 0x44, 0x33, 0x1c, 0xc1, 0x44, 0x3d,
+    0x16, 0xc1, 0x44, 0x47, 0x05, 0xc1, 0x44, 0x59, 0x1b, 0xc1, 0x44, 0x67,
+    0x0b, 0xc1, 0x44, 0x73, 0x15, 0xc1, 0x44, 0x85, 0x0e, 0xc1, 0x44, 0x8f,
+    0xc4, 0xdf, 0x1f, 0x08, 0x2a, 0x01, 0x0c, 0xc1, 0x44, 0x9b, 0x0d, 0xc1,
+    0x44, 0xa7, 0xc4, 0xdf, 0xa7, 0x08, 0x2a, 0x31, 0x42, 0x0f, 0x9a, 0xc1,
+    0x44, 0xb3, 0xc3, 0xda, 0xa6, 0x08, 0x2a, 0x61, 0xc4, 0xe4, 0x53, 0x08,
+    0x2a, 0x71, 0xc2, 0x00, 0x45, 0x08, 0x2a, 0x91, 0xc3, 0xd2, 0xb3, 0x08,
+    0x2a, 0xa1, 0x12, 0xc1, 0x44, 0xbb, 0xc3, 0x07, 0x81, 0x08, 0x2a, 0xc9,
+    0xc4, 0xde, 0x87, 0x08, 0x2a, 0xd8, 0xcc, 0x85, 0x1d, 0x0f, 0xb1, 0xc9,
+    0xc9, 0xa9, 0x36, 0x0f, 0xb1, 0xe0, 0x07, 0xc1, 0x44, 0xc7, 0x06, 0xc1,
+    0x45, 0x07, 0x03, 0xc1, 0x45, 0x47, 0x08, 0xc1, 0x45, 0x87, 0x24, 0xc1,
+    0x45, 0xc7, 0x23, 0xc1, 0x46, 0x07, 0x20, 0xc1, 0x46, 0x47, 0x1f, 0xc1,
+    0x46, 0x87, 0x1e, 0xc1, 0x46, 0xc7, 0x1d, 0xc1, 0x47, 0x07, 0x05, 0xc1,
+    0x47, 0x47, 0x04, 0xc1, 0x47, 0x87, 0x26, 0xc1, 0x47, 0xc7, 0x25, 0xc1,
+    0x48, 0x07, 0x22, 0xc1, 0x48, 0x47, 0x21, 0x41, 0x48, 0x87, 0x24, 0xc1,
+    0x48, 0xc7, 0x23, 0xc1, 0x49, 0x07, 0x22, 0xc1, 0x49, 0x47, 0x21, 0xc1,
+    0x49, 0x87, 0x1f, 0xc1, 0x49, 0xc7, 0x1d, 0xc1, 0x4a, 0x07, 0x08, 0xc1,
+    0x4a, 0x47, 0x04, 0xc1, 0x4a, 0x87, 0x03, 0xc1, 0x4a, 0xc7, 0x26, 0xc1,
+    0x4b, 0x07, 0x25, 0xc1, 0x4b, 0x47, 0x07, 0xc1, 0x4b, 0x87, 0x06, 0xc1,
+    0x4b, 0xc7, 0x05, 0xc1, 0x4c, 0x07, 0x20, 0xc1, 0x4c, 0x47, 0x1e, 0x41,
+    0x4c, 0x87, 0x1e, 0xc1, 0x4c, 0xc7, 0x1d, 0x41, 0x4c, 0xff, 0x06, 0xc1,
+    0x4d, 0x3f, 0x05, 0xc1, 0x4d, 0x67, 0x04, 0xc1, 0x4d, 0xa7, 0x03, 0xc1,
+    0x4d, 0xe7, 0x26, 0xc1, 0x4e, 0x27, 0x25, 0xc1, 0x4e, 0x67, 0x24, 0xc1,
+    0x4e, 0xa7, 0x23, 0xc1, 0x4e, 0xe7, 0x22, 0xc1, 0x4f, 0x1f, 0x21, 0xc1,
+    0x4f, 0x5f, 0x20, 0xc1, 0x4f, 0x9f, 0x1f, 0xc1, 0x4f, 0xdf, 0x1e, 0xc1,
+    0x50, 0x1f, 0x1d, 0x41, 0x50, 0x5f, 0x08, 0xc1, 0x50, 0x9f, 0x07, 0xc1,
+    0x50, 0xdf, 0x06, 0xc1, 0x51, 0x1f, 0x05, 0xc1, 0x51, 0x5f, 0x04, 0xc1,
+    0x51, 0x9f, 0x03, 0xc1, 0x51, 0xdf, 0x26, 0xc1, 0x52, 0x1f, 0x25, 0xc1,
+    0x52, 0x5f, 0x24, 0xc1, 0x52, 0x9f, 0x23, 0xc1, 0x52, 0xdf, 0x22, 0xc1,
+    0x53, 0x1f, 0x21, 0xc1, 0x53, 0x5f, 0x20, 0xc1, 0x53, 0x9f, 0x1f, 0xc1,
+    0x53, 0xdf, 0x1e, 0xc1, 0x54, 0x1f, 0x1d, 0x41, 0x54, 0x5f, 0x92, 0x01,
+    0x74, 0xc9, 0x8f, 0x01, 0x75, 0xb9, 0xc2, 0x00, 0x74, 0x01, 0x76, 0xb8,
+    0xc3, 0x43, 0x08, 0x01, 0x74, 0x09, 0xc5, 0x78, 0xee, 0x01, 0x76, 0x10,
+    0xc6, 0xca, 0xeb, 0x01, 0x75, 0x01, 0xc2, 0x0d, 0x10, 0x01, 0x76, 0x78,
+    0x15, 0xc1, 0x54, 0x9f, 0xc4, 0x63, 0x7e, 0x01, 0x76, 0x59, 0x09, 0xc1,
+    0x54, 0xbd, 0x0e, 0xc1, 0x54, 0xc9, 0x16, 0xc1, 0x54, 0xd5, 0xc4, 0x45,
+    0x10, 0x01, 0x76, 0xd9, 0x08, 0xc1, 0x54, 0xe7, 0x07, 0xc1, 0x54, 0xf9,
+    0xc5, 0xa0, 0x85, 0x01, 0x77, 0x11, 0xc4, 0xa3, 0x1a, 0x01, 0x77, 0x31,
+    0xc6, 0x87, 0xe7, 0x01, 0x77, 0x80, 0x45, 0x71, 0x24, 0xc1, 0x55, 0x05,
+    0xc2, 0x00, 0x65, 0x01, 0x74, 0x58, 0xc3, 0x05, 0x14, 0x01, 0x74, 0x61,
+    0xc3, 0x02, 0x9f, 0x01, 0x74, 0x68, 0xc3, 0x21, 0xdf, 0x01, 0x74, 0x91,
+    0x44, 0x4b, 0x1f, 0x41, 0x55, 0x0f, 0x49, 0x8c, 0x70, 0xc1, 0x55, 0x1b,
+    0xc2, 0x8c, 0x30, 0x01, 0x75, 0x78, 0xc3, 0x05, 0x14, 0x01, 0x75, 0x61,
+    0xc3, 0x02, 0x9f, 0x01, 0x75, 0x68, 0xc3, 0x05, 0x14, 0x01, 0x75, 0x21,
+    0xc3, 0x02, 0x9f, 0x01, 0x75, 0x28, 0x9a, 0x01, 0x74, 0x31, 0xcb, 0x93,
+    0x67, 0x01, 0x75, 0x51, 0xc2, 0x02, 0x6f, 0x01, 0x77, 0x18, 0xc3, 0x05,
+    0x14, 0x01, 0x75, 0xd1, 0xc3, 0x02, 0x9f, 0x01, 0x75, 0xd8, 0xc3, 0x05,
+    0x14, 0x01, 0x74, 0x71, 0x16, 0xc1, 0x55, 0x29, 0xc4, 0x09, 0x9d, 0x01,
+    0x74, 0x88, 0xc3, 0x05, 0x14, 0x01, 0x76, 0x89, 0xc3, 0x02, 0x9f, 0x01,
+    0x76, 0x90, 0x43, 0x0f, 0x06, 0xc1, 0x55, 0x35, 0x86, 0x01, 0x77, 0x08,
+    0xc2, 0x00, 0x45, 0x01, 0x74, 0xe9, 0xc4, 0x14, 0xdd, 0x01, 0x74, 0xf9,
+    0xc4, 0xd7, 0x14, 0x01, 0x75, 0xe9, 0x44, 0x0d, 0xee, 0x41, 0x55, 0x41,
+    0xc2, 0x01, 0xe2, 0x01, 0x75, 0xa9, 0xc2, 0x00, 0xfe, 0x01, 0x75, 0xe0,
+    0x44, 0x02, 0x11, 0xc1, 0x55, 0x4d, 0x43, 0xad, 0x64, 0x41, 0x55, 0x59,
+    0xc3, 0x05, 0x14, 0x01, 0x76, 0x19, 0xc3, 0x02, 0x9f, 0x01, 0x76, 0x20,
+    0xc4, 0x18, 0x10, 0x01, 0x77, 0x59, 0x16, 0xc1, 0x55, 0x65, 0xc6, 0x87,
+    0xe7, 0x01, 0x77, 0x78, 0xc3, 0x05, 0x14, 0x01, 0x76, 0xe9, 0x16, 0x41,
+    0x55, 0x71, 0xc2, 0x02, 0xa0, 0x01, 0x75, 0x91, 0xc4, 0x02, 0xde, 0x01,
+    0x75, 0x98, 0xc3, 0x05, 0x14, 0x01, 0x75, 0xf1, 0x16, 0x41, 0x55, 0x7d,
+    0x9c, 0x01, 0x8e, 0xc1, 0x89, 0x01, 0x8e, 0xf8, 0xc2, 0x47, 0xa4, 0x01,
+    0x8e, 0x49, 0x9c, 0x01, 0x8e, 0xf0, 0x9c, 0x01, 0x8e, 0x2b, 0x01, 0x55,
+    0x89, 0x89, 0x01, 0x8e, 0x31, 0x99, 0x01, 0x8e, 0x6b, 0x01, 0x55, 0x94,
+    0x96, 0x01, 0x8e, 0x50, 0xc2, 0x47, 0xa4, 0x01, 0x8e, 0x60, 0xc5, 0x08,
+    0xd9, 0x0f, 0xdc, 0xa8, 0x4d, 0x29, 0xb9, 0xc1, 0x55, 0x98, 0x47, 0x02,
+    0x0e, 0x41, 0x55, 0xe7, 0xc3, 0x91, 0xe8, 0x0f, 0x9a, 0x91, 0xc9, 0xae,
+    0x3d, 0x0f, 0x99, 0xc0, 0xc2, 0x02, 0x0a, 0x01, 0x02, 0x01, 0xc9, 0x33,
+    0xdd, 0x00, 0x00, 0x4a, 0x01, 0x56, 0x36, 0xcf, 0x64, 0xfe, 0x0f, 0xa6,
+    0x49, 0xcd, 0x7b, 0x22, 0x0f, 0xa6, 0x42, 0x01, 0x56, 0x3a, 0xc3, 0xd8,
+    0xd0, 0x08, 0x8a, 0x39, 0x0e, 0xc1, 0x56, 0x40, 0xc3, 0x39, 0x6e, 0x08,
+    0x89, 0x31, 0xc3, 0x82, 0xa0, 0x08, 0x89, 0x29, 0xc3, 0x14, 0x72, 0x08,
+    0x89, 0x21, 0xc3, 0x47, 0xd9, 0x08, 0x89, 0x11, 0x1b, 0xc1, 0x56, 0x4c,
+    0xc3, 0xc2, 0xab, 0x08, 0x88, 0xf9, 0x04, 0xc1, 0x56, 0x58, 0x12, 0xc1,
+    0x56, 0x64, 0x10, 0xc1, 0x56, 0x70, 0x06, 0xc1, 0x56, 0x88, 0x16, 0xc1,
+    0x56, 0x98, 0x0c, 0xc1, 0x56, 0xa8, 0x05, 0xc1, 0x56, 0xb4, 0x09, 0xc1,
+    0x56, 0xc0, 0x0d, 0xc1, 0x56, 0xcc, 0x87, 0x08, 0x88, 0x31, 0x97, 0x08,
+    0x88, 0x29, 0x8b, 0x08, 0x88, 0x21, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x18,
+    0x4a, 0x6f, 0xc8, 0xc1, 0x56, 0xd8, 0xc5, 0x1e, 0x96, 0x08, 0x89, 0x98,
+    0xcb, 0x97, 0xf5, 0x08, 0x8a, 0x11, 0xc4, 0x19, 0x53, 0x08, 0x8a, 0x09,
+    0x45, 0x09, 0x98, 0x41, 0x56, 0xfb, 0xcb, 0x45, 0x8e, 0x08, 0x8a, 0x01,
+    0x44, 0x00, 0xbb, 0x41, 0x57, 0x1f, 0xc2, 0x01, 0x4a, 0x05, 0x51, 0xb1,
+    0xc2, 0x00, 0xdb, 0x05, 0x51, 0xa9, 0xc2, 0x00, 0x39, 0x05, 0x51, 0xa1,
+    0xc2, 0x19, 0x2c, 0x05, 0x51, 0x99, 0x46, 0x26, 0xf7, 0x41, 0x57, 0x31,
+    0x97, 0x05, 0x51, 0x6b, 0x01, 0x57, 0x3f, 0x03, 0xc1, 0x57, 0x43, 0x91,
+    0x05, 0x51, 0x7b, 0x01, 0x57, 0x4f, 0xc2, 0x06, 0xdb, 0x05, 0x51, 0x61,
+    0x8b, 0x05, 0x51, 0x52, 0x01, 0x57, 0x53, 0xc2, 0x00, 0xd0, 0x05, 0x51,
+    0x41, 0x15, 0xc1, 0x57, 0x57, 0x10, 0xc1, 0x57, 0x61, 0x09, 0xc1, 0x57,
+    0x73, 0x0d, 0xc1, 0x57, 0x7d, 0x91, 0x05, 0x50, 0x29, 0x83, 0x05, 0x50,
+    0x03, 0x01, 0x57, 0x87, 0x87, 0x05, 0x50, 0x19, 0x46, 0x26, 0xf7, 0xc1,
+    0x57, 0x8b, 0xc2, 0x02, 0x41, 0x05, 0x51, 0x29, 0xc2, 0x00, 0xdb, 0x05,
+    0x51, 0x21, 0xc2, 0x00, 0x39, 0x05, 0x51, 0x19, 0xc2, 0x19, 0x2c, 0x05,
+    0x51, 0x11, 0x04, 0xc1, 0x57, 0xba, 0x0f, 0xc1, 0x57, 0xca, 0x12, 0xc1,
+    0x57, 0xd4, 0x06, 0xc1, 0x57, 0xe4, 0x16, 0xc1, 0x57, 0xf4, 0x0c, 0xc1,
+    0x57, 0xfe, 0x42, 0x11, 0xee, 0xc1, 0x58, 0x08, 0x97, 0x05, 0x50, 0x11,
+    0x8b, 0x05, 0x50, 0x08, 0xcc, 0x86, 0x19, 0x05, 0x52, 0xf9, 0x06, 0xc1,
+    0x58, 0x12, 0xc6, 0x99, 0x4e, 0x05, 0x52, 0xe0, 0xc4, 0x26, 0x78, 0x05,
+    0x52, 0xc9, 0xc5, 0x06, 0xdb, 0x05, 0x52, 0xc1, 0x15, 0xc1, 0x58, 0x1e,
+    0x08, 0xc1, 0x58, 0x2a, 0x16, 0xc1, 0x58, 0x36, 0xc4, 0x15, 0xe7, 0x05,
+    0x52, 0x81, 0xc3, 0x05, 0x14, 0x05, 0x52, 0x88, 0xc3, 0x05, 0x14, 0x08,
+    0x7e, 0x2b, 0x01, 0x58, 0x42, 0x16, 0xc1, 0x58, 0x48, 0xc4, 0x09, 0x9d,
+    0x08, 0x7e, 0x40, 0xc3, 0xb5, 0x3e, 0x08, 0x7e, 0x21, 0x15, 0xc1, 0x58,
+    0x58, 0xc4, 0xe0, 0xe7, 0x08, 0x7d, 0xd9, 0xc4, 0x4a, 0xb9, 0x08, 0x7d,
+    0xd1, 0xc2, 0x01, 0x7f, 0x08, 0x7d, 0xab, 0x01, 0x58, 0x6a, 0xc5, 0x4a,
+    0xb3, 0x08, 0x7d, 0xc1, 0xca, 0xa5, 0x26, 0x08, 0x7d, 0xb9, 0xc3, 0x7e,
+    0x89, 0x08, 0x7d, 0xb1, 0xc6, 0x40, 0x9a, 0x08, 0x7d, 0xa1, 0xc5, 0x9c,
+    0xa2, 0x08, 0x7d, 0x99, 0xc4, 0xe3, 0x27, 0x08, 0x7d, 0x91, 0x03, 0xc1,
+    0x58, 0x70, 0xc6, 0xcf, 0xd7, 0x08, 0x7d, 0xe1, 0xc3, 0x00, 0x4e, 0x08,
+    0x7d, 0xe9, 0xc3, 0x20, 0x18, 0x08, 0x7d, 0xf1, 0xc2, 0x00, 0x67, 0x08,
+    0x7e, 0x09, 0xc4, 0x5d, 0xe2, 0x08, 0x7e, 0x10, 0xc4, 0x01, 0xc3, 0x01,
+    0x3a, 0x61, 0x43, 0x00, 0x55, 0xc1, 0x58, 0x7c, 0x12, 0x41, 0x58, 0x88,
+    0xc6, 0xd3, 0xc1, 0x01, 0x34, 0xa1, 0xc5, 0xd4, 0x3e, 0x0f, 0x9c, 0x61,
+    0x47, 0x53, 0xfe, 0x41, 0x58, 0x97, 0x51, 0x4f, 0x69, 0xc1, 0x58, 0x9d,
+    0x14, 0x41, 0x59, 0x0e, 0x48, 0x5b, 0x32, 0xc1, 0x59, 0x18, 0x10, 0xc1,
+    0x59, 0x24, 0x4f, 0x66, 0xcf, 0xc1, 0x59, 0x30, 0x44, 0x31, 0xef, 0x41,
+    0x59, 0x3c, 0x0b, 0xc1, 0x59, 0x44, 0x07, 0x41, 0x59, 0x50, 0x43, 0x00,
+    0x4a, 0xc1, 0x59, 0x5c, 0x11, 0xc1, 0x59, 0x66, 0x45, 0x0b, 0x12, 0xc1,
+    0x59, 0x72, 0x42, 0x00, 0x2d, 0x41, 0x59, 0x7e, 0x43, 0x06, 0xa8, 0xc1,
+    0x59, 0x8a, 0xcf, 0x64, 0x0e, 0x00, 0xd5, 0xb0, 0x46, 0x18, 0x54, 0xc1,
+    0x59, 0x96, 0xcf, 0x0e, 0x7d, 0x01, 0x06, 0xd9, 0xc4, 0x1e, 0xc9, 0x00,
+    0x18, 0x1b, 0x01, 0x59, 0xa8, 0xd1, 0x52, 0x55, 0x00, 0x18, 0x90, 0x11,
+    0xc1, 0x59, 0xac, 0x07, 0xc1, 0x59, 0xbc, 0xc8, 0x20, 0xa9, 0x00, 0x18,
+    0x42, 0x01, 0x59, 0xc8, 0x49, 0xa8, 0x70, 0xc1, 0x59, 0xd4, 0xd0, 0x5e,
+    0xf2, 0x00, 0x1a, 0x38, 0xce, 0x3b, 0x7a, 0x01, 0x06, 0xe1, 0xc6, 0xcf,
+    0xef, 0x00, 0x1a, 0x90, 0x49, 0x05, 0xf9, 0xc1, 0x59, 0xf3, 0x48, 0xba,
+    0x9a, 0xc1, 0x59, 0xff, 0xd0, 0x08, 0xf7, 0x00, 0x18, 0x13, 0x01, 0x5a,
+    0x2b, 0x03, 0xc1, 0x5a, 0x31, 0x11, 0xc1, 0x5a, 0x40, 0xc6, 0xbd, 0xf4,
+    0x00, 0x19, 0x38, 0x45, 0x2e, 0xef, 0xc1, 0x5a, 0x4f, 0xce, 0x6c, 0x98,
+    0x00, 0xee, 0x19, 0xca, 0xa2, 0x4c, 0x00, 0xee, 0x11, 0x47, 0x25, 0xae,
+    0xc1, 0x5a, 0x59, 0x16, 0xc1, 0x5a, 0x65, 0xcc, 0x84, 0x81, 0x00, 0x19,
+    0xe0, 0xca, 0xa0, 0x6c, 0x08, 0x99, 0xd9, 0x14, 0x41, 0x5a, 0x6b, 0x4b,
+    0x94, 0xe8, 0xc1, 0x5a, 0x7a, 0x50, 0x5c, 0x02, 0x41, 0x5a, 0x86, 0x12,
+    0xc1, 0x5a, 0x92, 0xc7, 0x04, 0xed, 0x00, 0xee, 0x91, 0xc7, 0x0a, 0x80,
+    0x00, 0xee, 0x88, 0xc7, 0x05, 0x00, 0x00, 0xee, 0x81, 0x10, 0x41, 0x5a,
+    0x9e, 0xc5, 0x05, 0x02, 0x00, 0xee, 0x79, 0xc5, 0x00, 0xd4, 0x00, 0x1a,
+    0xd8, 0xc5, 0xcc, 0x90, 0x00, 0x19, 0x43, 0x01, 0x5a, 0xaa, 0xce, 0x6d,
+    0xf6, 0x00, 0xd5, 0xb9, 0xc7, 0x7d, 0xa5, 0x00, 0x18, 0x29, 0x51, 0x52,
+    0x33, 0x41, 0x5a, 0xb0, 0xc5, 0x60, 0xb2, 0x00, 0x18, 0x23, 0x01, 0x5a,
+    0xce, 0xcf, 0x68, 0x55, 0x00, 0x19, 0x00, 0x49, 0x60, 0xf4, 0xc1, 0x5a,
+    0xd6, 0x03, 0x41, 0x5a, 0xe2, 0xd0, 0x5d, 0xa2, 0x00, 0xd6, 0x31, 0xce,
+    0x70, 0xc0, 0x00, 0x1a, 0x50, 0xc8, 0xbb, 0x12, 0x00, 0xd5, 0xa9, 0x00,
+    0x41, 0x5a, 0xee, 0xc8, 0x9e, 0x5c, 0x00, 0x18, 0x49, 0xc2, 0x00, 0xc0,
+    0x00, 0x18, 0xd9, 0xce, 0x6b, 0xf0, 0x00, 0x1a, 0x58, 0x45, 0x02, 0x6d,
+    0xc1, 0x5a, 0xfa, 0xc5, 0x1e, 0xc8, 0x00, 0x19, 0xf0, 0xca, 0x8d, 0xb1,
+    0x01, 0x02, 0x91, 0xc2, 0x00, 0xfe, 0x00, 0x02, 0x00, 0x4b, 0x93, 0x04,
+    0xc1, 0x5b, 0x06, 0x4b, 0x99, 0xef, 0x41, 0x5b, 0x24, 0xc4, 0xde, 0xbf,
+    0x01, 0x19, 0xa9, 0xc4, 0xe3, 0x37, 0x01, 0x19, 0xa0, 0x45, 0x00, 0x8c,
+    0xc1, 0x5b, 0x42, 0x43, 0x54, 0xfc, 0x41, 0x5b, 0x54, 0xc5, 0xdc, 0x86,
+    0x0f, 0x9c, 0xd9, 0xd3, 0x42, 0x09, 0x00, 0x04, 0xd8, 0xc6, 0x0e, 0xbd,
+    0x01, 0x12, 0xa1, 0xc4, 0x00, 0xba, 0x01, 0x05, 0x08, 0x4c, 0x29, 0xba,
+    0xc1, 0x5b, 0x63, 0x46, 0x10, 0x79, 0x41, 0x5b, 0xd0, 0x4e, 0x0b, 0x18,
+    0xc1, 0x5b, 0xea, 0x49, 0x29, 0x29, 0x41, 0x5c, 0x57, 0xce, 0x74, 0x4e,
+    0x08, 0x17, 0x01, 0x46, 0x09, 0x97, 0xc1, 0x5c, 0x63, 0x47, 0x34, 0x2f,
+    0x41, 0x5c, 0x81, 0xc9, 0x11, 0xf6, 0x01, 0x67, 0xc9, 0xd4, 0x2f, 0xe2,
+    0x01, 0x67, 0xd1, 0xd6, 0x2f, 0xe0, 0x01, 0x67, 0xd9, 0xcd, 0x4b, 0xac,
+    0x01, 0x67, 0xe0, 0xd0, 0x53, 0xaa, 0x01, 0x67, 0xe9, 0xc8, 0x11, 0xf7,
+    0x01, 0x67, 0xf0, 0xcd, 0x80, 0x02, 0x0f, 0xa8, 0x81, 0x4d, 0x7f, 0x32,
+    0xc1, 0x5c, 0x9f, 0xc4, 0xe3, 0x33, 0x0f, 0xa6, 0xa9, 0x17, 0xc1, 0x5c,
+    0xab, 0xd8, 0x24, 0xfb, 0x01, 0x52, 0x69, 0x42, 0x06, 0x62, 0x41, 0x5c,
+    0xba, 0xd3, 0x41, 0x97, 0x01, 0x3f, 0x99, 0x05, 0xc1, 0x5c, 0xcc, 0xc8,
+    0x1e, 0x3f, 0x01, 0x11, 0x89, 0xd1, 0x05, 0x75, 0x01, 0x0d, 0xd9, 0x16,
+    0xc1, 0x5c, 0xd8, 0x45, 0x00, 0x2c, 0xc1, 0x5c, 0xe4, 0x48, 0x03, 0xc8,
+    0x41, 0x5c, 0xf0, 0x16, 0xc1, 0x5c, 0xf6, 0x07, 0xc1, 0x5d, 0x06, 0x44,
+    0x26, 0x78, 0xc1, 0x5d, 0x12, 0x15, 0xc1, 0x5d, 0x1e, 0x08, 0xc1, 0x5d,
+    0x2a, 0x43, 0x05, 0x14, 0x41, 0x5d, 0x36, 0xc9, 0xad, 0xe3, 0x0f, 0x99,
+    0x49, 0xc4, 0x2a, 0x90, 0x0f, 0x99, 0x41, 0xc4, 0x27, 0x54, 0x0f, 0x99,
+    0x39, 0xc7, 0xc2, 0x34, 0x0f, 0x99, 0x50, 0x05, 0xc1, 0x5d, 0x42, 0x0a,
+    0xc1, 0x5d, 0x56, 0xde, 0x0f, 0x7c, 0x01, 0x3a, 0x11, 0x19, 0xc1, 0x5d,
+    0x6e, 0x06, 0xc1, 0x5d, 0x78, 0x0e, 0xc1, 0x5d, 0x86, 0x47, 0x34, 0x2f,
+    0xc1, 0x5d, 0x92, 0x16, 0xc1, 0x5d, 0xa8, 0xc6, 0x0e, 0xbd, 0x01, 0x14,
+    0xe1, 0x03, 0xc1, 0x5d, 0xb7, 0x14, 0xc1, 0x5d, 0xc3, 0x0f, 0xc1, 0x5d,
+    0xcf, 0x12, 0xc1, 0x5d, 0xdb, 0x0b, 0xc1, 0x5d, 0xf3, 0xcc, 0x07, 0xc7,
+    0x01, 0x4e, 0x09, 0x04, 0xc1, 0x5e, 0x05, 0xcc, 0x07, 0xbb, 0x01, 0x4d,
+    0xb1, 0x9a, 0x01, 0x5d, 0xf1, 0xcf, 0x69, 0xcc, 0x0f, 0x88, 0x69, 0xc6,
+    0x0b, 0x09, 0x0f, 0xbe, 0xb9, 0x0d, 0x41, 0x5e, 0x11, 0x45, 0x00, 0x8c,
+    0xc1, 0x5e, 0x1d, 0x5e, 0x0e, 0xe6, 0x41, 0x5e, 0x47, 0x97, 0x09, 0x1b,
+    0x53, 0x01, 0x5e, 0x4d, 0x83, 0x09, 0x1a, 0xeb, 0x01, 0x5e, 0x64, 0x8b,
+    0x09, 0x1b, 0x1b, 0x01, 0x5e, 0x76, 0xc2, 0x8d, 0xc6, 0x09, 0x1b, 0x10,
+    0x94, 0x09, 0x19, 0x43, 0x01, 0x5e, 0x91, 0x00, 0xc1, 0x5e, 0xae, 0x8f,
+    0x09, 0x18, 0xeb, 0x01, 0x5e, 0xc1, 0x1c, 0xc1, 0x5e, 0xd6, 0xc4, 0xde,
+    0x97, 0x09, 0x1a, 0xc9, 0xc2, 0x01, 0xe2, 0x09, 0x1a, 0x8b, 0x01, 0x5e,
+    0xe1, 0x90, 0x09, 0x19, 0x33, 0x01, 0x5e, 0xf5, 0x86, 0x09, 0x18, 0x9b,
+    0x01, 0x5e, 0xfb, 0x84, 0x09, 0x18, 0x91, 0x9f, 0x09, 0x18, 0x88, 0x97,
+    0x09, 0x18, 0x2b, 0x01, 0x5f, 0x05, 0x83, 0x09, 0x17, 0x5b, 0x01, 0x5f,
+    0x1d, 0x8b, 0x09, 0x17, 0xf3, 0x01, 0x5f, 0x3c, 0x87, 0x09, 0x17, 0xe2,
+    0x01, 0x5f, 0x51, 0x8b, 0x09, 0x16, 0xdb, 0x01, 0x5f, 0x57, 0x0a, 0xc1,
+    0x5f, 0x6e, 0x83, 0x09, 0x14, 0x9b, 0x01, 0x5f, 0x87, 0x97, 0x09, 0x17,
+    0x12, 0x01, 0x5f, 0x9f, 0x8b, 0x09, 0x12, 0x63, 0x01, 0x5f, 0xc0, 0x97,
+    0x09, 0x13, 0x0b, 0x01, 0x5f, 0xde, 0x83, 0x09, 0x11, 0xf3, 0x01, 0x5f,
+    0xee, 0x87, 0x09, 0x12, 0x42, 0x01, 0x60, 0x06, 0x97, 0x09, 0x11, 0x63,
+    0x01, 0x60, 0x0a, 0x8b, 0x09, 0x11, 0x53, 0x01, 0x60, 0x2c, 0x87, 0x09,
+    0x11, 0x43, 0x01, 0x60, 0x36, 0x83, 0x09, 0x11, 0x02, 0x01, 0x60, 0x3d,
+    0x97, 0x09, 0x0f, 0xdb, 0x01, 0x60, 0x56, 0x83, 0x09, 0x0d, 0xbb, 0x01,
+    0x60, 0x7f, 0x8b, 0x09, 0x0f, 0xba, 0x01, 0x60, 0x9f, 0x83, 0x09, 0x0a,
+    0xbb, 0x01, 0x60, 0xaf, 0xc5, 0xd5, 0xf6, 0x09, 0x0d, 0xb1, 0x97, 0x09,
+    0x0d, 0x53, 0x01, 0x60, 0xe5, 0x8b, 0x09, 0x0d, 0x03, 0x01, 0x61, 0x12,
+    0xc4, 0x73, 0x32, 0x09, 0x0c, 0xf8, 0x8b, 0x09, 0x09, 0x6b, 0x01, 0x61,
+    0x24, 0x83, 0x09, 0x09, 0x4b, 0x01, 0x61, 0x2a, 0x97, 0x09, 0x09, 0xba,
+    0x01, 0x61, 0x32, 0x97, 0x09, 0x08, 0xb3, 0x01, 0x61, 0x47, 0x8b, 0x09,
+    0x08, 0x03, 0x01, 0x61, 0x6d, 0x07, 0xc1, 0x61, 0x8a, 0x83, 0x09, 0x05,
+    0xaa, 0x01, 0x61, 0x99, 0xc3, 0x0a, 0xe2, 0x09, 0x05, 0x0b, 0x01, 0x61,
+    0xd5, 0xc3, 0x05, 0x4e, 0x09, 0x05, 0x03, 0x01, 0x61, 0xd9, 0x14, 0xc1,
+    0x61, 0xdf, 0x9f, 0x09, 0x04, 0x6b, 0x01, 0x61, 0xee, 0x90, 0x09, 0x04,
+    0xbb, 0x01, 0x61, 0xf4, 0x8e, 0x09, 0x04, 0xb1, 0xc3, 0xe0, 0x5f, 0x09,
+    0x04, 0xa9, 0xc3, 0x03, 0x30, 0x09, 0x04, 0xa1, 0x00, 0x41, 0x61, 0xf8,
+    0x97, 0x09, 0x03, 0xd3, 0x01, 0x62, 0x04, 0x8b, 0x09, 0x03, 0x93, 0x01,
+    0x62, 0x27, 0x83, 0x09, 0x02, 0xaa, 0x01, 0x62, 0x42, 0x97, 0x09, 0x02,
+    0x6b, 0x01, 0x62, 0x5a, 0x83, 0x09, 0x02, 0x03, 0x01, 0x62, 0x6e, 0x8b,
+    0x09, 0x02, 0x4a, 0x01, 0x62, 0x92, 0x86, 0x09, 0x00, 0xe3, 0x01, 0x62,
+    0x98, 0x84, 0x09, 0x00, 0x53, 0x01, 0x62, 0x9e, 0xc3, 0x01, 0xc3, 0x09,
+    0x01, 0x5b, 0x01, 0x62, 0xa9, 0x15, 0xc1, 0x62, 0xaf, 0x14, 0xc1, 0x62,
+    0xbc, 0xc3, 0x0e, 0x61, 0x09, 0x01, 0x99, 0x90, 0x09, 0x01, 0x6b, 0x01,
+    0x62, 0xcb, 0x8e, 0x09, 0x01, 0x03, 0x01, 0x62, 0xd5, 0x8d, 0x09, 0x00,
+    0xeb, 0x01, 0x62, 0xe7, 0x9f, 0x09, 0x00, 0x49, 0x47, 0x03, 0x4c, 0x41,
+    0x62, 0xed, 0x8b, 0x09, 0x13, 0xfb, 0x01, 0x63, 0x1b, 0xc4, 0x73, 0x32,
+    0x09, 0x13, 0xf3, 0x01, 0x63, 0x23, 0x83, 0x09, 0x13, 0xd2, 0x01, 0x63,
+    0x29, 0x97, 0x09, 0x14, 0x91, 0x8b, 0x09, 0x14, 0x89, 0x83, 0x09, 0x14,
+    0x7a, 0x01, 0x63, 0x35, 0xc2, 0x01, 0xe2, 0x09, 0x0a, 0xb1, 0x94, 0x09,
+    0x0a, 0xa9, 0x90, 0x09, 0x0a, 0xa1, 0x8f, 0x09, 0x0a, 0x73, 0x01, 0x63,
+    0x39, 0x8e, 0x09, 0x0a, 0x5b, 0x01, 0x63, 0x43, 0x89, 0x09, 0x0a, 0x2b,
+    0x01, 0x63, 0x4d, 0xc3, 0x7e, 0x08, 0x09, 0x0a, 0x13, 0x01, 0x63, 0x54,
+    0x84, 0x09, 0x0a, 0x09, 0xc2, 0x00, 0xd3, 0x09, 0x0a, 0x00, 0xc9, 0xa8,
+    0xd3, 0x09, 0x23, 0xa1, 0xc8, 0xbd, 0xe2, 0x09, 0x23, 0x99, 0xc5, 0x33,
+    0x24, 0x09, 0x23, 0x90, 0x43, 0x02, 0x6f, 0xc1, 0x63, 0x5a, 0x44, 0xe0,
+    0x57, 0x41, 0x63, 0x82, 0x45, 0x00, 0x2d, 0xc1, 0x63, 0x8e, 0x47, 0xc0,
+    0x43, 0x41, 0x63, 0xb6, 0x45, 0x1b, 0xec, 0xc1, 0x63, 0xc6, 0x43, 0x4d,
+    0x57, 0xc1, 0x63, 0xeb, 0x54, 0x38, 0x68, 0x41, 0x64, 0x13, 0x44, 0x0d,
+    0x14, 0xc1, 0x64, 0x1f, 0x44, 0x09, 0x9e, 0x41, 0x64, 0x43, 0x43, 0x02,
+    0x6f, 0xc1, 0x64, 0x72, 0x50, 0x5b, 0x82, 0x41, 0x64, 0x98, 0x43, 0x02,
+    0xa0, 0xc1, 0x64, 0xa4, 0x45, 0x02, 0xde, 0x41, 0x64, 0xc9, 0x42, 0x01,
+    0xc8, 0xc1, 0x64, 0xee, 0xd1, 0x57, 0x2e, 0x01, 0x1d, 0x50, 0xc8, 0xb7,
+    0x32, 0x0f, 0xa5, 0x89, 0xc4, 0x00, 0xba, 0x00, 0x05, 0x20, 0xc8, 0x7d,
+    0xa4, 0x07, 0xf2, 0x51, 0xc8, 0x80, 0x2e, 0x07, 0xf2, 0x70, 0x9f, 0x09,
+    0x7f, 0x91, 0x9e, 0x09, 0x7f, 0x88, 0x1e, 0xc1, 0x64, 0xfa, 0x1d, 0x41,
+    0x65, 0x06, 0x26, 0xc1, 0x65, 0x2a, 0x25, 0xc1, 0x65, 0x4e, 0x24, 0xc1,
+    0x65, 0x76, 0x23, 0xc1, 0x65, 0x9d, 0x22, 0xc1, 0x65, 0xc1, 0x21, 0xc1,
+    0x65, 0xe5, 0x20, 0xc1, 0x65, 0xfd, 0x1f, 0xc1, 0x66, 0x1d, 0x1e, 0xc1,
+    0x66, 0x3d, 0x1d, 0x41, 0x66, 0x5c, 0x87, 0x08, 0x41, 0x99, 0x8b, 0x08,
+    0x41, 0xa1, 0x91, 0x08, 0x41, 0xa9, 0x83, 0x08, 0x41, 0x90, 0x83, 0x08,
+    0x41, 0xb9, 0x87, 0x08, 0x41, 0xc0, 0x83, 0x08, 0x41, 0xe1, 0x91, 0x08,
+    0x41, 0xf8, 0x83, 0x08, 0x40, 0x29, 0x91, 0x08, 0x40, 0x40, 0x83, 0x08,
+    0x40, 0x51, 0x87, 0x08, 0x40, 0x59, 0x8b, 0x08, 0x40, 0x61, 0x91, 0x08,
+    0x40, 0x69, 0x97, 0x08, 0x40, 0x70, 0x83, 0x08, 0x40, 0x79, 0x87, 0x08,
+    0x40, 0x81, 0x8b, 0x08, 0x40, 0x89, 0x91, 0x08, 0x40, 0x91, 0x97, 0x08,
+    0x40, 0x98, 0x83, 0x08, 0x40, 0xa1, 0x87, 0x08, 0x40, 0xa9, 0x8b, 0x08,
+    0x40, 0xb1, 0x91, 0x08, 0x40, 0xb9, 0x97, 0x08, 0x40, 0xc0, 0x83, 0x08,
+    0x40, 0xc9, 0x87, 0x08, 0x40, 0xd1, 0x8b, 0x08, 0x40, 0xd9, 0x91, 0x08,
+    0x40, 0xe1, 0x97, 0x08, 0x40, 0xe8, 0x83, 0x08, 0x40, 0xf1, 0x87, 0x08,
+    0x40, 0xf9, 0x8b, 0x08, 0x41, 0x01, 0x91, 0x08, 0x41, 0x09, 0x97, 0x08,
+    0x41, 0x10, 0x83, 0x08, 0x41, 0x19, 0x87, 0x08, 0x41, 0x21, 0x8b, 0x08,
+    0x41, 0x29, 0x91, 0x08, 0x41, 0x31, 0x97, 0x08, 0x41, 0x38, 0x83, 0x08,
+    0x41, 0x41, 0x87, 0x08, 0x41, 0x49, 0x8b, 0x08, 0x41, 0x51, 0x91, 0x08,
+    0x41, 0x59, 0x97, 0x08, 0x41, 0x60, 0x83, 0x08, 0x41, 0x69, 0x87, 0x08,
+    0x41, 0x71, 0x8b, 0x08, 0x41, 0x79, 0x91, 0x08, 0x41, 0x81, 0x97, 0x08,
+    0x41, 0x88, 0x97, 0x00, 0x22, 0x1b, 0x01, 0x66, 0x7c, 0x16, 0xc1, 0x66,
+    0x8f, 0x19, 0xc1, 0x66, 0xb2, 0x10, 0xc1, 0x66, 0xbc, 0x0e, 0xc1, 0x66,
+    0xce, 0x14, 0xc1, 0x66, 0xe6, 0x87, 0x00, 0x22, 0x6b, 0x01, 0x66, 0xf8,
+    0x06, 0xc1, 0x67, 0x25, 0x15, 0xc1, 0x67, 0x48, 0x12, 0xc1, 0x67, 0x6a,
+    0x83, 0x00, 0x21, 0x83, 0x01, 0x67, 0x7d, 0xc2, 0x0f, 0x9a, 0x00, 0x28,
+    0xd9, 0x1b, 0xc1, 0x67, 0x8f, 0x0d, 0xc1, 0x67, 0xab, 0x0a, 0xc1, 0x67,
+    0xc8, 0x09, 0xc1, 0x67, 0xd5, 0x04, 0xc1, 0x67, 0xe4, 0x91, 0x00, 0x21,
+    0xf3, 0x01, 0x68, 0x02, 0x8b, 0x00, 0x21, 0xc3, 0x01, 0x68, 0x15, 0x1c,
+    0xc1, 0x68, 0x32, 0x05, 0xc1, 0x68, 0x3d, 0x44, 0x13, 0x35, 0xc1, 0x68,
+    0x58, 0xc2, 0x00, 0x5f, 0x00, 0x21, 0x91, 0xc2, 0x1c, 0x52, 0x00, 0x22,
+    0xc1, 0xc4, 0xe0, 0x1b, 0x00, 0x23, 0x98, 0xc4, 0xe2, 0x37, 0x00, 0x26,
+    0xa9, 0xc6, 0xcf, 0xe9, 0x00, 0x25, 0xa9, 0xc6, 0xce, 0xb7, 0x00, 0x25,
+    0x28, 0x87, 0x00, 0x21, 0x6b, 0x01, 0x68, 0x64, 0x06, 0xc1, 0x68, 0x91,
+    0x15, 0xc1, 0x68, 0xb4, 0x12, 0xc1, 0x68, 0xd6, 0x83, 0x00, 0x20, 0x83,
+    0x01, 0x68, 0xe3, 0xc2, 0x00, 0x28, 0x00, 0x28, 0xe1, 0xc2, 0x0f, 0x9a,
+    0x00, 0x28, 0xd1, 0x1b, 0xc1, 0x68, 0xf5, 0x14, 0xc1, 0x69, 0x11, 0x0e,
+    0xc1, 0x69, 0x23, 0x0d, 0xc1, 0x69, 0x35, 0x0a, 0xc1, 0x69, 0x52, 0x09,
+    0xc1, 0x69, 0x5f, 0x05, 0xc1, 0x69, 0x6e, 0x97, 0x00, 0x21, 0x1b, 0x01,
+    0x69, 0x89, 0x04, 0xc1, 0x69, 0x96, 0x91, 0x00, 0x20, 0xf3, 0x01, 0x69,
+    0xb4, 0x8b, 0x00, 0x20, 0xc3, 0x01, 0x69, 0xc7, 0x1c, 0xc1, 0x69, 0xe4,
+    0x16, 0xc1, 0x69, 0xef, 0xc2, 0x1c, 0x52, 0x00, 0x20, 0x41, 0x10, 0xc1,
+    0x6a, 0x06, 0xc2, 0x00, 0x5f, 0x00, 0x20, 0x91, 0x44, 0x13, 0x35, 0xc1,
+    0x6a, 0x12, 0xc4, 0xe0, 0x1b, 0x00, 0x23, 0x90, 0xc4, 0xe2, 0x37, 0x00,
+    0x26, 0xa1, 0xc6, 0xcf, 0xe9, 0x00, 0x25, 0xa1, 0xc6, 0xce, 0xb7, 0x00,
+    0x25, 0x20, 0xc2, 0x02, 0xa0, 0x0f, 0xdf, 0x91, 0xc4, 0x02, 0xde, 0x0f,
+    0xdf, 0x98, 0xc3, 0x09, 0x9e, 0x0f, 0xdf, 0xa1, 0xc3, 0x0d, 0x14, 0x0f,
+    0xdf, 0xa8, 0xc2, 0x22, 0xcc, 0x0f, 0xdf, 0xb1, 0xc4, 0x18, 0x10, 0x0f,
+    0xdf, 0xb8, 0xa0, 0x00, 0x04, 0x79, 0x9f, 0x00, 0x04, 0x70, 0x47, 0xc2,
+    0x50, 0xc1, 0x6a, 0x1e, 0x43, 0x00, 0x2c, 0xc1, 0x6a, 0x2a, 0x0e, 0xc1,
+    0x6a, 0x30, 0xde, 0x0f, 0xb8, 0x01, 0x00, 0xd9, 0xd4, 0x3e, 0xd0, 0x00,
+    0x04, 0xd0, 0x47, 0x34, 0x2f, 0xc1, 0x6a, 0x3a, 0x46, 0x09, 0x97, 0x41,
+    0x6a, 0x58, 0xcb, 0x1e, 0x89, 0x00, 0x6c, 0x09, 0x03, 0xc1, 0x6a, 0x76,
+    0xc9, 0xb2, 0x24, 0x00, 0x6c, 0x18, 0x46, 0x02, 0x0f, 0xc1, 0x6a, 0x82,
+    0x4a, 0x9d, 0xec, 0x41, 0x6a, 0xd0, 0xca, 0x63, 0xc8, 0x00, 0x6e, 0x79,
+    0x0d, 0xc1, 0x6a, 0xf4, 0x45, 0x63, 0xc3, 0xc1, 0x6b, 0x00, 0x42, 0x01,
+    0x30, 0x41, 0x6b, 0x1e, 0x47, 0x01, 0xbb, 0xc1, 0x6b, 0x2a, 0x43, 0x46,
+    0xac, 0x41, 0x6b, 0x34, 0x0b, 0xc1, 0x6b, 0x46, 0xc8, 0x11, 0xf7, 0x0e,
+    0xd4, 0x41, 0x0e, 0xc1, 0x6b, 0x52, 0x48, 0xb8, 0x0a, 0xc1, 0x6b, 0x5e,
+    0x5c, 0x12, 0x39, 0x41, 0x6b, 0x70, 0x11, 0xc1, 0x6b, 0x7f, 0x46, 0x94,
+    0x69, 0x41, 0x6b, 0x8b, 0xc8, 0x52, 0x00, 0x0e, 0xd4, 0x49, 0x48, 0x18,
+    0xb0, 0xc1, 0x6b, 0x9d, 0x47, 0xc0, 0x12, 0xc1, 0x6b, 0xa9, 0x47, 0xc6,
+    0xe8, 0xc1, 0x6b, 0xb9, 0x46, 0xd0, 0xb5, 0x41, 0x6b, 0xc5, 0x47, 0x7f,
+    0x5a, 0xc1, 0x6b, 0xd7, 0x0b, 0x41, 0x6b, 0xdf, 0xe0, 0x00, 0x67, 0x0e,
+    0xd3, 0xa8, 0x11, 0xc1, 0x6b, 0xe9, 0x07, 0xc1, 0x6b, 0xfb, 0x46, 0xcd,
+    0x13, 0x41, 0x6c, 0x0a, 0xc9, 0xaa, 0xb9, 0x0e, 0xd3, 0x61, 0xc3, 0x10,
+    0xa1, 0x0e, 0xd1, 0x81, 0x42, 0x0c, 0x43, 0x41, 0x6c, 0x16, 0x03, 0xc1,
+    0x6c, 0x32, 0xc3, 0x01, 0x9c, 0x0e, 0xcf, 0xfa, 0x01, 0x6c, 0x3e, 0xc3,
+    0x6b, 0x04, 0x0e, 0xd3, 0x51, 0x44, 0x12, 0x51, 0x41, 0x6c, 0x42, 0x47,
+    0xc3, 0xdf, 0xc1, 0x6c, 0x52, 0x44, 0x1a, 0x39, 0x41, 0x6c, 0x6a, 0x45,
+    0xdb, 0x37, 0xc1, 0x6c, 0x9e, 0x44, 0xdc, 0x0a, 0x41, 0x6c, 0xaa, 0x44,
+    0xcf, 0x23, 0xc1, 0x6c, 0xbc, 0x44, 0x87, 0x15, 0x41, 0x6c, 0xc8, 0x4f,
+    0x61, 0xa7, 0xc1, 0x6c, 0xd4, 0x47, 0xc6, 0x55, 0x41, 0x6c, 0xe6, 0xc7,
+    0x0b, 0xc8, 0x0e, 0xc8, 0x51, 0xc8, 0x3b, 0xec, 0x0e, 0xc8, 0x49, 0xc6,
+    0x24, 0x3b, 0x0e, 0xc8, 0x40, 0xca, 0x22, 0x51, 0x01, 0x39, 0xb1, 0xd4,
+    0x3e, 0xbc, 0x0f, 0xa9, 0x79, 0xcd, 0x0e, 0x61, 0x0f, 0xbe, 0x68, 0x03,
+    0xc1, 0x6d, 0x0e, 0x91, 0x08, 0xad, 0xd1, 0x87, 0x08, 0xad, 0xc1, 0xc9,
+    0xb2, 0x2d, 0x08, 0xad, 0xa3, 0x01, 0x6d, 0x23, 0x97, 0x08, 0xad, 0x93,
+    0x01, 0x6d, 0x27, 0x8b, 0x08, 0xad, 0x82, 0x01, 0x6d, 0x2b, 0x83, 0x08,
+    0xac, 0x03, 0x01, 0x6d, 0x2f, 0x16, 0xc1, 0x6d, 0x41, 0xc2, 0x00, 0xd0,
+    0x08, 0xad, 0x71, 0x15, 0xc1, 0x6d, 0x56, 0x18, 0xc1, 0x6d, 0x66, 0xc2,
+    0x00, 0xdb, 0x08, 0xad, 0x49, 0xc2, 0x00, 0x39, 0x08, 0xad, 0x41, 0xc2,
+    0x19, 0x2c, 0x08, 0xad, 0x39, 0xc2, 0x01, 0xc3, 0x08, 0xad, 0x31, 0x04,
+    0xc1, 0x6d, 0x70, 0x12, 0xc1, 0x6d, 0x7a, 0x10, 0xc1, 0x6d, 0x84, 0x06,
+    0xc1, 0x6d, 0x9a, 0x0c, 0xc1, 0x6d, 0xa8, 0x05, 0xc1, 0x6d, 0xb2, 0x09,
+    0xc1, 0x6d, 0xbc, 0x0d, 0xc1, 0x6d, 0xc6, 0x91, 0x08, 0xac, 0x61, 0x87,
+    0x08, 0xac, 0x51, 0x97, 0x08, 0xac, 0x23, 0x01, 0x6d, 0xd0, 0x8b, 0x08,
+    0xac, 0x12, 0x01, 0x6d, 0xd4, 0x07, 0xc1, 0x6d, 0xd8, 0x44, 0x00, 0xbb,
+    0x41, 0x6d, 0xe4, 0xa0, 0x08, 0xae, 0x41, 0x9f, 0x08, 0xae, 0x39, 0x9e,
+    0x08, 0xae, 0x30, 0xcb, 0x97, 0xf5, 0x08, 0xae, 0x19, 0xc4, 0x19, 0x53,
+    0x08, 0xae, 0x10, 0xd3, 0x41, 0x25, 0x0f, 0xad, 0x09, 0xd1, 0x53, 0x10,
+    0x0f, 0xad, 0x01, 0xd4, 0x06, 0x73, 0x0f, 0xac, 0xd9, 0xd3, 0x43, 0x13,
+    0x0f, 0xac, 0xd0, 0xd3, 0x41, 0x25, 0x0f, 0xac, 0xf9, 0xd1, 0x53, 0x10,
+    0x0f, 0xac, 0xf1, 0xd4, 0x06, 0x73, 0x0f, 0xac, 0xc9, 0xd3, 0x43, 0x13,
+    0x0f, 0xac, 0xc0, 0x11, 0xc1, 0x6e, 0x02, 0xcc, 0x86, 0x85, 0x01, 0x31,
+    0x51, 0xc6, 0x0e, 0xbd, 0x01, 0x12, 0xd9, 0x45, 0x00, 0x8c, 0x41, 0x6e,
+    0x0e, 0xc4, 0x27, 0xe3, 0x00, 0x00, 0x11, 0xc7, 0xc3, 0x92, 0x00, 0x00,
+    0x09, 0x15, 0xc1, 0x6e, 0x1a, 0xce, 0x6d, 0x94, 0x00, 0x04, 0xb1, 0xcc,
+    0x87, 0xc9, 0x00, 0x04, 0xb0, 0xc4, 0x1d, 0xa8, 0x01, 0x1f, 0x21, 0xc6,
+    0xcd, 0xcd, 0x0f, 0xa6, 0x78, 0xcb, 0x99, 0x55, 0x0f, 0xde, 0x31, 0xc5,
+    0x21, 0xd2, 0x0f, 0xde, 0x48, 0xc4, 0x00, 0x49, 0x0f, 0xde, 0x39, 0xc5,
+    0x00, 0x2c, 0x0f, 0xde, 0x40, 0xcb, 0x1e, 0x89, 0x05, 0x46, 0x29, 0x42,
+    0x07, 0xb2, 0xc1, 0x6e, 0x26, 0xc8, 0x14, 0x38, 0x05, 0x44, 0x00, 0x03,
+    0xc1, 0x6e, 0x32, 0x91, 0x05, 0x46, 0x0b, 0x01, 0x6e, 0x3e, 0x87, 0x05,
+    0x45, 0xf3, 0x01, 0x6e, 0x42, 0x48, 0xb2, 0x2d, 0xc1, 0x6e, 0x46, 0x8b,
+    0x05, 0x45, 0xb3, 0x01, 0x6e, 0x54, 0x97, 0x05, 0x45, 0xc2, 0x01, 0x6e,
+    0x58, 0x15, 0xc1, 0x6e, 0x5c, 0xc2, 0x00, 0xd0, 0x05, 0x45, 0x91, 0x0e,
+    0xc1, 0x6e, 0x6c, 0x83, 0x05, 0x44, 0x13, 0x01, 0x6e, 0x76, 0x8b, 0x05,
+    0x44, 0x23, 0x01, 0x6e, 0x82, 0x97, 0x05, 0x44, 0x33, 0x01, 0x6e, 0x86,
+    0x18, 0xc1, 0x6e, 0x8a, 0x87, 0x05, 0x44, 0x63, 0x01, 0x6e, 0x94, 0x91,
+    0x05, 0x44, 0x7b, 0x01, 0x6e, 0x98, 0x0d, 0xc1, 0x6e, 0x9c, 0x09, 0xc1,
+    0x6e, 0xa6, 0x10, 0xc1, 0x6e, 0xb0, 0x05, 0xc1, 0x6e, 0xc6, 0x0c, 0xc1,
+    0x6e, 0xd0, 0x16, 0xc1, 0x6e, 0xda, 0x06, 0xc1, 0x6e, 0xe8, 0x12, 0xc1,
+    0x6e, 0xf6, 0x04, 0xc1, 0x6f, 0x00, 0xc2, 0x01, 0xc3, 0x05, 0x45, 0x51,
+    0xc2, 0x19, 0x2c, 0x05, 0x45, 0x59, 0xc2, 0x00, 0x39, 0x05, 0x45, 0x60,
+    0xc4, 0x19, 0x53, 0x05, 0x46, 0x71, 0xcb, 0x97, 0xf5, 0x05, 0x46, 0x79,
+    0x45, 0x09, 0x98, 0x41, 0x6f, 0x0a, 0x47, 0x00, 0x58, 0xc1, 0x6f, 0x2e,
+    0x48, 0xb9, 0x02, 0x41, 0x6f, 0x3a, 0x10, 0xc1, 0x6f, 0x40, 0xc6, 0xcd,
+    0x6d, 0x00, 0x41, 0xe1, 0xc5, 0xd7, 0x0e, 0x00, 0x41, 0xa1, 0xc5, 0xd3,
+    0xfd, 0x00, 0x41, 0x88, 0xcb, 0x96, 0x5e, 0x00, 0x41, 0xe9, 0xc9, 0xa9,
+    0x99, 0x00, 0x41, 0xa8, 0xc3, 0xdd, 0x83, 0x00, 0x41, 0xd1, 0xc4, 0xe1,
+    0x73, 0x00, 0x41, 0xc0, 0xc7, 0xc4, 0x33, 0x00, 0x41, 0x69, 0xce, 0x70,
+    0x34, 0x00, 0x40, 0xd9, 0xc6, 0x64, 0xa4, 0x00, 0x40, 0xc9, 0xc9, 0xac,
+    0x3c, 0x00, 0x40, 0xc1, 0xc2, 0x00, 0x74, 0x00, 0x40, 0xb2, 0x01, 0x6f,
+    0x4c, 0x8b, 0x00, 0x41, 0x41, 0xc7, 0xc3, 0x4c, 0x00, 0x41, 0x21, 0xce,
+    0x70, 0x34, 0x00, 0x40, 0xd0, 0xc4, 0xdb, 0xfb, 0x00, 0x41, 0x61, 0xc6,
+    0xc3, 0x4d, 0x00, 0x41, 0x28, 0xc9, 0xb1, 0x4c, 0x00, 0x41, 0x0a, 0x01,
+    0x6f, 0x52, 0x8b, 0x00, 0x41, 0x49, 0x97, 0x00, 0x41, 0x31, 0x83, 0x00,
+    0x41, 0x13, 0x01, 0x6f, 0x56, 0x87, 0x00, 0x40, 0xe0, 0x83, 0x00, 0x41,
+    0x00, 0xc3, 0xb8, 0xac, 0x00, 0x40, 0xa9, 0xc6, 0xcd, 0x07, 0x00, 0x40,
+    0x89, 0xc2, 0x00, 0x8d, 0x00, 0x40, 0x40, 0xc3, 0x00, 0xd0, 0x00, 0x40,
+    0xa1, 0xc6, 0xcf, 0x77, 0x00, 0x40, 0x70, 0x90, 0x00, 0x40, 0x79, 0x96,
+    0x00, 0x40, 0x39, 0x9b, 0x00, 0x40, 0x20, 0xc2, 0x04, 0xc6, 0x00, 0x40,
+    0x29, 0xc2, 0x00, 0x8d, 0x00, 0x40, 0x08, 0xc3, 0x02, 0x9b, 0x01, 0x52,
+    0xc1, 0xc2, 0x00, 0xbf, 0x01, 0x52, 0xb8, 0xc6, 0x00, 0x91, 0x0f, 0xa5,
+    0x21, 0xc4, 0x00, 0x87, 0x0f, 0xb1, 0xa1, 0xcd, 0x7f, 0x66, 0x0f, 0xb6,
+    0x60, 0xc9, 0x00, 0xca, 0x01, 0x54, 0xab, 0x01, 0x6f, 0x5a, 0xcc, 0x07,
+    0xc7, 0x01, 0x54, 0xb2, 0x01, 0x6f, 0x60, 0xc9, 0xab, 0x6d, 0x01, 0x5a,
+    0xd1, 0xcd, 0x7d, 0x2a, 0x01, 0x5a, 0xe0, 0x15, 0xc1, 0x6f, 0x66, 0xd1,
+    0x50, 0x68, 0x08, 0x8e, 0xe9, 0xca, 0x9d, 0x56, 0x08, 0x8e, 0xe1, 0x07,
+    0xc1, 0x6f, 0x7c, 0x06, 0xc1, 0x6f, 0x88, 0x46, 0x34, 0x6f, 0xc1, 0x6f,
+    0x9a, 0xd1, 0x50, 0xce, 0x08, 0x8e, 0x39, 0xc2, 0x00, 0x7a, 0x08, 0x8e,
+    0x21, 0x47, 0x02, 0x0e, 0x41, 0x6f, 0xa6, 0xc4, 0xe3, 0x9f, 0x08, 0x22,
+    0x81, 0x16, 0xc1, 0x70, 0x0b, 0xc4, 0xe0, 0xf7, 0x08, 0x22, 0x91, 0xc3,
+    0x1b, 0x05, 0x08, 0x22, 0x99, 0x15, 0xc1, 0x70, 0x15, 0xc6, 0xcc, 0x05,
+    0x08, 0x22, 0xb9, 0x42, 0x0c, 0x43, 0xc1, 0x70, 0x1f, 0x0a, 0xc1, 0x70,
+    0x27, 0xc3, 0xe5, 0xae, 0x08, 0x22, 0xd1, 0xc4, 0xe3, 0x63, 0x08, 0x22,
+    0xd9, 0xc3, 0x9e, 0xc8, 0x08, 0x22, 0xe1, 0xc3, 0x34, 0x6f, 0x08, 0x22,
+    0xe9, 0xc3, 0xe5, 0x39, 0x08, 0x22, 0xf9, 0x0f, 0xc1, 0x70, 0x33, 0xc5,
+    0xdd, 0x4e, 0x08, 0x23, 0x09, 0x42, 0x02, 0xa0, 0xc1, 0x70, 0x3f, 0xc4,
+    0xe1, 0x0f, 0x08, 0x23, 0x21, 0x0b, 0xc1, 0x70, 0x49, 0x07, 0xc1, 0x70,
+    0x59, 0x03, 0xc1, 0x70, 0x69, 0x11, 0xc1, 0x70, 0x8f, 0xc4, 0xdf, 0x73,
+    0x08, 0x23, 0x71, 0xc3, 0x20, 0x18, 0x08, 0x23, 0x79, 0xc2, 0x02, 0xae,
+    0x08, 0x23, 0x98, 0xc7, 0xc4, 0x64, 0x0d, 0xe5, 0x19, 0xc9, 0xb3, 0x05,
+    0x0d, 0xe5, 0x11, 0xd2, 0x4c, 0x7f, 0x0d, 0xe5, 0x09, 0xce, 0x70, 0x42,
+    0x0d, 0xe5, 0x00, 0x46, 0x03, 0x87, 0xc1, 0x70, 0xaf, 0xc9, 0xaf, 0x30,
+    0x01, 0x56, 0xf1, 0xc9, 0x32, 0xb7, 0x01, 0x56, 0xfb, 0x01, 0x70, 0xb5,
+    0xc7, 0xc4, 0x5d, 0x01, 0x57, 0x03, 0x01, 0x70, 0xbb, 0xd3, 0x46, 0xdc,
+    0x01, 0x5a, 0x71, 0x04, 0x41, 0x70, 0xbf, 0x91, 0x01, 0x09, 0xa1, 0x87,
+    0x01, 0x09, 0x79, 0x8e, 0x01, 0x08, 0x99, 0x89, 0x01, 0x08, 0x50, 0x8f,
+    0x01, 0x09, 0x99, 0x88, 0x01, 0x09, 0x89, 0x87, 0x01, 0x09, 0x81, 0x84,
+    0x01, 0x09, 0x61, 0x94, 0x01, 0x08, 0xd9, 0x92, 0x01, 0x08, 0xc1, 0x8e,
+    0x01, 0x08, 0x91, 0x8b, 0x01, 0x08, 0x81, 0x8a, 0x01, 0x08, 0x58, 0xd0,
+    0x5b, 0xc2, 0x0f, 0xc2, 0xb9, 0xcc, 0x82, 0x35, 0x01, 0x0e, 0xc9, 0xc5,
+    0x01, 0xa2, 0x01, 0x0c, 0xcb, 0x01, 0x70, 0xcb, 0x49, 0x01, 0xaa, 0xc1,
+    0x70, 0xcf, 0xcb, 0x01, 0xfc, 0x01, 0x58, 0x19, 0xcb, 0x94, 0x22, 0x01,
+    0x58, 0x59, 0xd5, 0x01, 0x92, 0x01, 0x5b, 0x4a, 0x01, 0x70, 0xe1, 0xd0,
+    0x5b, 0xc2, 0x0f, 0xc2, 0xb1, 0xc5, 0x01, 0xa2, 0x01, 0x0c, 0xc3, 0x01,
+    0x70, 0xe7, 0xcc, 0x82, 0x35, 0x01, 0x0e, 0xc1, 0x49, 0x01, 0xaa, 0xc1,
+    0x70, 0xeb, 0xcb, 0x01, 0xfc, 0x01, 0x58, 0x11, 0xcb, 0x94, 0x22, 0x01,
+    0x58, 0x51, 0xd5, 0x01, 0x92, 0x01, 0x5b, 0x42, 0x01, 0x70, 0xfd, 0xc5,
+    0x86, 0x2c, 0x08, 0xd4, 0xf9, 0xcc, 0x86, 0x25, 0x08, 0xd4, 0xf0, 0xc7,
+    0x40, 0xe5, 0x08, 0xd4, 0xb9, 0xc8, 0x14, 0x38, 0x08, 0xd4, 0xb1, 0xcb,
+    0x93, 0xf6, 0x08, 0xd4, 0x29, 0xcb, 0x8f, 0xe1, 0x08, 0xd4, 0x20, 0x8a,
+    0x08, 0xd4, 0x98, 0x89, 0x08, 0xd4, 0x60, 0x83, 0x08, 0xd4, 0x49, 0xc2,
+    0x00, 0xd0, 0x08, 0xd4, 0x40, 0xc3, 0x1d, 0x35, 0x08, 0xd4, 0x19, 0xc2,
+    0x00, 0xd0, 0x08, 0xd2, 0xe9, 0x83, 0x08, 0xd2, 0xe0, 0x83, 0x08, 0xd4,
+    0x09, 0xc2, 0x0d, 0xf6, 0x08, 0xd4, 0x01, 0xc2, 0x00, 0xd0, 0x08, 0xd3,
+    0xf8, 0x83, 0x08, 0xd3, 0xc9, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0xc0, 0xc2,
+    0x02, 0x1c, 0x08, 0xd3, 0xb9, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0x71, 0x83,
+    0x08, 0xd3, 0x69, 0x06, 0x41, 0x71, 0x03, 0x15, 0xc1, 0x71, 0x0d, 0xc2,
+    0x00, 0xd0, 0x08, 0xd3, 0x61, 0x83, 0x08, 0xd3, 0x59, 0x16, 0x41, 0x71,
+    0x17, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0x99, 0x83, 0x08, 0xd3, 0x90, 0xc2,
+    0x00, 0xd0, 0x08, 0xd3, 0x89, 0x83, 0x08, 0xd3, 0x80, 0x83, 0x08, 0xd3,
+    0x79, 0xc2, 0x00, 0xc1, 0x08, 0xd3, 0x51, 0xc2, 0x19, 0x2c, 0x08, 0xd3,
+    0x29, 0xc2, 0x01, 0x30, 0x08, 0xd3, 0x00, 0xc2, 0x00, 0xd0, 0x08, 0xd3,
+    0x21, 0x83, 0x08, 0xd3, 0x18, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0x11, 0x83,
+    0x08, 0xd3, 0x08, 0xc2, 0x00, 0xd0, 0x08, 0xd2, 0xf9, 0x83, 0x08, 0xd2,
+    0xf0, 0x48, 0xb2, 0x2d, 0xc1, 0x71, 0x21, 0x03, 0xc1, 0x71, 0x29, 0x91,
+    0x08, 0xd2, 0xab, 0x01, 0x71, 0x31, 0x87, 0x08, 0xd2, 0xa1, 0x97, 0x08,
+    0xd2, 0x9b, 0x01, 0x71, 0x35, 0x8b, 0x08, 0xd2, 0x88, 0xc4, 0x18, 0x10,
+    0x08, 0x87, 0xb9, 0xc2, 0x22, 0xcc, 0x08, 0x87, 0xb0, 0xc3, 0x0d, 0x14,
+    0x08, 0x87, 0xa9, 0xc3, 0x09, 0x9e, 0x08, 0x87, 0xa0, 0xc4, 0x02, 0xde,
+    0x08, 0x87, 0x99, 0xc2, 0x02, 0xa0, 0x08, 0x87, 0x90, 0x87, 0x08, 0x87,
+    0x41, 0x8a, 0x08, 0x86, 0xb0, 0x8a, 0x08, 0x87, 0x39, 0xc2, 0x16, 0x1c,
+    0x08, 0x87, 0x18, 0xc3, 0x44, 0x79, 0x08, 0x87, 0x09, 0xc2, 0x02, 0x98,
+    0x08, 0x86, 0xc9, 0xc3, 0x40, 0x40, 0x08, 0x86, 0xb8, 0xd1, 0x50, 0x57,
+    0x08, 0x7a, 0xc1, 0xcd, 0x7a, 0x52, 0x08, 0x7a, 0xaa, 0x01, 0x71, 0x39,
+    0xc8, 0x0d, 0x03, 0x08, 0x7a, 0xa0, 0xc5, 0x28, 0xee, 0x08, 0x7a, 0x99,
+    0xc2, 0x00, 0xc4, 0x08, 0x7a, 0x90, 0xc5, 0x05, 0x02, 0x08, 0x7a, 0x69,
+    0xc5, 0x00, 0xd4, 0x08, 0x7a, 0x60, 0xc5, 0x05, 0x02, 0x08, 0x7a, 0x59,
+    0xc5, 0x00, 0xd4, 0x08, 0x7a, 0x50, 0xc5, 0x00, 0xd4, 0x08, 0x7a, 0x49,
+    0xc5, 0x05, 0x02, 0x08, 0x7a, 0x38, 0xc5, 0x00, 0xd4, 0x08, 0x7a, 0x41,
+    0xc5, 0x05, 0x02, 0x08, 0x7a, 0x30, 0xc3, 0x26, 0x1a, 0x08, 0x7a, 0x21,
+    0xc5, 0xcf, 0xd8, 0x08, 0x79, 0xc8, 0xc3, 0x11, 0xef, 0x08, 0x7a, 0x09,
+    0x03, 0x41, 0x71, 0x3f, 0xc3, 0x16, 0x5a, 0x08, 0x79, 0xe9, 0xc4, 0x36,
+    0xb5, 0x08, 0x79, 0x80, 0xc2, 0x00, 0x8e, 0x08, 0x79, 0xb0, 0x16, 0xc1,
+    0x71, 0x4b, 0x08, 0xc1, 0x71, 0x5d, 0x19, 0xc1, 0x71, 0x65, 0x0e, 0xc1,
+    0x71, 0x75, 0x11, 0xc1, 0x71, 0x8b, 0x0b, 0xc1, 0x71, 0xa4, 0x05, 0xc1,
+    0x71, 0xb8, 0x14, 0xc1, 0x71, 0xde, 0x0a, 0xc1, 0x71, 0xf9, 0x06, 0xc1,
+    0x72, 0x21, 0x12, 0xc1, 0x72, 0x47, 0x07, 0xc1, 0x72, 0x80, 0x03, 0xc1,
+    0x72, 0x94, 0xc3, 0xdf, 0x37, 0x01, 0x98, 0x31, 0x0d, 0xc1, 0x72, 0xba,
+    0x09, 0xc1, 0x73, 0x1b, 0x15, 0xc1, 0x73, 0x40, 0x10, 0xc1, 0x73, 0x58,
+    0x04, 0xc1, 0x73, 0x79, 0x0f, 0xc1, 0x73, 0x99, 0x1b, 0xc1, 0x73, 0xec,
+    0xc8, 0xbe, 0xda, 0x01, 0x9e, 0xf0, 0x0e, 0xc1, 0x73, 0xf8, 0x15, 0xc1,
+    0x74, 0x02, 0x0d, 0xc1, 0x74, 0x32, 0xcc, 0x83, 0x3d, 0x01, 0x15, 0x09,
+    0x16, 0xc1, 0x74, 0x3e, 0x0f, 0xc1, 0x74, 0x4e, 0x12, 0xc1, 0x74, 0x58,
+    0x05, 0xc1, 0x74, 0x64, 0x18, 0xc1, 0x74, 0x74, 0x17, 0xc1, 0x74, 0x7e,
+    0x0a, 0xc1, 0x74, 0x8a, 0x11, 0xc1, 0x74, 0x9e, 0x08, 0xc1, 0x74, 0xa8,
+    0xc7, 0xc4, 0x56, 0x0f, 0x8c, 0xf9, 0x10, 0xc1, 0x74, 0xc0, 0xc2, 0x02,
+    0xfb, 0x0f, 0x8c, 0xa1, 0xc8, 0x0a, 0xff, 0x01, 0x4e, 0x31, 0xd5, 0x36,
+    0xc5, 0x01, 0x4e, 0x21, 0xc2, 0x15, 0x95, 0x0f, 0x8a, 0x78, 0xc9, 0xb0,
+    0xf2, 0x01, 0x20, 0xd3, 0x01, 0x74, 0xca, 0xc4, 0x40, 0x89, 0x01, 0x21,
+    0x01, 0xcf, 0x6a, 0x08, 0x01, 0x20, 0xb1, 0x45, 0xa0, 0x21, 0xc1, 0x74,
+    0xd0, 0x48, 0x46, 0xa3, 0xc1, 0x74, 0xdc, 0xcf, 0x69, 0x45, 0x01, 0x0a,
+    0x78, 0x07, 0xc1, 0x74, 0xe8, 0xcf, 0x61, 0x02, 0x01, 0x20, 0x80, 0x07,
+    0xc1, 0x74, 0xf7, 0xc3, 0x11, 0xf7, 0x01, 0x20, 0x00, 0xcd, 0x7d, 0xe0,
+    0x01, 0x20, 0xe1, 0xc8, 0xb7, 0xfa, 0x01, 0x20, 0x60, 0xc5, 0x61, 0x0c,
+    0x01, 0x20, 0xd9, 0x10, 0x41, 0x75, 0x03, 0xc4, 0x23, 0xca, 0x01, 0x20,
+    0xc1, 0xcd, 0x75, 0x58, 0x01, 0x20, 0x68, 0xc8, 0xb8, 0x9a, 0x01, 0x20,
+    0x41, 0xc3, 0x08, 0x93, 0x01, 0x20, 0x38, 0x0f, 0xc1, 0x75, 0x0f, 0xc2,
+    0x00, 0x67, 0x00, 0x39, 0x33, 0x01, 0x75, 0x1b, 0x16, 0xc1, 0x75, 0x21,
+    0x15, 0xc1, 0x75, 0x30, 0x14, 0xc1, 0x75, 0x4e, 0xc4, 0xc0, 0x4b, 0x00,
+    0x39, 0x49, 0x87, 0x00, 0x39, 0x29, 0xcd, 0x7e, 0x14, 0x00, 0x39, 0x21,
+    0xc3, 0x20, 0x18, 0x00, 0x39, 0x11, 0xc6, 0xd0, 0xcd, 0x00, 0x39, 0x01,
+    0xc4, 0xe0, 0xe7, 0x00, 0x38, 0xf9, 0xc4, 0xde, 0xef, 0x00, 0x38, 0xeb,
+    0x01, 0x75, 0x5a, 0xc2, 0x01, 0x7f, 0x00, 0x38, 0xbb, 0x01, 0x75, 0x60,
+    0xc4, 0x69, 0x81, 0x00, 0x38, 0xc9, 0xc3, 0x7e, 0x89, 0x00, 0x38, 0xc1,
+    0x06, 0xc1, 0x75, 0x66, 0xc5, 0xd7, 0x5e, 0x00, 0x38, 0x9b, 0x01, 0x75,
+    0x72, 0xc4, 0xe3, 0x27, 0x00, 0x38, 0x91, 0xc5, 0x58, 0x4d, 0x00, 0x38,
+    0x80, 0x44, 0x7c, 0x67, 0xc1, 0x75, 0x78, 0x48, 0xbf, 0x2a, 0xc1, 0x75,
+    0x82, 0xcf, 0x62, 0xf1, 0x00, 0x38, 0x28, 0xc7, 0x08, 0x6b, 0x00, 0x39,
+    0xc9, 0xca, 0x01, 0x68, 0x00, 0x39, 0xc0, 0x45, 0xd8, 0x94, 0xc1, 0x75,
+    0x94, 0xc4, 0xde, 0xa7, 0x00, 0x39, 0xf9, 0xc7, 0xc4, 0x2c, 0x00, 0x3a,
+    0x10, 0xc6, 0x19, 0x7a, 0x00, 0x39, 0xa9, 0xc5, 0x05, 0x02, 0x00, 0x39,
+    0xa1, 0xc5, 0x00, 0xd4, 0x00, 0x39, 0x98, 0xc6, 0x19, 0x7a, 0x00, 0x39,
+    0x91, 0xc5, 0x05, 0x02, 0x00, 0x39, 0x89, 0xc5, 0x00, 0xd4, 0x00, 0x39,
+    0x80, 0xc9, 0xaf, 0x0c, 0x00, 0x38, 0x51, 0x4b, 0x8f, 0xd6, 0x41, 0x75,
+    0xa0, 0x48, 0xbf, 0x02, 0xc1, 0x75, 0xac, 0x4a, 0x9f, 0x22, 0x41, 0x75,
+    0xbb, 0xcf, 0x60, 0x12, 0x00, 0x38, 0x01, 0x45, 0x75, 0x81, 0x41, 0x75,
+    0xca, 0x51, 0x55, 0x41, 0xc1, 0x75, 0xd6, 0x4a, 0x0e, 0x7d, 0x41, 0x75,
+    0xe2, 0xc5, 0x00, 0xd4, 0x00, 0x3a, 0x39, 0xc5, 0x05, 0x02, 0x00, 0x3a,
+    0x40, 0x91, 0x05, 0x40, 0x39, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x40, 0x91,
+    0x05, 0x40, 0x49, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x50, 0x91, 0x05, 0x40,
+    0x61, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x68, 0x16, 0xc1, 0x75, 0xee, 0x91,
+    0x05, 0x40, 0xa1, 0xc2, 0x01, 0x23, 0x05, 0x40, 0xa8, 0x06, 0xc1, 0x75,
+    0xf8, 0x91, 0x05, 0x40, 0xb1, 0xc2, 0x01, 0x23, 0x05, 0x40, 0xb8, 0x91,
+    0x05, 0x40, 0x71, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x78, 0x91, 0x05, 0x40,
+    0xc9, 0xc2, 0x01, 0x23, 0x05, 0x40, 0xd0, 0x91, 0x05, 0x40, 0xd9, 0xc2,
+    0x01, 0x23, 0x05, 0x40, 0xe0, 0x91, 0x05, 0x40, 0xf1, 0xc2, 0x00, 0x79,
+    0x05, 0x41, 0x00, 0xc7, 0x14, 0x39, 0x05, 0x40, 0x59, 0xd0, 0x5a, 0xd2,
+    0x05, 0x41, 0x60, 0x46, 0x00, 0x8b, 0x41, 0x76, 0x02, 0x95, 0x01, 0x39,
+    0x40, 0xd1, 0x4f, 0xe0, 0x01, 0x3e, 0x49, 0xc2, 0x00, 0x55, 0x01, 0x14,
+    0x1b, 0x01, 0x76, 0x14, 0x46, 0x00, 0xd4, 0xc1, 0x76, 0x18, 0x45, 0x00,
+    0x8c, 0xc1, 0x76, 0x24, 0x47, 0x13, 0x6d, 0x41, 0x76, 0x36, 0x0e, 0xc1,
+    0x76, 0x42, 0xd1, 0x1a, 0x4a, 0x01, 0x03, 0xf1, 0x07, 0xc1, 0x76, 0x4e,
+    0xc5, 0x1d, 0x1d, 0x01, 0x03, 0xd9, 0xc9, 0x60, 0xf3, 0x01, 0x03, 0xd1,
+    0xc4, 0x26, 0x78, 0x01, 0x03, 0xc9, 0x15, 0xc1, 0x76, 0x5a, 0x08, 0xc1,
+    0x76, 0x66, 0xc4, 0x15, 0xe7, 0x01, 0x03, 0x81, 0x16, 0xc1, 0x76, 0x72,
+    0xc3, 0x05, 0x14, 0x00, 0x05, 0xc8, 0xca, 0xa1, 0x98, 0x00, 0xe6, 0x39,
+    0xca, 0xa4, 0x86, 0x00, 0xe6, 0x31, 0xca, 0x9c, 0x8e, 0x00, 0xe6, 0x29,
+    0xcb, 0x90, 0x23, 0x00, 0xe6, 0x21, 0xc5, 0xdd, 0x53, 0x00, 0xe6, 0x19,
+    0x12, 0xc1, 0x76, 0x7e, 0xc5, 0xdd, 0xb7, 0x00, 0xe6, 0x00, 0x08, 0xc1,
+    0x76, 0x8a, 0x04, 0xc1, 0x76, 0x94, 0x0e, 0xc1, 0x76, 0x9e, 0x14, 0xc1,
+    0x76, 0xa8, 0x15, 0xc1, 0x76, 0xb2, 0x0d, 0xc1, 0x76, 0xbc, 0xc2, 0x00,
+    0xd0, 0x00, 0xdd, 0x01, 0xc2, 0x8d, 0x8f, 0x00, 0xdc, 0xf9, 0xc2, 0x01,
+    0x4a, 0x00, 0xdc, 0xe9, 0xc2, 0x19, 0x2c, 0x00, 0xdc, 0xd1, 0xc2, 0x01,
+    0xc3, 0x00, 0xdc, 0xc9, 0xc2, 0x02, 0x41, 0x00, 0xdc, 0xb9, 0xc2, 0x00,
+    0xb0, 0x00, 0xdc, 0xa9, 0x10, 0xc1, 0x76, 0xc6, 0xc2, 0x0e, 0x9a, 0x00,
+    0xdc, 0x99, 0xc2, 0x01, 0x6f, 0x00, 0xdc, 0x91, 0xc2, 0x02, 0x1c, 0x00,
+    0xdc, 0x81, 0xc2, 0x25, 0x3b, 0x00, 0xdc, 0x79, 0xc2, 0x00, 0x64, 0x00,
+    0xdc, 0x71, 0xc2, 0x01, 0x30, 0x00, 0xdc, 0x61, 0xc2, 0x0f, 0x9a, 0x00,
+    0xdc, 0x59, 0x87, 0x00, 0xdc, 0x43, 0x01, 0x76, 0xd6, 0x91, 0x00, 0xdc,
+    0x39, 0x83, 0x00, 0xdc, 0x1b, 0x01, 0x76, 0xda, 0x97, 0x00, 0xdc, 0x29,
+    0x8b, 0x00, 0xdc, 0x20, 0xc4, 0x26, 0x78, 0x00, 0xdd, 0xc9, 0xc5, 0x06,
+    0xdb, 0x00, 0xdd, 0xc1, 0x15, 0xc1, 0x76, 0xde, 0x08, 0xc1, 0x76, 0xea,
+    0x16, 0xc1, 0x76, 0xf6, 0xc3, 0x05, 0x14, 0x00, 0xdd, 0x89, 0xc4, 0x15,
+    0xe7, 0x00, 0xdd, 0x80, 0x47, 0xc1, 0xe7, 0xc1, 0x77, 0x02, 0x42, 0x16,
+    0x59, 0xc1, 0x77, 0x0e, 0xc7, 0xc3, 0x5a, 0x00, 0xdd, 0x08, 0xc6, 0x1e,
+    0x95, 0x00, 0xdd, 0x59, 0x42, 0x00, 0xb0, 0x41, 0x77, 0x1a, 0x10, 0xc1,
+    0x77, 0x24, 0xc5, 0xdb, 0x1e, 0x00, 0xdd, 0x40, 0xca, 0x37, 0x4e, 0x01,
+    0x13, 0xf9, 0xc5, 0x07, 0x62, 0x01, 0x13, 0xe8, 0x4c, 0x24, 0x3b, 0xc1,
+    0x77, 0x42, 0xcb, 0x0e, 0xbd, 0x01, 0x55, 0xa1, 0x44, 0x1f, 0xb2, 0xc1,
+    0x77, 0x4e, 0xcf, 0x6a, 0x8f, 0x01, 0x55, 0xc0, 0x00, 0x41, 0x77, 0x5a,
+    0xd0, 0x03, 0xb7, 0x01, 0x4b, 0xc9, 0x42, 0x06, 0x62, 0x41, 0x77, 0x6f,
+    0xc3, 0x02, 0xa3, 0x01, 0x55, 0xe9, 0xcf, 0x60, 0xf3, 0x01, 0x55, 0xf9,
+    0xd9, 0x1f, 0x18, 0x01, 0x56, 0x08, 0xca, 0x0e, 0xbe, 0x01, 0x04, 0x61,
+    0xc4, 0x00, 0x2d, 0x01, 0x04, 0x40, 0xc4, 0x18, 0x10, 0x01, 0x04, 0x39,
+    0xc2, 0x22, 0xcc, 0x01, 0x04, 0x30, 0xc3, 0x0d, 0x14, 0x01, 0x04, 0x29,
+    0xc3, 0x09, 0x9e, 0x01, 0x04, 0x20, 0xc4, 0x02, 0xde, 0x01, 0x04, 0x19,
+    0xc2, 0x02, 0xa0, 0x01, 0x04, 0x10, 0x4a, 0x00, 0x87, 0xc1, 0x77, 0x7b,
+    0x4e, 0x1d, 0x3c, 0x41, 0x77, 0x92, 0x42, 0x00, 0x99, 0xc1, 0x77, 0x9e,
+    0x07, 0xc1, 0x77, 0xb0, 0x14, 0xc1, 0x77, 0xcb, 0x16, 0xc1, 0x77, 0xdd,
+    0xcc, 0x87, 0x21, 0x0f, 0xa9, 0xc9, 0xce, 0x71, 0xf4, 0x0f, 0xa9, 0xc1,
+    0xd1, 0x55, 0x96, 0x01, 0x53, 0x09, 0x03, 0xc1, 0x77, 0xe9, 0xd1, 0x54,
+    0x0f, 0x07, 0xf2, 0x89, 0xc9, 0x11, 0xf6, 0x07, 0xf2, 0x91, 0xc9, 0xa8,
+    0x55, 0x07, 0xf2, 0xa1, 0xcd, 0x2c, 0xb2, 0x07, 0xf2, 0xb1, 0x42, 0x00,
+    0x49, 0xc1, 0x77, 0xfb, 0xcb, 0x97, 0x9d, 0x07, 0xf2, 0xf9, 0x12, 0xc1,
+    0x78, 0x07, 0xcc, 0x89, 0xcd, 0x07, 0xf3, 0x19, 0xd1, 0x54, 0xb9, 0x07,
+    0xf3, 0x29, 0xcb, 0x99, 0x60, 0x07, 0xf3, 0x48, 0xcc, 0x23, 0x9f, 0x01,
+    0x55, 0x60, 0x02, 0xc1, 0x78, 0x13, 0x00, 0x41, 0x78, 0x1b, 0xce, 0x50,
+    0xaf, 0x01, 0x1c, 0xc9, 0xc2, 0x00, 0x29, 0x0f, 0xad, 0x42, 0x01, 0x78,
+    0x27, 0xc2, 0x00, 0xcc, 0x0f, 0xa3, 0xc0, 0xc5, 0x07, 0x62, 0x01, 0x10,
+    0xe8, 0xd5, 0x37, 0x43, 0x01, 0x17, 0x41, 0xce, 0x74, 0x32, 0x01, 0x15,
+    0x81, 0x46, 0x23, 0xa0, 0xc1, 0x78, 0x2d, 0x46, 0x00, 0xd4, 0x41, 0x78,
+    0x39, 0x42, 0x00, 0x99, 0xc1, 0x78, 0x51, 0xc9, 0xa8, 0x55, 0x07, 0xf0,
+    0xa1, 0x07, 0xc1, 0x78, 0x5d, 0xcd, 0x2c, 0xb2, 0x07, 0xf0, 0xb1, 0xd3,
+    0x22, 0x78, 0x07, 0xf0, 0xc9, 0xce, 0x72, 0x1e, 0x07, 0xf1, 0x81, 0xcd,
+    0x80, 0x29, 0x07, 0xf1, 0xa1, 0x0e, 0xc1, 0x78, 0x6f, 0x46, 0x00, 0x2c,
+    0xc1, 0x78, 0x7b, 0x4c, 0x1c, 0x86, 0x41, 0x78, 0xa9, 0xcd, 0x80, 0x1c,
+    0x01, 0x18, 0xc1, 0xc7, 0xc4, 0x72, 0x0f, 0xb6, 0x80, 0x04, 0xc1, 0x78,
+    0xb5, 0x47, 0x70, 0xa5, 0xc1, 0x78, 0xc1, 0x16, 0xc1, 0x78, 0xd9, 0x08,
+    0xc1, 0x78, 0xf1, 0x15, 0xc1, 0x78, 0xfb, 0x49, 0xb2, 0x12, 0xc1, 0x79,
+    0x07, 0x48, 0xbb, 0x82, 0xc1, 0x79, 0x1f, 0x48, 0xb7, 0x1a, 0xc1, 0x79,
+    0x37, 0x0d, 0xc1, 0x79, 0x4f, 0x49, 0xa8, 0xf7, 0xc1, 0x79, 0x5b, 0xc9,
+    0xa9, 0x7e, 0x0f, 0x85, 0xf9, 0xcb, 0x8d, 0x16, 0x0f, 0x86, 0xf8, 0x16,
+    0xc1, 0x79, 0x73, 0x08, 0x41, 0x79, 0x7f, 0x00, 0x41, 0x79, 0x8b, 0x46,
+    0x08, 0xf1, 0xc1, 0x79, 0x9d, 0xc9, 0xb0, 0xa1, 0x0f, 0xa6, 0x20, 0x00,
+    0xc1, 0x79, 0xa9, 0xd8, 0x25, 0xbb, 0x01, 0x33, 0xe8, 0x4d, 0x29, 0xb9,
+    0xc1, 0x79, 0xb5, 0x4f, 0x0b, 0x17, 0x41, 0x7a, 0x1d, 0x16, 0xc1, 0x7a,
+    0x85, 0xc8, 0x4b, 0x5f, 0x01, 0x24, 0x31, 0x07, 0xc1, 0x7a, 0x97, 0x15,
+    0xc1, 0x7a, 0xa3, 0x08, 0x41, 0x7a, 0xaf, 0xc4, 0x26, 0x78, 0x01, 0x23,
+    0xe1, 0xc5, 0x06, 0xdb, 0x01, 0x23, 0xd9, 0x15, 0xc1, 0x7a, 0xbb, 0x08,
+    0xc1, 0x7a, 0xc7, 0x16, 0xc1, 0x7a, 0xd3, 0xc3, 0x05, 0x14, 0x01, 0x23,
+    0xa0, 0x0d, 0xc1, 0x7a, 0xdf, 0xc5, 0xd9, 0x61, 0x01, 0x90, 0x0b, 0x01,
+    0x7a, 0xf1, 0x16, 0xc1, 0x7a, 0xf7, 0xc5, 0xd6, 0x8c, 0x01, 0x90, 0x1b,
+    0x01, 0x7b, 0x09, 0xc5, 0xda, 0xe7, 0x01, 0x90, 0x23, 0x01, 0x7b, 0x0f,
+    0x12, 0xc1, 0x7b, 0x15, 0xc4, 0xad, 0x2b, 0x01, 0x90, 0x33, 0x01, 0x7b,
+    0x27, 0xc5, 0xb7, 0x9d, 0x01, 0x90, 0x3b, 0x01, 0x7b, 0x2d, 0x05, 0xc1,
+    0x7b, 0x33, 0xc5, 0x90, 0xe4, 0x01, 0x90, 0x6a, 0x01, 0x7b, 0x45, 0xc4,
+    0xe1, 0x47, 0x01, 0x90, 0xe9, 0xc3, 0x0d, 0x03, 0x01, 0x90, 0xf0, 0xc3,
+    0x05, 0x14, 0x01, 0x91, 0x01, 0x16, 0xc1, 0x7b, 0x4b, 0x08, 0xc1, 0x7b,
+    0x5d, 0x15, 0xc1, 0x7b, 0x6d, 0x07, 0xc1, 0x7b, 0x8b, 0x10, 0xc1, 0x7b,
+    0x9d, 0x0f, 0xc1, 0x7b, 0xa9, 0x19, 0xc1, 0x7b, 0xb5, 0xc4, 0xdf, 0xbf,
+    0x01, 0x91, 0x91, 0x05, 0xc1, 0x7b, 0xc1, 0xc5, 0xdd, 0x71, 0x01, 0x91,
+    0xc1, 0x42, 0x01, 0x19, 0xc1, 0x7b, 0xcd, 0xc8, 0xba, 0x62, 0x01, 0x91,
+    0xf8, 0xc2, 0x00, 0xf1, 0x01, 0x11, 0x29, 0x45, 0x00, 0x8c, 0x41, 0x7b,
+    0xdd, 0xca, 0x1b, 0x09, 0x01, 0x01, 0x49, 0xc2, 0x07, 0xa3, 0x01, 0x70,
+    0x79, 0xc7, 0x62, 0x81, 0x01, 0x72, 0x68, 0xc5, 0x26, 0xf7, 0x08, 0xd7,
+    0xc1, 0xc7, 0x41, 0x71, 0x08, 0xd7, 0x80, 0x00, 0x41, 0x7b, 0xe9, 0x08,
+    0xc1, 0x7b, 0xf8, 0x8b, 0x08, 0xd6, 0xbb, 0x01, 0x7c, 0x02, 0x97, 0x08,
+    0xd6, 0xcb, 0x01, 0x7c, 0x06, 0x91, 0x08, 0xd6, 0xc1, 0x87, 0x08, 0xd6,
+    0xb1, 0x83, 0x08, 0xd6, 0xa9, 0x05, 0xc1, 0x7c, 0x0a, 0xc2, 0x00, 0x39,
+    0x08, 0xd6, 0x91, 0x12, 0xc1, 0x7c, 0x14, 0x10, 0xc1, 0x7c, 0x1e, 0x16,
+    0xc1, 0x7c, 0x28, 0xc2, 0x01, 0x5d, 0x08, 0xd6, 0x61, 0xc2, 0x0d, 0xf6,
+    0x08, 0xd6, 0x59, 0x0d, 0xc1, 0x7c, 0x32, 0xc2, 0x01, 0x30, 0x08, 0xd6,
+    0x49, 0xc2, 0x00, 0xd0, 0x08, 0xd6, 0x41, 0xc2, 0x02, 0x41, 0x08, 0xd6,
+    0x31, 0xc2, 0x02, 0x1c, 0x08, 0xd6, 0x29, 0xc2, 0x0e, 0x9a, 0x08, 0xd6,
+    0x21, 0xc2, 0x01, 0xc3, 0x08, 0xd6, 0x19, 0xc2, 0x00, 0xdb, 0x08, 0xd6,
+    0x10, 0xc5, 0x26, 0xf7, 0x08, 0xd7, 0x91, 0xca, 0xa4, 0x04, 0x08, 0xd7,
+    0x88, 0x00, 0x41, 0x7c, 0x3c, 0xc6, 0x26, 0xf6, 0x08, 0xd7, 0x50, 0xc5,
+    0x26, 0xf7, 0x08, 0xd7, 0x49, 0xc4, 0x0d, 0xe5, 0x08, 0xd7, 0x2a, 0x01,
+    0x7c, 0x4b, 0xc4, 0x0a, 0x64, 0x0f, 0x99, 0xa1, 0xc9, 0xb4, 0x01, 0x0f,
+    0xd7, 0x99, 0xc7, 0xc5, 0x0c, 0x0f, 0xd7, 0xa1, 0xc6, 0x28, 0x24, 0x01,
+    0x70, 0xc8, 0x47, 0x34, 0x2f, 0xc1, 0x7c, 0x51, 0xd6, 0x2c, 0x9c, 0x08,
+    0x43, 0xc1, 0x42, 0x00, 0x49, 0x41, 0x7c, 0x5f, 0x18, 0xc1, 0x7c, 0x6b,
+    0x0d, 0xc1, 0x7c, 0x77, 0x16, 0xc1, 0x7c, 0x89, 0x1b, 0xc1, 0x7c, 0x93,
+    0xc3, 0xe6, 0x20, 0x0b, 0x5c, 0x59, 0x42, 0x00, 0xd0, 0xc1, 0x7c, 0x9f,
+    0xc4, 0xe4, 0x03, 0x0b, 0x5c, 0x39, 0xc4, 0xe3, 0xcb, 0x0b, 0x5c, 0x21,
+    0xc5, 0xd3, 0xdf, 0x0b, 0x5c, 0x09, 0x0e, 0x41, 0x7c, 0xa9, 0x05, 0xc1,
+    0x7c, 0xb5, 0xc3, 0xe6, 0x3e, 0x0b, 0x59, 0x71, 0xc2, 0x20, 0xec, 0x0b,
+    0x59, 0x69, 0x10, 0xc1, 0x7c, 0xc1, 0xc5, 0xd7, 0x54, 0x0b, 0x59, 0x51,
+    0x0a, 0xc1, 0x7c, 0xdd, 0xc3, 0xc4, 0x86, 0x0b, 0x59, 0x31, 0xc3, 0x2d,
+    0x34, 0x0b, 0x59, 0x21, 0xc4, 0xe4, 0xd7, 0x0b, 0x59, 0x19, 0xc3, 0xbe,
+    0x32, 0x0b, 0x59, 0x09, 0xc3, 0x20, 0xeb, 0x0b, 0x58, 0xf1, 0xc3, 0xe5,
+    0x4e, 0x0b, 0x58, 0xe0, 0xc8, 0xbc, 0x0a, 0x0b, 0x5b, 0xb9, 0xc8, 0xbf,
+    0x72, 0x0b, 0x5b, 0xb1, 0x16, 0xc1, 0x7c, 0xef, 0x05, 0xc1, 0x7c, 0xfe,
+    0xd2, 0x4d, 0xe7, 0x0b, 0x5b, 0x90, 0xc2, 0x11, 0xa5, 0x0b, 0x5b, 0x89,
+    0x44, 0x9f, 0x7e, 0x41, 0x7d, 0x0a, 0xc2, 0x20, 0xec, 0x0b, 0x5b, 0x79,
+    0xca, 0x9f, 0x7c, 0x0b, 0x5b, 0x69, 0xce, 0x73, 0xb4, 0x0b, 0x5b, 0x30,
+    0xc3, 0xe6, 0x1d, 0x0b, 0x5b, 0x59, 0xc3, 0xe5, 0x60, 0x0b, 0x5b, 0x48,
+    0xc3, 0x44, 0x23, 0x0b, 0x5b, 0x51, 0x1b, 0xc1, 0x7d, 0x16, 0xc3, 0x26,
+    0x9a, 0x0b, 0x5a, 0x20, 0xc3, 0x95, 0x80, 0x0b, 0x5b, 0x41, 0xc2, 0x01,
+    0x0f, 0x0b, 0x5b, 0x28, 0xc3, 0x46, 0x7d, 0x0b, 0x5b, 0x19, 0xc4, 0xe4,
+    0x47, 0x0b, 0x5a, 0x11, 0xc4, 0xdf, 0x67, 0x0b, 0x5a, 0x01, 0xc4, 0xe0,
+    0x47, 0x0b, 0x59, 0xd9, 0x16, 0x41, 0x7d, 0x22, 0xc8, 0xbd, 0x12, 0x0b,
+    0x5b, 0x09, 0x42, 0x00, 0xc4, 0x41, 0x7d, 0x2c, 0xc9, 0x33, 0xed, 0x0b,
+    0x5a, 0xf9, 0x95, 0x0b, 0x5a, 0xe0, 0xc4, 0x18, 0x10, 0x0b, 0x5a, 0xb9,
+    0xc2, 0x22, 0xcc, 0x0b, 0x5a, 0xb0, 0xc3, 0x0d, 0x14, 0x0b, 0x5a, 0xa9,
+    0xc3, 0x09, 0x9e, 0x0b, 0x5a, 0xa0, 0xc4, 0x02, 0xde, 0x0b, 0x5a, 0x99,
+    0xc2, 0x02, 0xa0, 0x0b, 0x5a, 0x90, 0xc3, 0xe5, 0x30, 0x0b, 0x59, 0xb1,
+    0xc2, 0x00, 0x5a, 0x0b, 0x59, 0x80, 0xc3, 0xa7, 0x6a, 0x0b, 0x59, 0xa1,
+    0x91, 0x0b, 0x59, 0x88, 0xc3, 0x40, 0xe3, 0x0b, 0x59, 0x99, 0xc2, 0x00,
+    0xcb, 0x0b, 0x59, 0x90, 0x03, 0xc1, 0x7d, 0x34, 0x98, 0x0b, 0x58, 0xb9,
+    0x84, 0x0b, 0x58, 0xb1, 0x19, 0xc1, 0x7d, 0x3c, 0x0b, 0xc1, 0x7d, 0x44,
+    0x17, 0x41, 0x7d, 0x4c, 0x98, 0x0b, 0x58, 0xc9, 0x84, 0x0b, 0x58, 0xc0,
+    0x03, 0xc1, 0x7d, 0x54, 0x98, 0x0b, 0x58, 0x19, 0x84, 0x0b, 0x58, 0x10,
+    0x98, 0x0b, 0x58, 0x99, 0x84, 0x0b, 0x58, 0x91, 0x11, 0x41, 0x7d, 0x5c,
+    0x03, 0xc1, 0x7d, 0x64, 0x98, 0x0b, 0x58, 0x39, 0x84, 0x0b, 0x58, 0x30,
+    0x98, 0x0b, 0x58, 0x49, 0x84, 0x0b, 0x58, 0x41, 0x07, 0x41, 0x7d, 0x6c,
+    0xc4, 0x2a, 0xcc, 0x0f, 0xa7, 0x79, 0xc4, 0x01, 0xc3, 0x01, 0x80, 0x92,
+    0x01, 0x7d, 0x74, 0x00, 0xc1, 0x7d, 0x7a, 0xcb, 0x7a, 0xa2, 0x0f, 0xa5,
+    0xd8, 0x91, 0x08, 0x5d, 0x51, 0xc4, 0x18, 0x12, 0x08, 0x5d, 0x70, 0xc3,
+    0x77, 0x79, 0x08, 0x5c, 0x79, 0xc4, 0xdc, 0x2d, 0x08, 0x5c, 0x68, 0x16,
+    0xc1, 0x7d, 0xa2, 0xc3, 0x05, 0x14, 0x08, 0x48, 0xb2, 0x01, 0x7d, 0xb2,
+    0x16, 0xc1, 0x7d, 0xb8, 0x15, 0xc1, 0x7d, 0xc4, 0xc4, 0xa9, 0x57, 0x08,
+    0x48, 0x99, 0xc3, 0xe5, 0x78, 0x08, 0x48, 0x91, 0xc2, 0x00, 0x67, 0x08,
+    0x48, 0x81, 0x03, 0xc1, 0x7d, 0xd6, 0xc3, 0x20, 0x18, 0x08, 0x48, 0x69,
+    0xc3, 0x00, 0x4e, 0x08, 0x48, 0x61, 0xc4, 0xb9, 0xf7, 0x08, 0x48, 0x59,
+    0xc3, 0xba, 0x37, 0x08, 0x48, 0x51, 0xc3, 0x4a, 0xb9, 0x08, 0x48, 0x49,
+    0xc2, 0x01, 0x7f, 0x08, 0x48, 0x23, 0x01, 0x7d, 0xe2, 0xc3, 0x69, 0x81,
+    0x08, 0x48, 0x31, 0xc3, 0xe4, 0xf4, 0x08, 0x48, 0x29, 0xc4, 0xdb, 0x4b,
+    0x08, 0x48, 0x19, 0xc4, 0xe0, 0x8f, 0x08, 0x48, 0x11, 0xc3, 0x0b, 0xc8,
+    0x08, 0x48, 0x08, 0x0d, 0xc1, 0x7d, 0xe6, 0x09, 0xc1, 0x7d, 0xf0, 0x10,
+    0xc1, 0x7d, 0xfa, 0x05, 0xc1, 0x7e, 0x10, 0xc2, 0x25, 0x3b, 0x05, 0x42,
+    0x31, 0x16, 0xc1, 0x7e, 0x1d, 0x06, 0xc1, 0x7e, 0x2f, 0x12, 0xc1, 0x7e,
+    0x3f, 0xc2, 0x01, 0x5d, 0x05, 0x42, 0x71, 0xc2, 0x01, 0xc3, 0x05, 0x42,
+    0x79, 0xc2, 0x01, 0x4a, 0x05, 0x42, 0x99, 0x1c, 0xc1, 0x7e, 0x49, 0x15,
+    0xc1, 0x7e, 0x53, 0xc2, 0x19, 0x2c, 0x05, 0x42, 0xb9, 0xc2, 0x00, 0x39,
+    0x05, 0x42, 0xc1, 0xc2, 0x00, 0xdb, 0x05, 0x42, 0xc9, 0xc2, 0x00, 0xd0,
+    0x05, 0x42, 0xe1, 0x83, 0x05, 0x42, 0xeb, 0x01, 0x7e, 0x63, 0x8b, 0x05,
+    0x42, 0xf1, 0x97, 0x05, 0x42, 0xf9, 0x87, 0x05, 0x43, 0x03, 0x01, 0x7e,
+    0x6f, 0x91, 0x05, 0x43, 0x09, 0xc2, 0x0f, 0x9a, 0x05, 0x43, 0x11, 0xc2,
+    0x8d, 0x8f, 0x05, 0x43, 0x19, 0xc2, 0x00, 0x87, 0x05, 0x43, 0x21, 0x45,
+    0x17, 0xbd, 0x41, 0x7e, 0x73, 0x17, 0xc1, 0x7e, 0x7f, 0xcf, 0x68, 0x46,
+    0x05, 0x43, 0xa0, 0xc4, 0x01, 0xe2, 0x05, 0x43, 0xb1, 0xcb, 0x99, 0x6b,
+    0x05, 0x43, 0xb8, 0xc9, 0xa2, 0x56, 0x08, 0x0e, 0x81, 0x0e, 0xc1, 0x7e,
+    0x8b, 0xc6, 0xca, 0xd9, 0x08, 0x0f, 0xa0, 0xcc, 0x89, 0x91, 0x08, 0x0e,
+    0x91, 0xc4, 0xdf, 0xeb, 0x08, 0x0e, 0xc1, 0xc4, 0x5e, 0xc9, 0x08, 0x0f,
+    0x80, 0x03, 0xc1, 0x7e, 0x97, 0xc4, 0xdf, 0xbb, 0x08, 0x0e, 0xa1, 0xc3,
+    0x46, 0x7d, 0x08, 0x0e, 0xe1, 0x11, 0x41, 0x7e, 0xa7, 0xc4, 0x29, 0xfd,
+    0x08, 0x0e, 0xa9, 0xc8, 0xbd, 0xda, 0x08, 0x0f, 0xe0, 0xc5, 0xb7, 0xed,
+    0x08, 0x0e, 0xb1, 0xc3, 0x00, 0xbf, 0x08, 0x0f, 0x49, 0xc3, 0x06, 0xa7,
+    0x08, 0x0f, 0x50, 0x11, 0xc1, 0x7e, 0xb6, 0xc2, 0x02, 0xe0, 0x08, 0x0f,
+    0x8b, 0x01, 0x7e, 0xc0, 0xc8, 0xb8, 0x62, 0x08, 0x0f, 0x58, 0x42, 0x00,
+    0x0a, 0xc1, 0x7e, 0xc6, 0xc2, 0x39, 0x8b, 0x08, 0x0e, 0xf9, 0xc4, 0x04,
+    0x15, 0x08, 0x0f, 0x29, 0xc8, 0xb9, 0xca, 0x08, 0x0f, 0xd9, 0xc7, 0xc0,
+    0xdd, 0x08, 0x0f, 0xd0, 0xc6, 0xca, 0xaf, 0x08, 0x0e, 0xe9, 0xc5, 0xd4,
+    0xed, 0x08, 0x0e, 0xf0, 0x86, 0x08, 0x0f, 0x01, 0xc2, 0x00, 0x35, 0x08,
+    0x0f, 0xb0, 0xc4, 0xe1, 0x07, 0x08, 0x0f, 0x19, 0xc2, 0x00, 0x5f, 0x08,
+    0x0f, 0x78, 0xc2, 0x00, 0xc2, 0x08, 0x0f, 0x69, 0xc6, 0xcd, 0x67, 0x08,
+    0x0f, 0xa8, 0xc5, 0xd5, 0xe2, 0x08, 0x0f, 0xc9, 0xc7, 0xc4, 0x87, 0x08,
+    0x0e, 0xb8, 0xc4, 0x02, 0xde, 0x00, 0x00, 0x99, 0xc2, 0x02, 0xa0, 0x00,
+    0x00, 0x90, 0xcb, 0x83, 0x0e, 0x00, 0x4a, 0xa1, 0xd0, 0x50, 0xcf, 0x00,
+    0x4b, 0x80, 0xcb, 0x1f, 0x0d, 0x00, 0x4a, 0x99, 0xc9, 0x93, 0x31, 0x05,
+    0x47, 0xc8, 0x4b, 0x91, 0xc5, 0xc1, 0x7e, 0xd0, 0x44, 0x00, 0xbb, 0x41,
+    0x7e, 0xdc, 0x03, 0xc1, 0x7f, 0x11, 0xcf, 0x61, 0x11, 0x00, 0x4a, 0x71,
+    0x91, 0x00, 0x4a, 0x5b, 0x01, 0x7f, 0x25, 0x46, 0x2e, 0xee, 0xc1, 0x7f,
+    0x2f, 0x47, 0xc7, 0x7b, 0xc1, 0x7f, 0x37, 0x87, 0x00, 0x4a, 0x39, 0x48,
+    0xb2, 0x2d, 0xc1, 0x7f, 0x45, 0x97, 0x00, 0x4a, 0x0b, 0x01, 0x7f, 0x53,
+    0x8b, 0x00, 0x49, 0xfa, 0x01, 0x7f, 0x5e, 0x0a, 0xc1, 0x7f, 0x62, 0x15,
+    0xc1, 0x7f, 0x6c, 0x18, 0xc1, 0x7f, 0x7a, 0x0e, 0xc1, 0x7f, 0x84, 0x14,
+    0xc1, 0x7f, 0x8c, 0x1b, 0xc1, 0x7f, 0x9c, 0xc2, 0x01, 0xc3, 0x00, 0x49,
+    0x73, 0x01, 0x7f, 0xa6, 0x04, 0xc1, 0x7f, 0xac, 0x12, 0xc1, 0x7f, 0xbc,
+    0x10, 0xc1, 0x7f, 0xc6, 0x06, 0xc1, 0x7f, 0xda, 0x16, 0xc1, 0x7f, 0xe8,
+    0x0c, 0xc1, 0x7f, 0xf6, 0x05, 0xc1, 0x80, 0x06, 0x09, 0xc1, 0x80, 0x13,
+    0x0d, 0xc1, 0x80, 0x27, 0x83, 0x00, 0x48, 0x2b, 0x01, 0x80, 0x2f, 0x91,
+    0x00, 0x48, 0x9b, 0x01, 0x80, 0x43, 0x87, 0x00, 0x48, 0x79, 0x97, 0x00,
+    0x48, 0x4b, 0x01, 0x80, 0x4d, 0x8b, 0x00, 0x48, 0x3b, 0x01, 0x80, 0x58,
+    0xc2, 0x0f, 0x9a, 0x00, 0x4a, 0xc1, 0x1c, 0xc1, 0x80, 0x5c, 0xc2, 0x00,
+    0x87, 0x00, 0x4a, 0xf0, 0x45, 0x09, 0x98, 0xc1, 0x80, 0x66, 0xcb, 0x97,
+    0xf5, 0x00, 0x4b, 0x29, 0xc4, 0x19, 0x53, 0x00, 0x4b, 0x20, 0xc7, 0xc7,
+    0x19, 0x0f, 0x9e, 0xe8, 0x4f, 0x0b, 0x17, 0xc1, 0x80, 0x8a, 0x4d, 0x29,
+    0xb9, 0x41, 0x80, 0xec, 0xcf, 0x66, 0x0c, 0x01, 0x1f, 0x41, 0xd4, 0x3b,
+    0x10, 0x01, 0x1c, 0xb0, 0x47, 0x07, 0x9a, 0xc1, 0x81, 0x4e, 0x44, 0x00,
+    0xf1, 0xc1, 0x81, 0x5a, 0xc4, 0x51, 0xb7, 0x01, 0x1e, 0x30, 0xc8, 0x01,
+    0x92, 0x01, 0x1e, 0x19, 0xc6, 0x02, 0xd1, 0x01, 0x1e, 0x00, 0xc4, 0x51,
+    0xb7, 0x01, 0x1e, 0x41, 0xc8, 0x01, 0x92, 0x01, 0x1e, 0x29, 0xc6, 0x02,
+    0xd1, 0x01, 0x1e, 0x10, 0xc4, 0x51, 0xb7, 0x01, 0x1e, 0x39, 0xc8, 0x01,
+    0x92, 0x01, 0x1e, 0x21, 0xc6, 0x02, 0xd1, 0x01, 0x1e, 0x08, 0x44, 0x84,
+    0x6c, 0x41, 0x81, 0x66, 0xca, 0xa6, 0xde, 0x0e, 0x98, 0x11, 0xcd, 0x7f,
+    0xce, 0x0e, 0x98, 0x08, 0xc2, 0x00, 0x74, 0x01, 0x34, 0x79, 0xc3, 0x01,
+    0x95, 0x01, 0x34, 0x60, 0xc3, 0x01, 0x95, 0x01, 0x34, 0x71, 0xc2, 0x00,
+    0x74, 0x01, 0x34, 0x68, 0x00, 0x41, 0x81, 0x72, 0x00, 0x41, 0x81, 0x7e,
+    0xc4, 0x18, 0x10, 0x00, 0x01, 0xbb, 0x01, 0x81, 0x8a, 0xc2, 0x22, 0xcc,
+    0x00, 0x01, 0xb2, 0x01, 0x81, 0x8e, 0xc3, 0x0d, 0x14, 0x00, 0x01, 0xab,
+    0x01, 0x81, 0x92, 0xc3, 0x09, 0x9e, 0x00, 0x01, 0xa2, 0x01, 0x81, 0x96,
+    0xc4, 0x02, 0xde, 0x00, 0x01, 0x9b, 0x01, 0x81, 0x9a, 0xc2, 0x02, 0xa0,
+    0x00, 0x01, 0x92, 0x01, 0x81, 0x9e, 0x00, 0x41, 0x81, 0xa2, 0x00, 0x41,
+    0x81, 0xae, 0x45, 0x09, 0x98, 0xc1, 0x81, 0xba, 0xcb, 0x97, 0xf5, 0x08,
+    0xca, 0x20, 0xc5, 0x33, 0x5d, 0x08, 0xca, 0x19, 0xc7, 0xc3, 0xa7, 0x08,
+    0xc9, 0xe9, 0xcb, 0x1e, 0x89, 0x08, 0xc9, 0xe1, 0xc8, 0x14, 0x38, 0x08,
+    0xc9, 0xd8, 0xc2, 0x00, 0x39, 0x08, 0xca, 0x11, 0xc2, 0x19, 0x2c, 0x08,
+    0xca, 0x00, 0xc5, 0x1e, 0x96, 0x08, 0xc9, 0xf1, 0x4a, 0x6f, 0xc8, 0x41,
+    0x81, 0xde, 0xc2, 0x02, 0x1c, 0x08, 0xc9, 0x79, 0x0e, 0xc1, 0x81, 0xf8,
+    0xc2, 0x00, 0xd0, 0x08, 0xc9, 0x69, 0x15, 0xc1, 0x82, 0x02, 0xc2, 0x02,
+    0x41, 0x08, 0xc9, 0x49, 0xc2, 0x00, 0x39, 0x08, 0xc9, 0x39, 0x1b, 0xc1,
+    0x82, 0x12, 0xc2, 0x01, 0xc3, 0x08, 0xc9, 0x21, 0x04, 0xc1, 0x82, 0x1c,
+    0x12, 0xc1, 0x82, 0x26, 0x10, 0xc1, 0x82, 0x30, 0x06, 0xc1, 0x82, 0x46,
+    0x16, 0xc1, 0x82, 0x54, 0xc2, 0x25, 0x3b, 0x08, 0xc8, 0x99, 0x05, 0xc1,
+    0x82, 0x64, 0x09, 0xc1, 0x82, 0x6e, 0x0d, 0xc1, 0x82, 0x78, 0x91, 0x08,
+    0xc8, 0x49, 0x87, 0x08, 0xc8, 0x31, 0x97, 0x08, 0xc8, 0x23, 0x01, 0x82,
+    0x82, 0x8b, 0x08, 0xc8, 0x13, 0x01, 0x82, 0x86, 0x83, 0x08, 0xc8, 0x02,
+    0x01, 0x82, 0x8a, 0xc5, 0x03, 0x4d, 0x01, 0x16, 0x39, 0x15, 0x41, 0x82,
+    0x8e, 0xca, 0xa3, 0x64, 0x01, 0x3c, 0x99, 0x46, 0x09, 0x97, 0x41, 0x82,
+    0x9a, 0xc4, 0x26, 0x78, 0x01, 0x3b, 0xf1, 0xc5, 0x06, 0xdb, 0x01, 0x3b,
+    0xe9, 0x15, 0xc1, 0x82, 0xbe, 0x08, 0xc1, 0x82, 0xca, 0x16, 0xc1, 0x82,
+    0xd6, 0xc3, 0x05, 0x14, 0x01, 0x3b, 0xb0, 0xc4, 0x26, 0x78, 0x01, 0x3c,
+    0x41, 0xc5, 0x06, 0xdb, 0x01, 0x3c, 0x39, 0x15, 0xc1, 0x82, 0xe2, 0x08,
+    0xc1, 0x82, 0xee, 0x16, 0xc1, 0x82, 0xfa, 0xc3, 0x05, 0x14, 0x01, 0x3c,
+    0x01, 0xc4, 0x15, 0xe7, 0x0f, 0x88, 0x58, 0xc4, 0x00, 0x87, 0x0f, 0xb0,
+    0xf1, 0xd1, 0x4f, 0x14, 0x0f, 0xb1, 0x28, 0xc8, 0x18, 0x67, 0x01, 0x16,
+    0x21, 0xd7, 0x26, 0x1b, 0x0f, 0xa5, 0x01, 0x45, 0x00, 0x8c, 0xc1, 0x83,
+    0x06, 0xc6, 0xcf, 0xad, 0x0f, 0xbc, 0xe0, 0xc4, 0x01, 0x23, 0x0f, 0xc8,
+    0x43, 0x01, 0x83, 0x1e, 0xcc, 0x84, 0xa5, 0x0f, 0xc8, 0x4a, 0x01, 0x83,
+    0x24, 0x16, 0xc1, 0x83, 0x2a, 0x15, 0xc1, 0x83, 0x36, 0x0a, 0xc1, 0x83,
+    0x42, 0x03, 0xc1, 0x83, 0x4e, 0xcf, 0x61, 0x4d, 0x01, 0x3f, 0x89, 0xcb,
+    0x01, 0xfc, 0x01, 0x0f, 0x4b, 0x01, 0x83, 0x5d, 0x06, 0xc1, 0x83, 0x63,
+    0xcd, 0x7c, 0xa8, 0x01, 0x0e, 0x51, 0xcc, 0x2e, 0x48, 0x01, 0x0d, 0x79,
+    0xc6, 0xca, 0xa3, 0x0f, 0xb3, 0x79, 0x46, 0x04, 0x8f, 0xc1, 0x83, 0x6f,
+    0xd1, 0x56, 0xd9, 0x0f, 0xc1, 0xb9, 0xd0, 0x58, 0x62, 0x0f, 0xc1, 0xf8,
+    0xd2, 0x4c, 0xfd, 0x01, 0x57, 0x88, 0xd0, 0x5d, 0x52, 0x01, 0x4f, 0x49,
+    0xcf, 0x66, 0x66, 0x01, 0x4f, 0x40, 0x43, 0xe5, 0x0c, 0xc1, 0x83, 0x7b,
+    0x43, 0xe5, 0xff, 0xc1, 0x83, 0x97, 0x43, 0xe5, 0xdb, 0xc1, 0x83, 0xb3,
+    0x43, 0xe6, 0x6e, 0xc1, 0x83, 0xcf, 0x43, 0xe6, 0x3b, 0xc1, 0x83, 0xeb,
+    0x43, 0xe5, 0xa8, 0xc1, 0x84, 0x07, 0x43, 0xe5, 0x45, 0x41, 0x84, 0x23,
+    0x43, 0xe5, 0xdb, 0xc1, 0x84, 0x3f, 0x43, 0xe5, 0xff, 0xc1, 0x84, 0x5b,
+    0x43, 0xe6, 0x6e, 0xc1, 0x84, 0x77, 0x43, 0xe6, 0x3b, 0xc1, 0x84, 0x93,
+    0x43, 0xe5, 0x0c, 0xc1, 0x84, 0xaf, 0x43, 0xe5, 0xa8, 0xc1, 0x84, 0xcb,
+    0x43, 0xe5, 0x45, 0x41, 0x84, 0xe7, 0x05, 0xc1, 0x85, 0x03, 0x49, 0x07,
+    0xbb, 0xc1, 0x85, 0x15, 0x17, 0xc1, 0x85, 0x24, 0x44, 0x06, 0xbb, 0xc1,
+    0x85, 0x30, 0x15, 0xc1, 0x85, 0x3c, 0xcd, 0x2c, 0xb2, 0x01, 0x02, 0x39,
+    0xd0, 0x0f, 0x09, 0x01, 0x01, 0xe1, 0x12, 0xc1, 0x85, 0x50, 0x06, 0xc1,
+    0x85, 0x5a, 0x0a, 0xc1, 0x85, 0x66, 0x0e, 0xc1, 0x85, 0x72, 0xdb, 0x16,
+    0x89, 0x01, 0x4c, 0xb1, 0x47, 0xc4, 0x17, 0xc1, 0x85, 0x7c, 0xcc, 0x83,
+    0x0d, 0x00, 0x16, 0xe9, 0xcd, 0x7d, 0x9f, 0x07, 0xf2, 0x61, 0xce, 0x70,
+    0x0a, 0x01, 0x70, 0xb8, 0xc9, 0x1b, 0xc7, 0x01, 0x35, 0x19, 0xcb, 0x21,
+    0x00, 0x01, 0x35, 0x11, 0xc6, 0x00, 0x91, 0x01, 0x5f, 0xe0, 0x47, 0x73,
+    0x59, 0xc1, 0x85, 0x8b, 0xce, 0x6e, 0xd6, 0x01, 0x4e, 0xf9, 0x45, 0x02,
+    0x6d, 0x41, 0x85, 0xa3, 0xc5, 0x02, 0xd2, 0x01, 0x2e, 0x61, 0xc4, 0x0d,
+    0x21, 0x01, 0x02, 0xe0, 0xc5, 0x0b, 0x0a, 0x01, 0x58, 0xd1, 0xc6, 0x27,
+    0x5e, 0x01, 0x72, 0x50, 0xc5, 0x33, 0x5d, 0x08, 0xc1, 0xd1, 0x42, 0x07,
+    0xb2, 0xc1, 0x85, 0xaf, 0xc8, 0x14, 0x38, 0x08, 0xc1, 0xb8, 0x03, 0xc1,
+    0x85, 0xbb, 0x91, 0x08, 0xc1, 0xa9, 0x87, 0x08, 0xc1, 0x99, 0xc9, 0xb2,
+    0x2d, 0x08, 0xc1, 0x8b, 0x01, 0x85, 0xc7, 0x97, 0x08, 0xc1, 0x7b, 0x01,
+    0x85, 0xcb, 0x8b, 0x08, 0xc1, 0x6a, 0x01, 0x85, 0xcf, 0x14, 0xc1, 0x85,
+    0xd3, 0xc2, 0x00, 0xd0, 0x08, 0xc1, 0x51, 0x15, 0xc1, 0x85, 0xdd, 0xc2,
+    0x02, 0x41, 0x08, 0xc1, 0x31, 0xc2, 0x00, 0xdb, 0x08, 0xc1, 0x29, 0xc2,
+    0x19, 0x2c, 0x08, 0xc1, 0x19, 0xc2, 0x01, 0xc3, 0x08, 0xc1, 0x11, 0x04,
+    0xc1, 0x85, 0xed, 0x12, 0xc1, 0x85, 0xf7, 0x10, 0xc1, 0x86, 0x01, 0x06,
+    0xc1, 0x86, 0x17, 0x16, 0xc1, 0x86, 0x25, 0x0c, 0xc1, 0x86, 0x33, 0x05,
+    0xc1, 0x86, 0x3d, 0x09, 0xc1, 0x86, 0x47, 0x0d, 0xc1, 0x86, 0x51, 0x83,
+    0x08, 0xc0, 0x03, 0x01, 0x86, 0x5b, 0x91, 0x08, 0xc0, 0x41, 0x87, 0x08,
+    0xc0, 0x31, 0x97, 0x08, 0xc0, 0x23, 0x01, 0x86, 0x67, 0x8b, 0x08, 0xc0,
+    0x12, 0x01, 0x86, 0x6b, 0xc9, 0x23, 0x9f, 0x01, 0x17, 0x68, 0xc9, 0x23,
+    0x9f, 0x01, 0x17, 0x00, 0xcc, 0x87, 0xbd, 0x0f, 0xad, 0xd0, 0x43, 0x02,
+    0x5f, 0xc1, 0x86, 0x6f, 0xd5, 0x32, 0x57, 0x0d, 0xe3, 0x80, 0xc8, 0x00,
+    0x5f, 0x0d, 0xe4, 0x43, 0x01, 0x86, 0x9e, 0xc4, 0x51, 0xb7, 0x0d, 0xe4,
+    0x39, 0x0e, 0xc1, 0x86, 0xa4, 0xc6, 0x02, 0xd1, 0x0d, 0xe4, 0x29, 0xc3,
+    0x02, 0xa3, 0x0d, 0xe4, 0x21, 0xc5, 0x1f, 0x0c, 0x0d, 0xe4, 0x11, 0xcb,
+    0x8f, 0x94, 0x0d, 0xe4, 0x09, 0xc5, 0x31, 0xee, 0x0d, 0xe4, 0x00, 0x42,
+    0x01, 0x6f, 0xc1, 0x86, 0xb0, 0xc6, 0xce, 0x8d, 0x0d, 0xe3, 0xd9, 0xc6,
+    0x99, 0xc8, 0x0d, 0xe3, 0xd1, 0xd4, 0x3c, 0xdc, 0x0d, 0xe3, 0xb9, 0xc6,
+    0x27, 0x9c, 0x0d, 0xe3, 0xb0, 0xcf, 0x61, 0x98, 0x0d, 0xe3, 0xa1, 0xd1,
+    0x27, 0x91, 0x0d, 0xe3, 0x88, 0xc2, 0x00, 0x2b, 0x0d, 0xe1, 0xd1, 0x8a,
+    0x0d, 0xe1, 0xc9, 0x91, 0x0d, 0xe2, 0xeb, 0x01, 0x86, 0xbf, 0xc2, 0x06,
+    0xdb, 0x0d, 0xe2, 0xf9, 0x8b, 0x0d, 0xe2, 0xf1, 0x83, 0x0d, 0xe2, 0xe0,
+    0x00, 0xc1, 0x86, 0xc3, 0x8a, 0x0d, 0xe0, 0x88, 0x00, 0xc1, 0x86, 0xcd,
+    0x45, 0xd9, 0x89, 0xc1, 0x86, 0xfe, 0xc6, 0xcf, 0x17, 0x0d, 0xe2, 0x48,
+    0x00, 0x41, 0x87, 0x1a, 0x00, 0xc1, 0x87, 0x38, 0x45, 0x44, 0xf8, 0x41,
+    0x87, 0x49, 0x00, 0x41, 0x87, 0x59, 0x8a, 0x0d, 0xe0, 0xc1, 0xc2, 0x00,
+    0x3f, 0x0d, 0xe0, 0x81, 0x48, 0xb5, 0xfa, 0x41, 0x87, 0x6a, 0x8a, 0x0d,
+    0xe0, 0xb9, 0x44, 0x08, 0x48, 0x41, 0x87, 0x72, 0x8e, 0x0d, 0xe0, 0xb0,
+    0x8d, 0x0d, 0xe0, 0xa1, 0x00, 0x41, 0x87, 0x7a, 0x8a, 0x0d, 0xe0, 0x99,
+    0xc2, 0x00, 0x3f, 0x0d, 0xe0, 0x68, 0xc2, 0x04, 0x4d, 0x0d, 0xe0, 0x70,
+    0xc2, 0x04, 0x4d, 0x0d, 0xe0, 0x61, 0x47, 0xc0, 0x35, 0x41, 0x87, 0x84,
+    0xc4, 0xe4, 0x37, 0x0d, 0xe1, 0xf0, 0xc8, 0xbb, 0x02, 0x0d, 0xe3, 0x50,
+    0x99, 0x0d, 0xe2, 0x98, 0x97, 0x0d, 0xe2, 0xd9, 0x99, 0x0d, 0xe2, 0xd1,
+    0xc2, 0x38, 0x2a, 0x0d, 0xe2, 0xc9, 0x83, 0x0d, 0xe2, 0x18, 0x8a, 0x0d,
+    0xe2, 0xb9, 0xc2, 0x04, 0x4d, 0x0d, 0xe2, 0xa1, 0x8b, 0x0d, 0xe2, 0x50,
+    0x97, 0x0d, 0xe2, 0x91, 0x87, 0x0d, 0xe2, 0x58, 0x87, 0x0d, 0xe2, 0x40,
+    0xc2, 0x00, 0x59, 0x0d, 0xe2, 0x28, 0xca, 0xa2, 0xc4, 0x01, 0x71, 0xb1,
+    0xcb, 0x98, 0x9a, 0x01, 0x71, 0xb8, 0xc5, 0x06, 0x82, 0x00, 0x04, 0x69,
+    0x42, 0x01, 0x0f, 0xc1, 0x87, 0x8c, 0xc7, 0x27, 0x5d, 0x00, 0x02, 0xe3,
+    0x01, 0x87, 0x98, 0xcd, 0x7b, 0x15, 0x0f, 0xb3, 0xf9, 0x55, 0x33, 0x92,
+    0x41, 0x87, 0x9c, 0x14, 0xc1, 0x87, 0xa8, 0xc8, 0x68, 0xc5, 0x01, 0x18,
+    0x81, 0x16, 0xc1, 0x87, 0xba, 0x15, 0xc1, 0x87, 0xcf, 0x12, 0xc1, 0x87,
+    0xdb, 0x47, 0x00, 0x58, 0xc1, 0x87, 0xe7, 0xe0, 0x09, 0x27, 0x0f, 0xac,
+    0xa9, 0xcc, 0x89, 0x79, 0x0f, 0xac, 0xa1, 0xc9, 0xb2, 0xf3, 0x01, 0x4d,
+    0x81, 0xc5, 0x01, 0x95, 0x01, 0x4d, 0x1b, 0x01, 0x87, 0xf6, 0xd2, 0x4a,
+    0x3f, 0x01, 0x70, 0x89, 0xcd, 0x2c, 0xb2, 0x01, 0x71, 0x71, 0xc5, 0x0a,
+    0x8a, 0x01, 0x72, 0x08, 0x9f, 0x01, 0x37, 0x09, 0x9e, 0x01, 0x37, 0x00,
+    0xd1, 0x53, 0x54, 0x01, 0x33, 0xd1, 0x45, 0x1a, 0xad, 0x41, 0x87, 0xfc,
+    0x87, 0x05, 0x4a, 0x4b, 0x01, 0x88, 0x26, 0x03, 0xc1, 0x88, 0x2e, 0x91,
+    0x05, 0x4a, 0x59, 0x97, 0x05, 0x4a, 0x41, 0x8b, 0x05, 0x4a, 0x38, 0x89,
+    0x05, 0x4a, 0x78, 0x1b, 0xc1, 0x88, 0x36, 0xc2, 0x0e, 0x9a, 0x05, 0x4a,
+    0x21, 0x09, 0xc1, 0x88, 0x40, 0x83, 0x05, 0x49, 0xa8, 0xc2, 0x01, 0x5d,
+    0x05, 0x4a, 0x11, 0x83, 0x05, 0x49, 0xc0, 0x07, 0xc1, 0x88, 0x4a, 0xd5,
+    0x32, 0x18, 0x01, 0x3e, 0x31, 0xcd, 0x25, 0xae, 0x00, 0x02, 0xeb, 0x01,
+    0x88, 0x56, 0x0b, 0xc1, 0x88, 0x5a, 0x42, 0x00, 0x67, 0xc1, 0x88, 0x66,
+    0xd3, 0x1f, 0xcd, 0x01, 0x70, 0x18, 0x10, 0xc1, 0x88, 0x75, 0x14, 0x41,
+    0x88, 0x7f, 0xc9, 0x9b, 0x77, 0x01, 0x3e, 0xb1, 0x43, 0x02, 0x6f, 0xc1,
+    0x88, 0x8b, 0xcf, 0x63, 0x5a, 0x0f, 0xdd, 0xe0, 0x43, 0x01, 0xd0, 0xc1,
+    0x88, 0x97, 0xd5, 0x36, 0xb0, 0x0f, 0xab, 0xe8, 0xc7, 0xc9, 0xb2, 0x01,
+    0x1d, 0xc9, 0xcd, 0x77, 0xfc, 0x01, 0x71, 0x08, 0xcc, 0x00, 0x33, 0x00,
+    0x03, 0xeb, 0x01, 0x88, 0xaf, 0xc6, 0xb7, 0x3b, 0x01, 0x18, 0x49, 0xcd,
+    0x69, 0x65, 0x01, 0x80, 0x68, 0x00, 0x41, 0x88, 0xb3, 0xc4, 0x20, 0xe6,
+    0x01, 0x18, 0x59, 0x0b, 0x41, 0x88, 0xc5, 0x14, 0xc1, 0x88, 0xd1, 0xc3,
+    0x00, 0x3a, 0x01, 0x15, 0x11, 0x0a, 0xc1, 0x88, 0xdd, 0xd5, 0x08, 0x89,
+    0x01, 0x80, 0xa8, 0x45, 0x00, 0x5a, 0xc1, 0x88, 0xef, 0xd9, 0x1f, 0xc7,
+    0x01, 0x70, 0x28, 0xcb, 0x8a, 0x0a, 0x01, 0x4e, 0xc9, 0x45, 0x01, 0xfd,
+    0x41, 0x89, 0x05, 0xd6, 0x08, 0x88, 0x01, 0x4c, 0xc1, 0xd2, 0x21, 0x89,
+    0x01, 0x80, 0x88, 0xca, 0x01, 0xfd, 0x01, 0x0f, 0x43, 0x01, 0x89, 0x21,
+    0xc9, 0xb0, 0x6b, 0x01, 0x0c, 0xe8, 0x42, 0x00, 0x2c, 0xc1, 0x89, 0x25,
+    0x42, 0x02, 0xa0, 0xc1, 0x89, 0x31, 0xd5, 0x37, 0xc1, 0x0f, 0xc5, 0x18,
+    0xcf, 0x5b, 0xc3, 0x0f, 0xc2, 0x91, 0x42, 0x00, 0xe3, 0x41, 0x89, 0x3d,
+    0x45, 0x11, 0x3a, 0xc1, 0x89, 0x49, 0x03, 0x41, 0x89, 0x55, 0x00, 0xc1,
+    0x89, 0x61, 0xc5, 0x14, 0xa5, 0x01, 0x48, 0xd0, 0xcb, 0x82, 0xba, 0x01,
+    0x0f, 0x11, 0x46, 0x00, 0x59, 0x41, 0x89, 0x7e, 0xc5, 0xca, 0xa4, 0x0f,
+    0xb3, 0x71, 0xd7, 0x2a, 0x6b, 0x0f, 0xc5, 0x28, 0x45, 0x04, 0x90, 0xc1,
+    0x89, 0x8d, 0xd8, 0x23, 0xdb, 0x0f, 0xc5, 0x09, 0xdf, 0x0c, 0x65, 0x0f,
+    0xc5, 0x48, 0xd0, 0x56, 0xda, 0x0f, 0xc1, 0xb1, 0xe0, 0x01, 0xe7, 0x0f,
+    0xc5, 0x58, 0xd0, 0x5a, 0x22, 0x0f, 0xa8, 0x71, 0xcd, 0x0b, 0x91, 0x01,
+    0x19, 0x51, 0xd4, 0x3b, 0x9c, 0x01, 0x4f, 0xe9, 0xdb, 0x18, 0x39, 0x00,
+    0x05, 0xd8, 0xdc, 0x14, 0x4d, 0x01, 0x3d, 0x49, 0xd7, 0x29, 0xe1, 0x01,
+    0x49, 0xc0, 0xc7, 0x00, 0xfa, 0x01, 0x03, 0x39, 0xc8, 0xb6, 0xca, 0x01,
+    0x01, 0x71, 0xc9, 0xb3, 0x9e, 0x01, 0x01, 0x59, 0xc4, 0x01, 0xc3, 0x01,
+    0x00, 0x78, 0xd6, 0x2d, 0x4c, 0x00, 0x2c, 0x69, 0xc4, 0xb9, 0x3c, 0x0f,
+    0xc8, 0xe1, 0xcb, 0x8f, 0xf7, 0x00, 0x7e, 0xaa, 0x01, 0x89, 0x99, 0xc4,
+    0x00, 0x49, 0x01, 0x5d, 0x81, 0xc5, 0x00, 0x2c, 0x01, 0x5d, 0x88, 0xc4,
+    0x00, 0x49, 0x01, 0x5d, 0x91, 0xc5, 0x00, 0x2c, 0x01, 0x5d, 0x98, 0xc2,
+    0x02, 0xae, 0x01, 0x5d, 0xa1, 0xc4, 0x03, 0xc8, 0x01, 0x5d, 0xb0, 0xc2,
+    0x02, 0xae, 0x01, 0x5d, 0xa9, 0xc4, 0x03, 0xc8, 0x01, 0x5d, 0xb8, 0xc7,
+    0xc9, 0x42, 0x0f, 0x9d, 0x11, 0xc5, 0xdb, 0x41, 0x0f, 0xb7, 0xe0, 0xc6,
+    0xd0, 0x2b, 0x0f, 0x93, 0x21, 0xc2, 0x00, 0x59, 0x0f, 0x93, 0x10, 0x00,
+    0x41, 0x89, 0x9f, 0x0b, 0xc1, 0x89, 0xb1, 0xc3, 0x09, 0x9e, 0x01, 0x0b,
+    0x18, 0xc2, 0x22, 0xcc, 0x01, 0x0b, 0x2b, 0x01, 0x89, 0xc3, 0xc4, 0x18,
+    0x10, 0x01, 0x0b, 0x30, 0xc2, 0x00, 0xc4, 0x01, 0x0b, 0x4b, 0x01, 0x89,
+    0xc9, 0x19, 0xc1, 0x89, 0xcf, 0xc4, 0x02, 0xde, 0x01, 0x0b, 0x10, 0xc5,
+    0x66, 0xb1, 0x01, 0x0b, 0x51, 0xc4, 0x00, 0x2d, 0x01, 0x0b, 0x38, 0x42,
+    0x09, 0x40, 0xc1, 0x89, 0xd9, 0xcb, 0x9a, 0x05, 0x08, 0x0c, 0x91, 0xcd,
+    0x7a, 0xd4, 0x08, 0x0c, 0xc0, 0x46, 0x00, 0x8b, 0x41, 0x89, 0xe5, 0xc6,
+    0x02, 0xe9, 0x0f, 0x8b, 0x61, 0xc6, 0x42, 0xd4, 0x0f, 0x8b, 0x59, 0xc6,
+    0x5c, 0x5b, 0x0f, 0x8b, 0x50, 0xd8, 0x21, 0x3b, 0x01, 0x70, 0x38, 0xc5,
+    0x06, 0x67, 0x08, 0x73, 0xe9, 0xc7, 0x08, 0x79, 0x08, 0x73, 0xe1, 0xc4,
+    0x01, 0xce, 0x08, 0x73, 0xd8, 0xc8, 0x0d, 0x03, 0x08, 0x73, 0xd1, 0xc2,
+    0x0d, 0x10, 0x08, 0x73, 0x88, 0xc8, 0x0d, 0x03, 0x08, 0x73, 0xc9, 0x9b,
+    0x08, 0x73, 0x80, 0x44, 0x18, 0x10, 0xc1, 0x89, 0xf1, 0x42, 0x22, 0xcc,
+    0x41, 0x89, 0xfd, 0x0b, 0xc1, 0x8a, 0x09, 0x11, 0x41, 0x8a, 0x15, 0x0a,
+    0xc1, 0x8a, 0x21, 0x19, 0xc1, 0x8a, 0x2d, 0xc2, 0x00, 0xc4, 0x08, 0x73,
+    0x48, 0xc4, 0x18, 0x10, 0x08, 0x73, 0x31, 0xc2, 0x22, 0xcc, 0x08, 0x73,
+    0x28, 0xc3, 0x0d, 0x14, 0x08, 0x73, 0x21, 0xc3, 0x09, 0x9e, 0x08, 0x73,
+    0x18, 0xc4, 0x02, 0xde, 0x08, 0x73, 0x11, 0xc2, 0x02, 0xa0, 0x08, 0x73,
+    0x08, 0x08, 0xc1, 0x8a, 0x39, 0x91, 0x00, 0xb5, 0x73, 0x01, 0x8a, 0x45,
+    0x15, 0xc1, 0x8a, 0x63, 0x8d, 0x00, 0xb7, 0x8b, 0x01, 0x8a, 0x7c, 0x9a,
+    0x00, 0xb7, 0x51, 0x93, 0x00, 0xb7, 0x49, 0x0b, 0xc1, 0x8a, 0x82, 0x0e,
+    0xc1, 0x8a, 0xa3, 0x85, 0x00, 0xb6, 0x6b, 0x01, 0x8a, 0xaf, 0x87, 0x00,
+    0xb6, 0x13, 0x01, 0x8a, 0xbf, 0x86, 0x00, 0xb6, 0x8b, 0x01, 0x8a, 0xd7,
+    0xcc, 0x84, 0xe1, 0x00, 0xb6, 0xb9, 0xd8, 0x25, 0x2b, 0x00, 0xb6, 0x91,
+    0x16, 0xc1, 0x8a, 0xe3, 0x9c, 0x00, 0xb6, 0x71, 0x03, 0xc1, 0x8a, 0xef,
+    0xcf, 0x60, 0xe4, 0x00, 0xb6, 0x41, 0x89, 0x00, 0xb5, 0xab, 0x01, 0x8b,
+    0x07, 0xc7, 0xc7, 0xf2, 0x00, 0xb6, 0x19, 0xd1, 0x57, 0x0c, 0x00, 0xb5,
+    0xf1, 0x42, 0x00, 0xd0, 0xc1, 0x8b, 0x11, 0x99, 0x00, 0xb5, 0x2b, 0x01,
+    0x8b, 0x1d, 0xd0, 0x5d, 0x82, 0x00, 0xb5, 0x89, 0x9b, 0x00, 0xb5, 0x23,
+    0x01, 0x8b, 0x23, 0xc9, 0xb4, 0x88, 0x00, 0xb5, 0x11, 0x98, 0x00, 0xb5,
+    0x08, 0xa1, 0x70, 0x0c, 0x49, 0xa0, 0x70, 0x0c, 0x41, 0xa6, 0x70, 0x0c,
+    0x71, 0xa5, 0x70, 0x0c, 0x69, 0xa4, 0x70, 0x0c, 0x61, 0xa3, 0x70, 0x0c,
+    0x59, 0xa2, 0x70, 0x0c, 0x51, 0x9f, 0x70, 0x0c, 0x39, 0x9e, 0x70, 0x0c,
+    0x31, 0x9d, 0x70, 0x0c, 0x28, 0xa0, 0x70, 0x0b, 0x01, 0x9f, 0x70, 0x0a,
+    0xf9, 0x9e, 0x70, 0x0a, 0xf1, 0x9d, 0x70, 0x0a, 0xe9, 0xa6, 0x70, 0x0b,
+    0x31, 0xa5, 0x70, 0x0b, 0x29, 0xa4, 0x70, 0x0b, 0x21, 0xa3, 0x70, 0x0b,
+    0x19, 0xa2, 0x70, 0x0b, 0x11, 0xa1, 0x70, 0x0b, 0x08, 0xa6, 0x70, 0x0a,
+    0xe1, 0xa5, 0x70, 0x0a, 0xd9, 0xa4, 0x70, 0x0a, 0xd1, 0xa3, 0x70, 0x0a,
+    0xc9, 0xa2, 0x70, 0x0a, 0xc1, 0xa1, 0x70, 0x0a, 0xb9, 0xa0, 0x70, 0x0a,
+    0xb1, 0x9f, 0x70, 0x0a, 0xa9, 0x9e, 0x70, 0x0a, 0xa1, 0x9d, 0x70, 0x0a,
+    0x98, 0xa6, 0x70, 0x0d, 0xb1, 0xa5, 0x70, 0x0d, 0xa9, 0xa4, 0x70, 0x0d,
+    0xa1, 0xa3, 0x70, 0x0d, 0x99, 0xa2, 0x70, 0x0d, 0x91, 0xa1, 0x70, 0x0d,
+    0x89, 0xa0, 0x70, 0x0d, 0x81, 0x9f, 0x70, 0x0d, 0x79, 0x9e, 0x70, 0x0d,
+    0x71, 0x9d, 0x70, 0x0d, 0x68, 0xa6, 0x70, 0x0d, 0x61, 0xa5, 0x70, 0x0d,
+    0x59, 0xa4, 0x70, 0x0d, 0x51, 0xa3, 0x70, 0x0d, 0x49, 0xa2, 0x70, 0x0d,
+    0x41, 0xa1, 0x70, 0x0d, 0x39, 0xa0, 0x70, 0x0d, 0x31, 0x9f, 0x70, 0x0d,
+    0x29, 0x9e, 0x70, 0x0d, 0x21, 0x9d, 0x70, 0x0d, 0x18, 0xa6, 0x70, 0x0d,
+    0x11, 0xa5, 0x70, 0x0d, 0x09, 0xa4, 0x70, 0x0d, 0x01, 0xa3, 0x70, 0x0c,
+    0xf9, 0xa2, 0x70, 0x0c, 0xf1, 0xa1, 0x70, 0x0c, 0xe9, 0xa0, 0x70, 0x0c,
+    0xe1, 0x9f, 0x70, 0x0c, 0xd9, 0x9e, 0x70, 0x0c, 0xd1, 0x9d, 0x70, 0x0c,
+    0xc8, 0xa6, 0x70, 0x0c, 0xc1, 0xa5, 0x70, 0x0c, 0xb9, 0xa4, 0x70, 0x0c,
+    0xb1, 0xa3, 0x70, 0x0c, 0xa9, 0xa2, 0x70, 0x0c, 0xa1, 0xa1, 0x70, 0x0c,
+    0x99, 0xa0, 0x70, 0x0c, 0x91, 0x9f, 0x70, 0x0c, 0x89, 0x9e, 0x70, 0x0c,
+    0x81, 0x9d, 0x70, 0x0c, 0x78, 0xa6, 0x70, 0x0c, 0x21, 0xa5, 0x70, 0x0c,
+    0x19, 0xa4, 0x70, 0x0c, 0x11, 0xa3, 0x70, 0x0c, 0x09, 0xa2, 0x70, 0x0c,
+    0x01, 0xa1, 0x70, 0x0b, 0xf9, 0xa0, 0x70, 0x0b, 0xf1, 0x9f, 0x70, 0x0b,
+    0xe9, 0x9e, 0x70, 0x0b, 0xe1, 0x9d, 0x70, 0x0b, 0xd8, 0xa6, 0x70, 0x0b,
+    0xd1, 0xa5, 0x70, 0x0b, 0xc9, 0xa4, 0x70, 0x0b, 0xc1, 0xa3, 0x70, 0x0b,
+    0xb9, 0xa2, 0x70, 0x0b, 0xb1, 0xa1, 0x70, 0x0b, 0xa9, 0xa0, 0x70, 0x0b,
+    0xa1, 0x9f, 0x70, 0x0b, 0x99, 0x9e, 0x70, 0x0b, 0x91, 0x9d, 0x70, 0x0b,
+    0x88, 0xa6, 0x70, 0x0b, 0x81, 0xa5, 0x70, 0x0b, 0x79, 0xa4, 0x70, 0x0b,
+    0x71, 0xa3, 0x70, 0x0b, 0x69, 0xa2, 0x70, 0x0b, 0x61, 0xa1, 0x70, 0x0b,
+    0x59, 0xa0, 0x70, 0x0b, 0x51, 0x9f, 0x70, 0x0b, 0x49, 0x9e, 0x70, 0x0b,
+    0x41, 0x9d, 0x70, 0x0b, 0x38, 0xa3, 0x70, 0x0f, 0x79, 0xa2, 0x70, 0x0f,
+    0x71, 0xa1, 0x70, 0x0f, 0x69, 0xa0, 0x70, 0x0f, 0x61, 0x9f, 0x70, 0x0f,
+    0x59, 0x9e, 0x70, 0x0f, 0x51, 0x9d, 0x70, 0x0f, 0x48, 0xa6, 0x70, 0x0f,
+    0x41, 0xa5, 0x70, 0x0f, 0x39, 0xa4, 0x70, 0x0f, 0x31, 0xa3, 0x70, 0x0f,
+    0x29, 0xa2, 0x70, 0x0f, 0x21, 0xa1, 0x70, 0x0f, 0x19, 0xa0, 0x70, 0x0f,
+    0x11, 0x9f, 0x70, 0x0f, 0x09, 0x9e, 0x70, 0x0f, 0x01, 0x9d, 0x70, 0x0e,
+    0xf8, 0xa6, 0x70, 0x0e, 0xf1, 0xa5, 0x70, 0x0e, 0xe9, 0xa4, 0x70, 0x0e,
+    0xe1, 0xa3, 0x70, 0x0e, 0xd9, 0xa2, 0x70, 0x0e, 0xd1, 0xa1, 0x70, 0x0e,
+    0xc9, 0xa0, 0x70, 0x0e, 0xc1, 0x9f, 0x70, 0x0e, 0xb9, 0x9e, 0x70, 0x0e,
+    0xb1, 0x9d, 0x70, 0x0e, 0xa8, 0xa6, 0x70, 0x0e, 0xa1, 0xa5, 0x70, 0x0e,
+    0x99, 0xa4, 0x70, 0x0e, 0x91, 0xa3, 0x70, 0x0e, 0x89, 0xa2, 0x70, 0x0e,
+    0x81, 0xa1, 0x70, 0x0e, 0x79, 0xa0, 0x70, 0x0e, 0x71, 0x9f, 0x70, 0x0e,
+    0x69, 0x9e, 0x70, 0x0e, 0x61, 0x9d, 0x70, 0x0e, 0x58, 0xa6, 0x70, 0x0e,
+    0x51, 0xa5, 0x70, 0x0e, 0x49, 0xa4, 0x70, 0x0e, 0x41, 0xa3, 0x70, 0x0e,
+    0x39, 0xa2, 0x70, 0x0e, 0x31, 0xa1, 0x70, 0x0e, 0x29, 0xa0, 0x70, 0x0e,
+    0x21, 0x9f, 0x70, 0x0e, 0x19, 0x9e, 0x70, 0x0e, 0x11, 0x9d, 0x70, 0x0e,
+    0x08, 0xa6, 0x70, 0x0e, 0x01, 0xa5, 0x70, 0x0d, 0xf9, 0xa4, 0x70, 0x0d,
+    0xf1, 0xa3, 0x70, 0x0d, 0xe9, 0xa2, 0x70, 0x0d, 0xe1, 0xa1, 0x70, 0x0d,
+    0xd9, 0xa0, 0x70, 0x0d, 0xd1, 0x9f, 0x70, 0x0d, 0xc9, 0x9e, 0x70, 0x0d,
+    0xc1, 0x9d, 0x70, 0x0d, 0xb8, 0x87, 0x05, 0x2f, 0x0b, 0x01, 0x8b, 0x27,
+    0x0a, 0xc1, 0x8b, 0x32, 0x19, 0xc1, 0x8b, 0x55, 0x12, 0xc1, 0x8b, 0x78,
+    0x04, 0xc1, 0x8b, 0x92, 0x0f, 0xc1, 0x8b, 0xb0, 0x0d, 0xc1, 0x8b, 0xd4,
+    0x09, 0xc1, 0x8b, 0xf5, 0x08, 0xc1, 0x8c, 0x13, 0x18, 0xc1, 0x8c, 0x2d,
+    0x16, 0xc1, 0x8c, 0x47, 0x06, 0xc1, 0x8c, 0x65, 0x0e, 0xc1, 0x8c, 0x83,
+    0x14, 0xc1, 0x8c, 0x9d, 0x10, 0xc1, 0x8c, 0xb7, 0x15, 0xc1, 0x8c, 0xe4,
+    0x1c, 0xc1, 0x8d, 0x02, 0x05, 0xc1, 0x8d, 0x20, 0x0c, 0xc1, 0x8d, 0x3a,
+    0x1b, 0xc1, 0x8d, 0x54, 0x8b, 0x05, 0x29, 0x23, 0x01, 0x8d, 0x6e, 0x83,
+    0x05, 0x2a, 0x4b, 0x01, 0x8d, 0x72, 0x91, 0x05, 0x2d, 0xd3, 0x01, 0x8d,
+    0x76, 0x97, 0x05, 0x2c, 0xaa, 0x01, 0x8d, 0x81, 0x08, 0xc1, 0x8d, 0x85,
+    0x0d, 0xc1, 0x8d, 0x91, 0x16, 0xc1, 0x8d, 0x9d, 0xc3, 0xe6, 0x5f, 0x05,
+    0x30, 0xb1, 0xc4, 0x10, 0xd0, 0x05, 0x30, 0xb9, 0x06, 0xc1, 0x8d, 0xaf,
+    0xc4, 0x9d, 0xd8, 0x05, 0x30, 0xf8, 0xc2, 0x02, 0xa0, 0x05, 0x31, 0x11,
+    0xc4, 0x02, 0xde, 0x05, 0x31, 0x18, 0xc3, 0x09, 0x9e, 0x05, 0x31, 0x21,
+    0xc3, 0x0d, 0x14, 0x05, 0x31, 0x28, 0xc2, 0x22, 0xcc, 0x05, 0x31, 0x31,
+    0xc4, 0x18, 0x10, 0x05, 0x31, 0x38, 0x9f, 0x0f, 0xdb, 0x81, 0xa0, 0x0f,
+    0xdb, 0x89, 0xa1, 0x0f, 0xdb, 0x91, 0xa2, 0x0f, 0xdb, 0x99, 0xa3, 0x0f,
+    0xdb, 0xa1, 0xa4, 0x0f, 0xdb, 0xa8, 0xd6, 0x30, 0x7a, 0x01, 0x3e, 0x51,
+    0xd5, 0x38, 0x00, 0x01, 0x4e, 0x81, 0xd6, 0x30, 0x38, 0x01, 0x57, 0x11,
+    0xd5, 0x34, 0xcd, 0x01, 0x57, 0x20, 0x00, 0x41, 0x8d, 0xb9, 0x42, 0x00,
+    0x03, 0xc1, 0x8d, 0xc5, 0xcc, 0x89, 0x55, 0x0f, 0xb5, 0x31, 0xc4, 0x1e,
+    0xc9, 0x01, 0x71, 0x78, 0xc4, 0x01, 0xc3, 0x01, 0x81, 0x8b, 0x01, 0x8d,
+    0xd4, 0xd6, 0x31, 0x2a, 0x01, 0x81, 0x92, 0x01, 0x8d, 0xd8, 0x46, 0x0f,
+    0x88, 0xc1, 0x8d, 0xde, 0xcb, 0x58, 0xc7, 0x0f, 0xbd, 0x31, 0x46, 0x01,
+    0xfc, 0xc1, 0x8d, 0xea, 0xcf, 0x61, 0xd4, 0x0f, 0xb3, 0xe9, 0x15, 0xc1,
+    0x8d, 0xf6, 0xd4, 0x3c, 0xb4, 0x0f, 0xbd, 0x98, 0xcc, 0x07, 0xc7, 0x01,
+    0x16, 0xc9, 0xc9, 0x00, 0xca, 0x01, 0x16, 0xc0, 0xc7, 0xc2, 0xb2, 0x00,
+    0xe7, 0xb9, 0xcb, 0x40, 0xe1, 0x00, 0xe7, 0x91, 0x48, 0x14, 0x39, 0x41,
+    0x8e, 0x08, 0xd3, 0x40, 0xd9, 0x00, 0xe7, 0x99, 0xd3, 0x3f, 0xa9, 0x00,
+    0xe7, 0x81, 0x50, 0x5f, 0x62, 0x41, 0x8e, 0x23, 0xc8, 0x74, 0xc4, 0x00,
+    0xe7, 0x2b, 0x01, 0x8e, 0x2f, 0xc6, 0x74, 0xc6, 0x00, 0xe7, 0x1b, 0x01,
+    0x8e, 0x35, 0xc7, 0x02, 0x40, 0x00, 0xe7, 0x10, 0x45, 0x00, 0x5a, 0xc1,
+    0x8e, 0x3b, 0xc7, 0x0e, 0x70, 0x00, 0xe6, 0xe8, 0xc8, 0x9e, 0xe8, 0x00,
+    0xe7, 0xc1, 0x43, 0x61, 0x97, 0x41, 0x8e, 0x47, 0xc5, 0x00, 0xd4, 0x00,
+    0xe7, 0xa1, 0xc5, 0x05, 0x02, 0x00, 0xe6, 0xc0, 0xcf, 0x67, 0xce, 0x00,
+    0xe6, 0xf9, 0xcd, 0x04, 0xfa, 0x00, 0xe6, 0xf1, 0xcd, 0x7d, 0x78, 0x00,
+    0xe6, 0xd8, 0xce, 0x74, 0xbe, 0x00, 0xe6, 0xe1, 0xc6, 0xcd, 0xa9, 0x00,
+    0xe6, 0x80, 0xdb, 0x17, 0xe8, 0x00, 0xe6, 0xbb, 0x01, 0x8e, 0x4d, 0xd3,
+    0x02, 0x34, 0x00, 0xe6, 0xb1, 0xde, 0x0f, 0xf4, 0x00, 0xe6, 0xa8, 0xc2,
+    0x00, 0x51, 0x08, 0x2b, 0x89, 0x87, 0x08, 0x2b, 0x90, 0x87, 0x08, 0x2b,
+    0x99, 0xc2, 0x01, 0x7f, 0x08, 0x2b, 0xa0, 0x87, 0x08, 0x2b, 0xa9, 0xc2,
+    0x01, 0x7f, 0x08, 0x2b, 0xb0, 0x8b, 0x08, 0x2b, 0xb8, 0xc2, 0x00, 0xd0,
+    0x08, 0x2b, 0xe9, 0x83, 0x08, 0x2b, 0xe0, 0xc2, 0x1c, 0x52, 0x08, 0x2b,
+    0xf8, 0xc2, 0x00, 0xdb, 0x08, 0x2c, 0x19, 0x83, 0x08, 0x2c, 0x10, 0x87,
+    0x08, 0x2c, 0x29, 0xc2, 0x1c, 0x52, 0x08, 0x2c, 0x30, 0xc2, 0x01, 0x7f,
+    0x08, 0x2c, 0x69, 0x87, 0x08, 0x2c, 0x60, 0x87, 0x08, 0x2c, 0x71, 0xc2,
+    0x01, 0x7f, 0x08, 0x2c, 0x78, 0xc2, 0x00, 0x51, 0x08, 0x2c, 0xc1, 0x87,
+    0x08, 0x2c, 0xc8, 0x87, 0x08, 0x2c, 0xd1, 0xc2, 0x01, 0x7f, 0x08, 0x2c,
+    0xd8, 0x87, 0x08, 0x2c, 0xe1, 0xc2, 0x01, 0x7f, 0x08, 0x2c, 0xe8, 0x8b,
+    0x08, 0x2c, 0xf0, 0x83, 0x08, 0x2d, 0x19, 0xc2, 0x00, 0xd0, 0x08, 0x2d,
+    0x20, 0xc2, 0x1c, 0x52, 0x08, 0x2d, 0x30, 0x83, 0x08, 0x2d, 0x49, 0xc2,
+    0x00, 0xdb, 0x08, 0x2d, 0x50, 0x87, 0x08, 0x2d, 0x61, 0xc2, 0x1c, 0x52,
+    0x08, 0x2d, 0x68, 0x87, 0x08, 0x2d, 0x99, 0xc2, 0x01, 0x7f, 0x08, 0x2d,
+    0xa0, 0x87, 0x08, 0x2d, 0xa9, 0xc2, 0x01, 0x7f, 0x08, 0x2d, 0xb0, 0xc7,
+    0x3f, 0xe8, 0x01, 0x0a, 0xe9, 0xc6, 0xd3, 0x5b, 0x01, 0x0a, 0xd0, 0xc7,
+    0x3f, 0xe8, 0x01, 0x0a, 0xe1, 0xc6, 0x9c, 0x06, 0x01, 0x0a, 0xb9, 0xc8,
+    0x08, 0x79, 0x00, 0x05, 0xf0, 0xc6, 0x9c, 0x06, 0x01, 0x0a, 0xb1, 0xc6,
+    0x8d, 0x4d, 0x01, 0x0a, 0xa0, 0xc4, 0x9d, 0x74, 0x01, 0x0a, 0xc9, 0xc6,
+    0xcf, 0x29, 0x01, 0x0a, 0x80, 0xc4, 0x06, 0x68, 0x01, 0x0a, 0x99, 0xc4,
+    0x0f, 0x1f, 0x01, 0x0a, 0x90, 0xca, 0x1f, 0x0e, 0x70, 0x03, 0x01, 0xcf,
+    0x54, 0xbb, 0x70, 0x01, 0xf0, 0xc7, 0x80, 0x2f, 0x70, 0x02, 0xf9, 0x07,
+    0xc1, 0x8e, 0x53, 0x45, 0x0b, 0x12, 0x41, 0x8e, 0x5f, 0xd0, 0x08, 0xf7,
+    0x70, 0x02, 0xf1, 0x11, 0x41, 0x8e, 0x6b, 0x45, 0x00, 0x2d, 0xc1, 0x8e,
+    0x77, 0xce, 0x61, 0xd5, 0x70, 0x02, 0xe0, 0xcb, 0x2c, 0xb4, 0x70, 0x01,
+    0xf9, 0xcc, 0x01, 0xbb, 0x70, 0x01, 0x10, 0xca, 0x0e, 0xbe, 0x70, 0x01,
+    0xe9, 0xcf, 0x0f, 0x0a, 0x70, 0x01, 0x08, 0xc8, 0x52, 0x00, 0x70, 0x01,
+    0xd9, 0xc6, 0x27, 0x5e, 0x70, 0x01, 0x79, 0xc4, 0x40, 0x89, 0x70, 0x01,
+    0x00, 0x45, 0x09, 0x98, 0xc1, 0x8e, 0x89, 0xca, 0x99, 0x61, 0x70, 0x01,
+    0x20, 0xc8, 0x60, 0xf4, 0x70, 0x01, 0x59, 0xcb, 0x8e, 0x13, 0x70, 0x01,
+    0x28, 0xc7, 0x0b, 0x00, 0x70, 0x01, 0x51, 0xc9, 0x2d, 0x85, 0x70, 0x01,
+    0x39, 0xc8, 0x36, 0x21, 0x70, 0x01, 0x30, 0x97, 0x00, 0xbb, 0x99, 0x8b,
+    0x00, 0xbb, 0x90, 0xc2, 0x0d, 0xf6, 0x00, 0xbb, 0x81, 0xc2, 0x01, 0x4a,
+    0x00, 0xbb, 0x79, 0xc2, 0x00, 0xdb, 0x00, 0xbb, 0x71, 0xc2, 0x19, 0x2c,
+    0x00, 0xbb, 0x61, 0xc2, 0x01, 0xc3, 0x00, 0xbb, 0x59, 0xc2, 0x01, 0x5d,
+    0x00, 0xbb, 0x51, 0xc2, 0x00, 0xb0, 0x00, 0xbb, 0x49, 0x10, 0xc1, 0x8e,
+    0xad, 0xc2, 0x0e, 0x9a, 0x00, 0xbb, 0x39, 0xc2, 0x01, 0x6f, 0x00, 0xbb,
+    0x31, 0xc2, 0x01, 0x30, 0x00, 0xbb, 0x21, 0xc2, 0x02, 0x2b, 0x00, 0xbb,
+    0x19, 0x97, 0x00, 0xbb, 0x11, 0x8b, 0x00, 0xbb, 0x09, 0x83, 0x00, 0xbb,
+    0x00, 0x83, 0x00, 0xb8, 0x03, 0x01, 0x8e, 0xb7, 0xc2, 0x00, 0xd0, 0x00,
+    0xb8, 0x89, 0xc2, 0x0d, 0xf6, 0x00, 0xb8, 0x81, 0xc2, 0x01, 0x4a, 0x00,
+    0xb8, 0x79, 0xc2, 0x00, 0xdb, 0x00, 0xb8, 0x71, 0xc2, 0x00, 0x39, 0x00,
+    0xb8, 0x69, 0xc2, 0x19, 0x2c, 0x00, 0xb8, 0x61, 0xc2, 0x01, 0xc3, 0x00,
+    0xb8, 0x59, 0xc2, 0x01, 0x5d, 0x00, 0xb8, 0x51, 0xc2, 0x00, 0xb0, 0x00,
+    0xb8, 0x49, 0x10, 0xc1, 0x8e, 0xbd, 0xc2, 0x0e, 0x9a, 0x00, 0xb8, 0x39,
+    0xc2, 0x01, 0x6f, 0x00, 0xb8, 0x31, 0xc2, 0x01, 0x30, 0x00, 0xb8, 0x21,
+    0xc2, 0x02, 0x2b, 0x00, 0xb8, 0x19, 0x97, 0x00, 0xb8, 0x11, 0x8b, 0x00,
+    0xb8, 0x08, 0xc8, 0x7a, 0x8b, 0x00, 0xb8, 0xa9, 0xc6, 0x1e, 0x95, 0x00,
+    0xb8, 0xa0, 0x97, 0x00, 0xb8, 0x99, 0x8b, 0x00, 0xb8, 0x90, 0x4a, 0xa3,
+    0x3c, 0xc1, 0x8e, 0xc7, 0xce, 0x1c, 0x92, 0x0b, 0x7f, 0x00, 0x46, 0x09,
+    0x97, 0xc1, 0x8e, 0xe7, 0x47, 0x02, 0x0e, 0x41, 0x8f, 0x0b, 0x44, 0x00,
+    0xbb, 0xc1, 0x8f, 0x77, 0xd1, 0x55, 0xeb, 0x08, 0xff, 0x79, 0xc9, 0xaf,
+    0x9c, 0x08, 0xff, 0x61, 0xcc, 0x8a, 0x69, 0x08, 0xff, 0x38, 0xc9, 0xab,
+    0x0a, 0x08, 0xff, 0x69, 0x4b, 0x9a, 0x10, 0x41, 0x8f, 0x9f, 0xcb, 0x94,
+    0xfe, 0x08, 0xff, 0x59, 0xcd, 0x73, 0x0d, 0x00, 0x5e, 0xb9, 0xcc, 0x8a,
+    0x51, 0x00, 0x5f, 0xc0, 0xcb, 0x97, 0xea, 0x08, 0xff, 0x51, 0xca, 0x97,
+    0xa9, 0x00, 0x5f, 0xb8, 0xc8, 0x42, 0xd2, 0x08, 0xff, 0x31, 0x46, 0x02,
+    0x0f, 0x41, 0x8f, 0xab, 0xd3, 0x43, 0xf7, 0x08, 0xff, 0x29, 0x45, 0x09,
+    0x98, 0xc1, 0x90, 0x12, 0xc7, 0xbf, 0xf6, 0x00, 0x5f, 0x99, 0xc9, 0xb0,
+    0x59, 0x00, 0x5f, 0xb0, 0xd8, 0x25, 0x8b, 0x08, 0xfe, 0xa1, 0x46, 0x02,
+    0xdd, 0xc1, 0x90, 0x36, 0x44, 0x05, 0x14, 0x41, 0x90, 0x4e, 0x03, 0xc1,
+    0x90, 0x74, 0x8b, 0x00, 0x5d, 0xfb, 0x01, 0x90, 0x80, 0x97, 0x00, 0x5e,
+    0x0b, 0x01, 0x90, 0x84, 0x87, 0x00, 0x5e, 0x33, 0x01, 0x90, 0x88, 0x91,
+    0x00, 0x5e, 0x52, 0x01, 0x90, 0x8c, 0xc3, 0x09, 0x41, 0x00, 0x5f, 0x81,
+    0x44, 0x05, 0x14, 0xc1, 0x90, 0x90, 0xc4, 0x00, 0xba, 0x00, 0x5f, 0xd0,
+    0xc4, 0x26, 0x78, 0x08, 0xb6, 0x49, 0xc5, 0x06, 0xdb, 0x08, 0xb6, 0x41,
+    0x15, 0xc1, 0x90, 0x9c, 0x08, 0xc1, 0x90, 0xa8, 0x16, 0xc1, 0x90, 0xb4,
+    0xc3, 0x05, 0x14, 0x08, 0xb6, 0x09, 0xc4, 0x15, 0xe7, 0x08, 0xb6, 0x00,
+    0x83, 0x08, 0xb4, 0x03, 0x01, 0x90, 0xc0, 0x14, 0xc1, 0x90, 0xd2, 0xc2,
+    0x00, 0xd0, 0x08, 0xb5, 0x49, 0x15, 0xc1, 0x90, 0xdc, 0xc2, 0x02, 0x41,
+    0x08, 0xb5, 0x31, 0xc2, 0x00, 0xdb, 0x08, 0xb5, 0x29, 0xc2, 0x19, 0x2c,
+    0x08, 0xb5, 0x19, 0xc2, 0x01, 0xc3, 0x08, 0xb5, 0x11, 0x04, 0xc1, 0x90,
+    0xe6, 0x12, 0xc1, 0x90, 0xf0, 0x10, 0xc1, 0x90, 0xfa, 0x06, 0xc1, 0x91,
+    0x10, 0x16, 0xc1, 0x91, 0x1e, 0x0c, 0xc1, 0x91, 0x2c, 0x05, 0xc1, 0x91,
+    0x36, 0x09, 0xc1, 0x91, 0x40, 0x0d, 0xc1, 0x91, 0x4a, 0x91, 0x08, 0xb4,
+    0x41, 0x87, 0x08, 0xb4, 0x31, 0x97, 0x08, 0xb4, 0x23, 0x01, 0x91, 0x54,
+    0x8b, 0x08, 0xb4, 0x12, 0x01, 0x91, 0x58, 0xc5, 0x33, 0x5d, 0x08, 0xb5,
+    0xb9, 0x42, 0x07, 0xb2, 0xc1, 0x91, 0x5c, 0xc8, 0x14, 0x38, 0x08, 0xb5,
+    0x58, 0x03, 0xc1, 0x91, 0x68, 0x91, 0x08, 0xb5, 0xa1, 0x87, 0x08, 0xb5,
+    0x91, 0x97, 0x08, 0xb5, 0x83, 0x01, 0x91, 0x74, 0x8b, 0x08, 0xb5, 0x72,
+    0x01, 0x91, 0x78, 0xc5, 0xde, 0x25, 0x00, 0xd5, 0x69, 0x0a, 0xc1, 0x91,
+    0x7c, 0x42, 0x0d, 0xf6, 0xc1, 0x91, 0x88, 0x0d, 0xc1, 0x91, 0x9d, 0x44,
+    0x38, 0x7e, 0xc1, 0x91, 0xb2, 0x14, 0xc1, 0x91, 0xc7, 0xc6, 0xca, 0xc7,
+    0x00, 0xd5, 0x29, 0xc5, 0xdc, 0xcc, 0x00, 0xd5, 0x03, 0x01, 0x91, 0xd3,
+    0x45, 0x28, 0xb1, 0x41, 0x91, 0xd9, 0xc4, 0x26, 0x78, 0x00, 0xd4, 0xc9,
+    0xc5, 0x06, 0xdb, 0x00, 0xd4, 0xc1, 0x15, 0xc1, 0x91, 0xe1, 0x08, 0xc1,
+    0x91, 0xed, 0x16, 0xc1, 0x91, 0xf9, 0xc3, 0x05, 0x14, 0x00, 0xd4, 0x89,
+    0xc4, 0x15, 0xe7, 0x00, 0xd4, 0x80, 0xc4, 0x26, 0x78, 0x00, 0xd4, 0x49,
+    0xc5, 0x06, 0xdb, 0x00, 0xd4, 0x41, 0x15, 0xc1, 0x92, 0x05, 0x08, 0xc1,
+    0x92, 0x11, 0x16, 0xc1, 0x92, 0x1d, 0xc3, 0x05, 0x14, 0x00, 0xd4, 0x09,
+    0xc4, 0x15, 0xe7, 0x00, 0xd4, 0x00, 0xd9, 0x1d, 0xd3, 0x00, 0xd3, 0xf9,
+    0x4d, 0x30, 0x92, 0x41, 0x92, 0x29, 0x91, 0x00, 0xd3, 0x5b, 0x01, 0x92,
+    0x49, 0x16, 0xc1, 0x92, 0x57, 0x83, 0x00, 0xd3, 0x0b, 0x01, 0x92, 0x63,
+    0x87, 0x00, 0xd3, 0x71, 0x97, 0x00, 0xd3, 0x4b, 0x01, 0x92, 0x6f, 0x8b,
+    0x00, 0xd3, 0x2b, 0x01, 0x92, 0x7a, 0xc7, 0xc2, 0xce, 0x00, 0xd3, 0x10,
+    0xc8, 0xbd, 0xea, 0x00, 0xd2, 0xa1, 0x0e, 0xc1, 0x92, 0x7e, 0xc2, 0x01,
+    0x24, 0x00, 0xd2, 0x91, 0xc2, 0x02, 0xe0, 0x00, 0xd2, 0x89, 0x97, 0x00,
+    0xd2, 0x7b, 0x01, 0x92, 0x97, 0x8b, 0x00, 0xd2, 0x6b, 0x01, 0x92, 0x9b,
+    0x83, 0x00, 0xd2, 0x59, 0x45, 0x08, 0xcb, 0xc1, 0x92, 0x9f, 0xc2, 0x01,
+    0x4a, 0x00, 0xd2, 0x29, 0x14, 0xc1, 0x92, 0xcb, 0xc2, 0x01, 0xc3, 0x00,
+    0xd1, 0xf1, 0xc2, 0x01, 0x5d, 0x00, 0xd1, 0xb9, 0x10, 0xc1, 0x92, 0xd8,
+    0xc2, 0x0e, 0x9a, 0x00, 0xd1, 0x78, 0x44, 0x1a, 0xce, 0xc1, 0x92, 0xe8,
+    0x15, 0xc1, 0x92, 0xfc, 0xc2, 0x00, 0xd0, 0x00, 0xca, 0xb9, 0x83, 0x00,
+    0xca, 0xb0, 0x8b, 0x00, 0xcb, 0x69, 0xc2, 0x0f, 0xe1, 0x00, 0xcb, 0x60,
+    0x8a, 0x00, 0xcb, 0x31, 0x87, 0x00, 0xcb, 0x28, 0x87, 0x00, 0xcb, 0x50,
+    0x91, 0x00, 0xcb, 0x40, 0x83, 0x00, 0xcb, 0x11, 0xc2, 0x01, 0x30, 0x00,
+    0xca, 0x90, 0xc2, 0x00, 0xd0, 0x00, 0xcb, 0x01, 0x83, 0x00, 0xca, 0x80,
+    0xc2, 0x00, 0xd0, 0x00, 0xca, 0xd1, 0x83, 0x00, 0xca, 0xc8, 0x42, 0x00,
+    0xe8, 0xc1, 0x93, 0x06, 0xc6, 0xd3, 0x49, 0x05, 0x56, 0xf1, 0xc3, 0x71,
+    0xe5, 0x05, 0x56, 0xe9, 0xc5, 0xda, 0x2e, 0x05, 0x56, 0xe0, 0xc4, 0x7b,
+    0x07, 0x05, 0x56, 0x11, 0xc3, 0x1c, 0xd6, 0x05, 0x56, 0x09, 0xc5, 0xda,
+    0x2e, 0x05, 0x56, 0x01, 0xc2, 0x13, 0x4c, 0x05, 0x55, 0xf8, 0x03, 0xc1,
+    0x93, 0x10, 0x97, 0x05, 0x55, 0xa3, 0x01, 0x93, 0x26, 0x8b, 0x05, 0x55,
+    0x93, 0x01, 0x93, 0x31, 0x87, 0x05, 0x55, 0xa9, 0x91, 0x05, 0x55, 0xb0,
+    0xc3, 0x01, 0x95, 0x05, 0x55, 0x81, 0xc3, 0x01, 0xfd, 0x05, 0x55, 0xb8,
+    0x45, 0x08, 0xcb, 0xc1, 0x93, 0x35, 0x44, 0x05, 0x36, 0x41, 0x93, 0x8f,
+    0xcb, 0x50, 0x7f, 0x01, 0x36, 0x51, 0xc8, 0xbd, 0x02, 0x01, 0x5e, 0x10,
+    0xc6, 0x30, 0x98, 0x01, 0x18, 0xc9, 0x44, 0x06, 0x1f, 0x41, 0x93, 0xe9,
+    0x46, 0x10, 0x29, 0xc1, 0x93, 0xf5, 0xc5, 0xce, 0x22, 0x01, 0x71, 0xc0,
+    0xc6, 0xd2, 0x71, 0x01, 0x0a, 0x71, 0x52, 0x46, 0xb6, 0xc1, 0x94, 0x01,
+    0x45, 0x1a, 0x38, 0xc1, 0x94, 0x0d, 0xc8, 0x52, 0x00, 0x01, 0x71, 0xa8,
+    0xc8, 0x36, 0x21, 0x01, 0x0a, 0x59, 0xc4, 0x01, 0x96, 0x01, 0x4d, 0x10,
+    0xc8, 0xbd, 0x0a, 0x01, 0x09, 0x91, 0xc4, 0x0a, 0x8b, 0x01, 0x71, 0x90,
+    0xd0, 0x59, 0xe2, 0x01, 0x3e, 0x01, 0xce, 0x05, 0x19, 0x01, 0x02, 0xb0,
+    0x50, 0x5a, 0x72, 0xc1, 0x94, 0x19, 0xcf, 0x65, 0x85, 0x01, 0x59, 0x88,
+    0xd0, 0x27, 0x1f, 0x01, 0x0f, 0xb1, 0x44, 0x39, 0xfd, 0x41, 0x94, 0x25,
+    0x4c, 0x89, 0x85, 0xc1, 0x94, 0x3d, 0x4b, 0x95, 0x35, 0xc1, 0x94, 0x49,
+    0x43, 0x07, 0x6e, 0xc1, 0x94, 0x4f, 0x4c, 0x80, 0x91, 0x41, 0x94, 0x55,
+    0x15, 0xc1, 0x94, 0x5b, 0xcb, 0x58, 0xc7, 0x0f, 0xbd, 0x08, 0xce, 0x73,
+    0x7c, 0x01, 0x10, 0x21, 0xc6, 0xd3, 0xc7, 0x01, 0x10, 0x18, 0xc8, 0xb8,
+    0xba, 0x00, 0x3d, 0x79, 0xc6, 0xcb, 0xc3, 0x00, 0x3d, 0x71, 0xc8, 0xbb,
+    0x1a, 0x00, 0x3d, 0x58, 0xc8, 0xb8, 0x32, 0x00, 0x3d, 0x49, 0xc6, 0xcc,
+    0x5f, 0x00, 0x3d, 0x61, 0xc8, 0xb6, 0x52, 0x00, 0x3d, 0x68, 0xc8, 0xb8,
+    0xaa, 0x00, 0x3d, 0x39, 0xc6, 0xcd, 0x01, 0x00, 0x3d, 0x30, 0xc5, 0xda,
+    0xec, 0x00, 0x3d, 0x29, 0xc5, 0xd8, 0x3a, 0x00, 0x3d, 0x21, 0x09, 0xc1,
+    0x94, 0x67, 0x16, 0xc1, 0x94, 0x79, 0x06, 0xc1, 0x94, 0x92, 0x15, 0xc1,
+    0x94, 0x9c, 0x0a, 0xc1, 0x94, 0xac, 0xc9, 0xb4, 0xd9, 0x00, 0x3c, 0xb9,
+    0xc8, 0xb7, 0x22, 0x00, 0x3c, 0xb1, 0xc8, 0xbd, 0x92, 0x00, 0x3c, 0xa9,
+    0xc3, 0xa9, 0x9c, 0x00, 0x3c, 0xa1, 0x1c, 0xc1, 0x94, 0xb8, 0x0e, 0xc1,
+    0x94, 0xc0, 0xc5, 0xde, 0x7a, 0x00, 0x3c, 0x51, 0xc5, 0xdb, 0x00, 0x00,
+    0x3c, 0x49, 0xc5, 0xd8, 0xd0, 0x00, 0x3c, 0x41, 0x03, 0xc1, 0x94, 0xcc,
+    0x0d, 0xc1, 0x94, 0xd8, 0xc3, 0x47, 0x81, 0x00, 0x3c, 0x21, 0xc3, 0x47,
+    0xd9, 0x00, 0x3c, 0x19, 0x10, 0x41, 0x94, 0xe4, 0x49, 0x3b, 0x93, 0xc1,
+    0x94, 0xf0, 0xd3, 0x44, 0x0a, 0x00, 0x71, 0xf8, 0xc4, 0x15, 0xe7, 0x00,
+    0x72, 0x81, 0xc3, 0x05, 0x14, 0x00, 0x72, 0x89, 0x16, 0xc1, 0x95, 0x44,
+    0x08, 0xc1, 0x95, 0x50, 0x15, 0xc1, 0x95, 0x5c, 0xc5, 0x06, 0xdb, 0x00,
+    0x72, 0xc1, 0xc4, 0x26, 0x78, 0x00, 0x72, 0xc8, 0xc8, 0x1e, 0x3f, 0x01,
+    0x19, 0x01, 0xcc, 0x85, 0x71, 0x01, 0x5e, 0x51, 0xcc, 0x83, 0x19, 0x01,
+    0x71, 0xc9, 0xd0, 0x1d, 0xec, 0x01, 0x72, 0xc9, 0xd1, 0x1a, 0x4a, 0x01,
+    0x72, 0xd0, 0xc5, 0x13, 0x67, 0x01, 0x18, 0xe9, 0xc3, 0x0a, 0xea, 0x01,
+    0x18, 0x70, 0xc5, 0x13, 0x67, 0x01, 0x18, 0xe1, 0xc3, 0x0a, 0xea, 0x01,
+    0x18, 0x78, 0xca, 0xa1, 0xb6, 0x01, 0x49, 0xe8, 0x83, 0x0f, 0x15, 0x6b,
+    0x01, 0x95, 0x68, 0x04, 0xc1, 0x95, 0x6c, 0x91, 0x0f, 0x15, 0x51, 0x87,
+    0x0f, 0x15, 0x33, 0x01, 0x95, 0x76, 0x97, 0x0f, 0x15, 0x29, 0x8b, 0x0f,
+    0x15, 0x0b, 0x01, 0x95, 0x7a, 0xc2, 0x00, 0xdb, 0x0f, 0x15, 0x01, 0xc2,
+    0x00, 0x39, 0x0f, 0x14, 0xf9, 0xc2, 0x00, 0xd0, 0x0f, 0x14, 0xf1, 0xc2,
+    0x25, 0x3b, 0x0f, 0x14, 0xe9, 0xc2, 0x01, 0x4a, 0x0f, 0x14, 0xe1, 0xc2,
+    0x19, 0x2c, 0x0f, 0x14, 0xd9, 0xc3, 0x1c, 0x63, 0x0f, 0x14, 0xd1, 0xc2,
+    0x0d, 0xf6, 0x0f, 0x14, 0xc9, 0x10, 0xc1, 0x95, 0x7e, 0xc2, 0x01, 0xc3,
+    0x0f, 0x14, 0xb1, 0xc2, 0x01, 0x30, 0x0f, 0x14, 0xa9, 0xc2, 0x02, 0x2b,
+    0x0f, 0x14, 0xa1, 0xc2, 0x0e, 0x9a, 0x0f, 0x14, 0x99, 0xc2, 0x01, 0x6f,
+    0x0f, 0x14, 0x91, 0xc2, 0x00, 0xb0, 0x0f, 0x14, 0x80, 0xc2, 0xe6, 0x7d,
+    0x0f, 0x92, 0x09, 0xc2, 0x8c, 0x54, 0x0f, 0x92, 0x10, 0xc3, 0xe5, 0x81,
+    0x0f, 0x92, 0x41, 0xc3, 0xe6, 0x59, 0x0f, 0x92, 0x29, 0xc3, 0xe5, 0xa5,
+    0x0f, 0x92, 0x00, 0xc3, 0xe6, 0x6b, 0x0f, 0x92, 0x39, 0xc3, 0xe5, 0x3f,
+    0x0f, 0x92, 0x18, 0xc3, 0xe5, 0x54, 0x0f, 0x92, 0x31, 0xc3, 0xe5, 0xe4,
+    0x0f, 0x92, 0x20, 0xd8, 0x03, 0xaf, 0x01, 0x3c, 0xe9, 0x46, 0x00, 0x8b,
+    0x41, 0x95, 0x88, 0xc6, 0x1c, 0xb4, 0x01, 0x01, 0x19, 0xc5, 0xcd, 0xce,
+    0x0f, 0xa6, 0x81, 0xcc, 0x87, 0x69, 0x0f, 0xb5, 0x48, 0xc4, 0x03, 0xd7,
+    0x01, 0x31, 0xa9, 0xc3, 0x02, 0x34, 0x01, 0x31, 0xa0, 0xcf, 0x05, 0x98,
+    0x01, 0x15, 0x51, 0xc9, 0x32, 0x24, 0x01, 0x4c, 0x01, 0xcf, 0x27, 0x65,
+    0x01, 0x57, 0xa1, 0xd6, 0x30, 0x7a, 0x01, 0x57, 0xa8, 0xc4, 0x18, 0x26,
+    0x01, 0x01, 0xa1, 0xc3, 0x25, 0xd6, 0x01, 0x4f, 0xd8, 0xd6, 0x2d, 0x62,
+    0x01, 0x53, 0x41, 0xd6, 0x2c, 0x2e, 0x01, 0x53, 0x48, 0xc9, 0x00, 0xca,
+    0x01, 0x57, 0xb9, 0xcc, 0x07, 0xc7, 0x01, 0x57, 0xc0, 0xc5, 0xc3, 0x08,
+    0x0f, 0x9b, 0xc9, 0xc4, 0x55, 0x81, 0x0f, 0xa1, 0x00, 0xc7, 0xc8, 0x70,
+    0x0e, 0x9a, 0xb1, 0xc7, 0xb6, 0x0b, 0x0e, 0x98, 0xc0, 0xc4, 0x1d, 0xa8,
+    0x0e, 0x99, 0x59, 0xc7, 0x05, 0x79, 0x0e, 0x98, 0x38, 0xc7, 0xca, 0x37,
+    0x0e, 0x9a, 0xa9, 0xca, 0xa3, 0x32, 0x0e, 0x99, 0x68, 0xca, 0x9b, 0xe4,
+    0x0e, 0x9a, 0xa1, 0x0f, 0xc1, 0x95, 0xa0, 0xc8, 0xbc, 0xd2, 0x0e, 0x98,
+    0x80, 0xc7, 0xb1, 0x21, 0x0e, 0x9a, 0x39, 0xca, 0xa6, 0x20, 0x0e, 0x99,
+    0x11, 0xd9, 0x1d, 0xa1, 0x0e, 0x98, 0x78, 0x43, 0x5e, 0x7a, 0xc1, 0x95,
+    0xac, 0x10, 0x41, 0x95, 0xb8, 0xc3, 0x14, 0xc8, 0x0e, 0x9a, 0x79, 0x07,
+    0x41, 0x95, 0xc2, 0x11, 0xc1, 0x95, 0xce, 0xc6, 0xca, 0xd3, 0x0e, 0x99,
+    0x48, 0xc9, 0xab, 0x5b, 0x0e, 0x99, 0x99, 0xc8, 0xba, 0xba, 0x0e, 0x99,
+    0x81, 0xc7, 0xc4, 0xc6, 0x0e, 0x98, 0xf8, 0xc3, 0x01, 0xd2, 0x0e, 0x99,
+    0xf8, 0x15, 0xc1, 0x95, 0xda, 0xc5, 0xd9, 0x93, 0x0e, 0x98, 0xd1, 0xc3,
+    0x29, 0x43, 0x0e, 0x98, 0xa0, 0xc5, 0x83, 0x4f, 0x0e, 0x99, 0xa1, 0xc5,
+    0x5b, 0x25, 0x0e, 0x99, 0x20, 0xd7, 0x28, 0xfb, 0x01, 0x3d, 0xd1, 0xcf,
+    0x15, 0x36, 0x01, 0x39, 0xd8, 0xcd, 0x7f, 0x59, 0x01, 0x38, 0x31, 0x43,
+    0x05, 0xbb, 0xc1, 0x95, 0xe4, 0xc4, 0x00, 0xba, 0x01, 0x09, 0x09, 0xcf,
+    0x62, 0x01, 0x0f, 0xac, 0x00, 0x05, 0xc1, 0x95, 0xf3, 0x03, 0xc1, 0x95,
+    0xff, 0x42, 0x07, 0xb2, 0xc1, 0x96, 0x0b, 0xc5, 0x33, 0x5d, 0x00, 0x61,
+    0xe1, 0xc7, 0xc3, 0x61, 0x00, 0x63, 0xb9, 0xc5, 0xdc, 0x40, 0x00, 0x63,
+    0xf8, 0x45, 0x02, 0x10, 0xc1, 0x96, 0x17, 0xc9, 0x36, 0x53, 0x00, 0x62,
+    0xa8, 0x03, 0xc1, 0x96, 0x80, 0x8b, 0x00, 0x61, 0xfb, 0x01, 0x96, 0x8c,
+    0x97, 0x00, 0x62, 0x0b, 0x01, 0x96, 0x90, 0x48, 0xb2, 0x2d, 0xc1, 0x96,
+    0x94, 0x87, 0x00, 0x62, 0x33, 0x01, 0x96, 0xa2, 0x91, 0x00, 0x62, 0x52,
+    0x01, 0x96, 0xa6, 0xc4, 0x15, 0xe7, 0x00, 0x63, 0x31, 0xc3, 0x05, 0x14,
+    0x00, 0x63, 0x39, 0x16, 0xc1, 0x96, 0xaa, 0x08, 0xc1, 0x96, 0xb6, 0x15,
+    0xc1, 0x96, 0xc2, 0xc5, 0x06, 0xdb, 0x00, 0x63, 0x71, 0xc4, 0x26, 0x78,
+    0x00, 0x63, 0x78, 0xdb, 0x15, 0xe7, 0x00, 0x63, 0xc1, 0x48, 0xb5, 0xca,
+    0xc1, 0x96, 0xce, 0x16, 0x41, 0x96, 0xda, 0x00, 0x41, 0x96, 0xe6, 0xca,
+    0x9e, 0xe6, 0x01, 0x70, 0xd9, 0x44, 0x05, 0x18, 0x41, 0x96, 0xf2, 0xc4,
+    0x26, 0x78, 0x08, 0xa6, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0xa6, 0xc1, 0x15,
+    0xc1, 0x96, 0xfe, 0x08, 0xc1, 0x97, 0x0a, 0x16, 0xc1, 0x97, 0x16, 0xc3,
+    0x05, 0x14, 0x08, 0xa6, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0xa6, 0x80, 0xd0,
+    0x50, 0xcf, 0x08, 0xa6, 0x31, 0xc3, 0x7c, 0x50, 0x08, 0xa4, 0x00, 0x03,
+    0xc1, 0x97, 0x22, 0xc5, 0x33, 0x5d, 0x08, 0xa6, 0x19, 0xcb, 0x1e, 0x89,
+    0x08, 0xa5, 0xf9, 0x42, 0x07, 0xb2, 0x41, 0x97, 0x2e, 0x03, 0xc1, 0x97,
+    0x3a, 0x46, 0x2e, 0xee, 0xc1, 0x97, 0x46, 0x91, 0x08, 0xa5, 0xe1, 0x87,
+    0x08, 0xa5, 0xc9, 0x48, 0xb2, 0x2d, 0xc1, 0x97, 0x4e, 0x97, 0x08, 0xa5,
+    0x9b, 0x01, 0x97, 0x5c, 0x8b, 0x08, 0xa5, 0x8a, 0x01, 0x97, 0x60, 0xc2,
+    0x00, 0xd0, 0x08, 0xa5, 0x79, 0x15, 0xc1, 0x97, 0x64, 0x18, 0xc1, 0x97,
+    0x74, 0xc2, 0x00, 0xdb, 0x08, 0xa5, 0x51, 0xc2, 0x00, 0x39, 0x08, 0xa5,
+    0x49, 0xc2, 0x19, 0x2c, 0x08, 0xa5, 0x41, 0xc2, 0x01, 0xc3, 0x08, 0xa5,
+    0x39, 0x04, 0xc1, 0x97, 0x7e, 0x12, 0xc1, 0x97, 0x88, 0x10, 0xc1, 0x97,
+    0x92, 0x06, 0xc1, 0x97, 0xa8, 0x16, 0xc1, 0x97, 0xb6, 0x0c, 0xc1, 0x97,
+    0xc4, 0x05, 0xc1, 0x97, 0xce, 0x09, 0xc1, 0x97, 0xd8, 0x0d, 0xc1, 0x97,
+    0xe2, 0x83, 0x08, 0xa4, 0x0b, 0x01, 0x97, 0xec, 0x91, 0x08, 0xa4, 0x69,
+    0x87, 0x08, 0xa4, 0x59, 0x97, 0x08, 0xa4, 0x2b, 0x01, 0x97, 0xf8, 0x8b,
+    0x08, 0xa4, 0x1a, 0x01, 0x97, 0xfc, 0xc9, 0xae, 0x7c, 0x00, 0x78, 0x01,
+    0x45, 0x10, 0x7a, 0x41, 0x98, 0x00, 0x14, 0xc1, 0x98, 0x1c, 0x42, 0x19,
+    0x2c, 0xc1, 0x98, 0x2e, 0x0f, 0xc1, 0x98, 0x3a, 0xce, 0x70, 0x50, 0x00,
+    0x7c, 0x11, 0xc8, 0xbb, 0x42, 0x00, 0x7c, 0x19, 0x42, 0x58, 0x61, 0xc1,
+    0x98, 0x46, 0x44, 0xe0, 0x6f, 0xc1, 0x98, 0x52, 0xd1, 0x4f, 0x9c, 0x00,
+    0x7c, 0x60, 0x45, 0x00, 0xba, 0xc1, 0x98, 0x5e, 0x47, 0x02, 0x0e, 0x41,
+    0x98, 0x70, 0x44, 0x02, 0x11, 0xc1, 0x98, 0xd2, 0x4b, 0x8f, 0xec, 0x41,
+    0x98, 0xde, 0x46, 0x10, 0xb6, 0xc1, 0x98, 0xea, 0xd1, 0x56, 0xfb, 0x00,
+    0x78, 0x58, 0x47, 0x90, 0xa7, 0xc1, 0x98, 0xf6, 0x45, 0x95, 0xf1, 0xc1,
+    0x99, 0x02, 0xc6, 0xd3, 0x19, 0x00, 0x79, 0xc0, 0xc9, 0xb4, 0x37, 0x00,
+    0x78, 0x41, 0xc3, 0x01, 0xe3, 0x00, 0x78, 0x68, 0x15, 0xc1, 0x99, 0x0e,
+    0x49, 0xad, 0x6e, 0x41, 0x99, 0x18, 0x44, 0x97, 0x1a, 0xc1, 0x99, 0x24,
+    0x4a, 0x9f, 0xd6, 0x41, 0x99, 0x33, 0x15, 0xc1, 0x99, 0x3f, 0xd3, 0x47,
+    0x02, 0x00, 0x7e, 0xd0, 0xd3, 0x45, 0x73, 0x00, 0x78, 0x89, 0xcd, 0x76,
+    0x01, 0x00, 0x78, 0x90, 0xc2, 0x00, 0x45, 0x00, 0x79, 0xe1, 0xc2, 0x02,
+    0x2c, 0x00, 0x79, 0xe8, 0xca, 0x9c, 0xfc, 0x00, 0x78, 0xa9, 0xca, 0xa4,
+    0xfe, 0x00, 0x78, 0xb0, 0x0d, 0xc1, 0x99, 0x4b, 0x09, 0xc1, 0x99, 0x61,
+    0x10, 0xc1, 0x99, 0x6b, 0x05, 0xc1, 0x99, 0x81, 0xc2, 0x25, 0x3b, 0x00,
+    0x7a, 0x39, 0x16, 0xc1, 0x99, 0x8b, 0x06, 0xc1, 0x99, 0x9d, 0x12, 0xc1,
+    0x99, 0xaf, 0x04, 0xc1, 0x99, 0xb9, 0xc2, 0x01, 0xc3, 0x00, 0x7a, 0xc1,
+    0xc2, 0x01, 0x4a, 0x00, 0x7a, 0xe9, 0x1c, 0xc1, 0x99, 0xc3, 0xc2, 0x00,
+    0x02, 0x00, 0x7b, 0x01, 0xc2, 0x19, 0x2c, 0x00, 0x7b, 0x09, 0x14, 0xc1,
+    0x99, 0xcd, 0xc2, 0x00, 0xdb, 0x00, 0x7b, 0x19, 0x15, 0xc1, 0x99, 0xd7,
+    0xc2, 0x00, 0xd0, 0x00, 0x7b, 0x39, 0x83, 0x00, 0x7b, 0x41, 0xcd, 0x7f,
+    0xe8, 0x00, 0x7b, 0x50, 0xd4, 0x39, 0x1c, 0x00, 0x78, 0xb9, 0xcb, 0x98,
+    0x63, 0x00, 0x78, 0xc8, 0xc2, 0x02, 0xa0, 0x00, 0x79, 0x11, 0xc4, 0x02,
+    0xde, 0x00, 0x79, 0x18, 0xc3, 0x09, 0x9e, 0x00, 0x79, 0x21, 0xc3, 0x0d,
+    0x14, 0x00, 0x79, 0x28, 0xc2, 0x22, 0xcc, 0x00, 0x79, 0x31, 0xc4, 0x18,
+    0x10, 0x00, 0x79, 0x38, 0xc3, 0x05, 0x14, 0x00, 0x79, 0x51, 0x16, 0xc1,
+    0x99, 0xe7, 0x08, 0xc1, 0x99, 0xf3, 0x15, 0xc1, 0x99, 0xff, 0xc5, 0x06,
+    0xdb, 0x00, 0x79, 0x89, 0xc4, 0x26, 0x78, 0x00, 0x79, 0x91, 0xc4, 0x15,
+    0xe7, 0x00, 0x79, 0x98, 0x8b, 0x00, 0x7b, 0x98, 0x97, 0x00, 0x7b, 0xa8,
+    0x94, 0x00, 0x7b, 0xb3, 0x01, 0x9a, 0x0b, 0x8e, 0x00, 0x7b, 0xc2, 0x01,
+    0x9a, 0x0f, 0x87, 0x00, 0x7b, 0xd8, 0x91, 0x00, 0x7b, 0xe8, 0x8b, 0x00,
+    0x7c, 0x08, 0x83, 0x01, 0x69, 0x83, 0x01, 0x9a, 0x13, 0x87, 0x01, 0x6b,
+    0x33, 0x01, 0x9a, 0x84, 0x8b, 0x01, 0x6a, 0x49, 0x97, 0x01, 0x6a, 0x99,
+    0x91, 0x01, 0x6b, 0x38, 0x8c, 0x01, 0x69, 0xa9, 0x8a, 0x01, 0x6a, 0x08,
+    0x48, 0xba, 0x82, 0xc1, 0x9a, 0x88, 0xcd, 0x7f, 0x0b, 0x01, 0x6b, 0x20,
+    0xcb, 0x8d, 0xfd, 0x01, 0x6a, 0x59, 0xc8, 0xb6, 0x7a, 0x01, 0x6a, 0xc0,
+    0x00, 0xc1, 0x9a, 0xa7, 0xda, 0x05, 0x0d, 0x01, 0x71, 0x50, 0xc2, 0x00,
+    0xbf, 0x01, 0x52, 0xb1, 0xc3, 0x02, 0x9b, 0x01, 0x52, 0xa8, 0xcb, 0x97,
+    0x03, 0x01, 0x50, 0x41, 0xcc, 0x86, 0x6d, 0x01, 0x50, 0x38, 0xc7, 0x09,
+    0x0d, 0x01, 0x49, 0xa1, 0xc9, 0x03, 0xc8, 0x01, 0x49, 0xa9, 0xca, 0x3c,
+    0xa4, 0x0f, 0xc5, 0x88, 0xc9, 0x01, 0x88, 0x01, 0x49, 0xb1, 0xca, 0x03,
+    0x87, 0x01, 0x49, 0xb8, 0x48, 0x19, 0x9b, 0xc1, 0x9a, 0xb3, 0x07, 0xc1,
+    0x9b, 0x11, 0x45, 0x17, 0x15, 0x41, 0x9b, 0x1d, 0x43, 0x01, 0xc5, 0xc1,
+    0x9b, 0x29, 0x43, 0x2d, 0x2f, 0xc1, 0x9b, 0x35, 0x4b, 0x4c, 0x93, 0x41,
+    0x9b, 0x41, 0x03, 0xc1, 0x9b, 0xad, 0x45, 0x00, 0x59, 0xc1, 0x9b, 0xbc,
+    0xd3, 0x44, 0x69, 0x00, 0x47, 0x11, 0xd0, 0x5e, 0x52, 0x00, 0x33, 0x58,
+    0x4f, 0x2f, 0xa0, 0xc1, 0x9b, 0xcb, 0x03, 0xc1, 0x9b, 0xda, 0x43, 0x0d,
+    0xed, 0xc1, 0x9b, 0xe4, 0xcd, 0x75, 0xb3, 0x00, 0x32, 0xe8, 0x00, 0xc1,
+    0x9b, 0xea, 0xc3, 0x13, 0x00, 0x00, 0x32, 0x6a, 0x01, 0x9b, 0xfc, 0xc4,
+    0x04, 0xa7, 0x00, 0x32, 0x73, 0x01, 0x9c, 0x02, 0xc8, 0x11, 0xf7, 0x00,
+    0x36, 0xa1, 0xd0, 0x5c, 0x72, 0x00, 0x33, 0x69, 0xce, 0x6f, 0x7e, 0x00,
+    0x30, 0x10, 0x45, 0x03, 0x14, 0xc1, 0x9c, 0x0f, 0x17, 0xc1, 0x9c, 0x39,
+    0x46, 0x10, 0x79, 0xc1, 0x9c, 0x4e, 0x44, 0x00, 0xbb, 0xc1, 0x9c, 0x70,
+    0xd3, 0x46, 0xa3, 0x00, 0x36, 0xf1, 0xc5, 0xd7, 0x18, 0x00, 0x32, 0x8b,
+    0x01, 0x9c, 0x8c, 0xc8, 0x52, 0x00, 0x00, 0x30, 0xd8, 0xc8, 0xb5, 0x52,
+    0x00, 0x47, 0x91, 0xc8, 0xb8, 0xc2, 0x00, 0x47, 0x89, 0xc8, 0x6e, 0xbf,
+    0x00, 0x47, 0x80, 0x44, 0x05, 0x14, 0xc1, 0x9c, 0x90, 0xd1, 0x52, 0x44,
+    0x00, 0x47, 0x19, 0x03, 0xc1, 0x9c, 0xa2, 0xd2, 0x4b, 0x95, 0x00, 0x33,
+    0x61, 0xda, 0x1b, 0x1a, 0x00, 0x30, 0xf0, 0x45, 0x00, 0x33, 0xc1, 0x9c,
+    0xb1, 0xc4, 0x0a, 0x8b, 0x00, 0x30, 0x60, 0xd3, 0x41, 0xbd, 0x00, 0x44,
+    0xf9, 0x44, 0x08, 0x0b, 0x41, 0x9c, 0xcc, 0xd1, 0x53, 0xcb, 0x00, 0x44,
+    0x89, 0x11, 0xc1, 0x9c, 0xd8, 0xce, 0x70, 0xa4, 0x00, 0x37, 0x49, 0xcb,
+    0x8e, 0x13, 0x00, 0x33, 0x50, 0xcc, 0x41, 0x19, 0x00, 0x44, 0x71, 0x4a,
+    0x6f, 0xc8, 0x41, 0x9c, 0xe4, 0x4c, 0x81, 0x09, 0xc1, 0x9c, 0xf6, 0x46,
+    0x0a, 0x10, 0x41, 0x9d, 0x02, 0xca, 0x43, 0x42, 0x00, 0x30, 0x29, 0xc4,
+    0x00, 0xba, 0x00, 0x30, 0x00, 0xc4, 0x26, 0x78, 0x00, 0x33, 0x49, 0xc5,
+    0x06, 0xdb, 0x00, 0x33, 0x41, 0x15, 0xc1, 0x9d, 0x0e, 0x08, 0xc1, 0x9d,
+    0x1a, 0x16, 0xc1, 0x9d, 0x26, 0xc3, 0x05, 0x14, 0x00, 0x33, 0x09, 0xc4,
+    0x15, 0xe7, 0x00, 0x33, 0x00, 0xd1, 0x57, 0x1d, 0x00, 0x30, 0x51, 0xca,
+    0xa8, 0x00, 0x00, 0x30, 0x48, 0x44, 0x40, 0xee, 0xc1, 0x9d, 0x32, 0xc7,
+    0xc2, 0xdc, 0x07, 0xd8, 0xb1, 0xc8, 0xb8, 0x22, 0x00, 0x2c, 0x38, 0xc2,
+    0x16, 0x5a, 0x00, 0x2b, 0xab, 0x01, 0x9d, 0x4a, 0xc3, 0xb1, 0x0d, 0x00,
+    0x2c, 0x31, 0xc2, 0x38, 0x2a, 0x00, 0x2c, 0x29, 0x42, 0x00, 0x3c, 0xc1,
+    0x9d, 0x56, 0x12, 0xc1, 0x9d, 0x5e, 0x05, 0xc1, 0x9d, 0x6a, 0x14, 0xc1,
+    0x9d, 0x76, 0x16, 0xc1, 0x9d, 0x80, 0x18, 0xc1, 0x9d, 0x90, 0x15, 0xc1,
+    0x9d, 0x9a, 0x0c, 0xc1, 0x9d, 0xa6, 0xc3, 0x2a, 0x91, 0x00, 0x2b, 0xb1,
+    0xc3, 0x00, 0xc3, 0x00, 0x2b, 0xa1, 0x09, 0xc1, 0x9d, 0xb0, 0xc2, 0x01,
+    0x23, 0x00, 0x2b, 0x81, 0xc3, 0xe6, 0x1a, 0x00, 0x2b, 0x69, 0xc4, 0xe1,
+    0x0b, 0x00, 0x2b, 0x61, 0xc3, 0x03, 0x0d, 0x00, 0x2b, 0x59, 0x1c, 0xc1,
+    0x9d, 0xbc, 0x07, 0xc1, 0x9d, 0xc6, 0xc2, 0x0e, 0x9a, 0x00, 0x2b, 0x21,
+    0xc3, 0x18, 0xf2, 0x00, 0x2b, 0x11, 0xc3, 0x36, 0x99, 0x00, 0x2b, 0x08,
+    0xc3, 0xb1, 0x0d, 0x00, 0x2a, 0xb1, 0xc2, 0x38, 0x2a, 0x00, 0x2a, 0xa9,
+    0x42, 0x00, 0x3c, 0xc1, 0x9d, 0xd4, 0x12, 0xc1, 0x9d, 0xdc, 0xc2, 0x16,
+    0x5a, 0x00, 0x2a, 0x2b, 0x01, 0x9d, 0xe8, 0x05, 0xc1, 0x9d, 0xee, 0x14,
+    0xc1, 0x9d, 0xfa, 0x16, 0xc1, 0x9e, 0x04, 0x18, 0xc1, 0x9e, 0x0e, 0x15,
+    0xc1, 0x9e, 0x18, 0x0c, 0xc1, 0x9e, 0x24, 0xc3, 0x2a, 0x91, 0x00, 0x2a,
+    0x31, 0xc3, 0x00, 0xc3, 0x00, 0x2a, 0x21, 0x09, 0xc1, 0x9e, 0x2e, 0xc2,
+    0x01, 0x23, 0x00, 0x2a, 0x01, 0xc3, 0xe6, 0x1a, 0x00, 0x29, 0xe9, 0xc4,
+    0xe1, 0x0b, 0x00, 0x29, 0xe1, 0xc3, 0x03, 0x0d, 0x00, 0x29, 0xd9, 0x1c,
+    0xc1, 0x9e, 0x3a, 0x07, 0xc1, 0x9e, 0x44, 0xc2, 0x0e, 0x9a, 0x00, 0x29,
+    0xa1, 0xc3, 0x36, 0x99, 0x00, 0x29, 0x89, 0xc3, 0x18, 0xf2, 0x00, 0x29,
+    0x90, 0xc4, 0x6b, 0x52, 0x0f, 0x48, 0x01, 0x06, 0xc1, 0x9e, 0x52, 0xc4,
+    0x76, 0x31, 0x0f, 0x48, 0x11, 0xc4, 0xe4, 0xb3, 0x0f, 0x48, 0x19, 0x04,
+    0xc1, 0x9e, 0x5e, 0x15, 0xc1, 0x9e, 0x68, 0xc2, 0x00, 0x67, 0x0f, 0x48,
+    0x31, 0xc2, 0x00, 0x39, 0x0f, 0x48, 0x41, 0x87, 0x0f, 0x48, 0x49, 0xc2,
+    0x00, 0x87, 0x0f, 0x48, 0x51, 0x8b, 0x0f, 0x48, 0x59, 0x91, 0x0f, 0x48,
+    0x61, 0x1b, 0xc1, 0x9e, 0x74, 0xc3, 0x7e, 0x89, 0x0f, 0x48, 0x79, 0x10,
+    0xc1, 0x9e, 0x7e, 0x0d, 0xc1, 0x9e, 0x90, 0x97, 0x0f, 0x48, 0x99, 0xc4,
+    0xe1, 0x4b, 0x0f, 0x48, 0xa1, 0xc3, 0x11, 0xee, 0x0f, 0x48, 0xa9, 0xc2,
+    0x00, 0xd0, 0x0f, 0x48, 0xb1, 0xc4, 0xd8, 0x3a, 0x0f, 0x48, 0xb9, 0x09,
+    0xc1, 0x9e, 0xa2, 0xc2, 0x00, 0x16, 0x0f, 0x48, 0xd1, 0xc2, 0x02, 0x41,
+    0x0f, 0x48, 0xe1, 0xc3, 0xa9, 0xfc, 0x0f, 0x48, 0xf8, 0xc4, 0x14, 0x74,
+    0x0f, 0x49, 0x19, 0xc2, 0x00, 0xd0, 0x0f, 0x49, 0x78, 0x83, 0x0f, 0x49,
+    0x31, 0xc2, 0x01, 0x7f, 0x0f, 0x49, 0x48, 0xc9, 0xaf, 0x27, 0x0f, 0x49,
+    0x39, 0xc2, 0x00, 0xd0, 0x0f, 0x4a, 0x18, 0xc2, 0x01, 0x7f, 0x0f, 0x49,
+    0x81, 0x83, 0x0f, 0x49, 0xa0, 0xc2, 0x05, 0x1d, 0x0f, 0x49, 0x91, 0xc2,
+    0x19, 0x2c, 0x0f, 0x49, 0xd9, 0xc2, 0x00, 0xd0, 0x0f, 0x49, 0xe8, 0xc2,
+    0x0f, 0x9b, 0x0f, 0x49, 0x99, 0xc2, 0x00, 0xd0, 0x0f, 0x49, 0xf9, 0xc2,
+    0x01, 0x53, 0x0f, 0x4a, 0x10, 0x83, 0x0f, 0x49, 0xd1, 0xc2, 0x00, 0x51,
+    0x0f, 0x4a, 0x00, 0xc2, 0x02, 0xa0, 0x0f, 0x4a, 0x91, 0xc4, 0x02, 0xde,
+    0x0f, 0x4a, 0x98, 0xc3, 0x09, 0x9e, 0x0f, 0x4a, 0xa1, 0xc3, 0x0d, 0x14,
+    0x0f, 0x4a, 0xa8, 0xc2, 0x22, 0xcc, 0x0f, 0x4a, 0xb1, 0xc4, 0x18, 0x10,
+    0x0f, 0x4a, 0xb8, 0xc7, 0xc0, 0xeb, 0x0f, 0xbb, 0x61, 0xc4, 0xe4, 0xab,
+    0x0f, 0xbb, 0x58, 0x02, 0x41, 0x9e, 0xac, 0xc6, 0xcf, 0x8f, 0x0f, 0xbb,
+    0x2b, 0x01, 0x9e, 0xb4, 0x48, 0xba, 0xf2, 0x41, 0x9e, 0xb8, 0xc3, 0x04,
+    0xa1, 0x0f, 0xb9, 0x01, 0xcb, 0x4c, 0x50, 0x0f, 0xb9, 0x28, 0xc2, 0x34,
+    0x63, 0x0f, 0xba, 0x61, 0xcb, 0x95, 0xa3, 0x0f, 0xba, 0x71, 0xc6, 0xd1,
+    0xed, 0x0f, 0xba, 0x80, 0xc5, 0xd9, 0x25, 0x0f, 0xbb, 0x0b, 0x01, 0x9e,
+    0xc7, 0xc4, 0x2d, 0xad, 0x0f, 0xbb, 0x00, 0xc4, 0xdf, 0x63, 0x0f, 0xba,
+    0x5b, 0x01, 0x9e, 0xcd, 0xc7, 0xc7, 0x0b, 0x0f, 0xba, 0xc0, 0xc4, 0xde,
+    0xcf, 0x0f, 0xbb, 0x19, 0xca, 0x9f, 0x68, 0x0f, 0xbb, 0x20, 0xc2, 0xe5,
+    0xfd, 0x0f, 0xba, 0x00, 0xc4, 0x91, 0x3d, 0x0f, 0xb9, 0x49, 0xc5, 0x87,
+    0xc4, 0x0f, 0xba, 0x40, 0xc5, 0xd5, 0xe7, 0x0f, 0xb9, 0x93, 0x01, 0x9e,
+    0xd3, 0xc5, 0xd9, 0x8e, 0x0f, 0xb9, 0xdb, 0x01, 0x9e, 0xdd, 0xc4, 0x08,
+    0x88, 0x0f, 0xbb, 0x68, 0xc2, 0xe5, 0xfd, 0x0f, 0xb8, 0xc8, 0xc5, 0xdb,
+    0x7d, 0x0f, 0xb8, 0x53, 0x01, 0x9e, 0xe3, 0xc5, 0xd7, 0xb8, 0x0f, 0xb8,
+    0xb2, 0x01, 0x9e, 0xed, 0x46, 0x5d, 0x2b, 0xc1, 0x9e, 0xf3, 0xc4, 0x4e,
+    0x2b, 0x0f, 0xb8, 0x68, 0x96, 0x0f, 0xb8, 0xa3, 0x01, 0x9e, 0xff, 0xc9,
+    0xad, 0xec, 0x0f, 0xb9, 0xc8, 0xcd, 0x7b, 0x49, 0x0f, 0xba, 0x91, 0xd3,
+    0x40, 0xc6, 0x0f, 0xba, 0xe2, 0x01, 0x9f, 0x05, 0x00, 0xc1, 0x9f, 0x0b,
+    0xc6, 0xd1, 0xab, 0x0f, 0xb8, 0x28, 0xc4, 0xe1, 0x17, 0x0f, 0xb9, 0xb3,
+    0x01, 0x9f, 0x1d, 0xc2, 0x01, 0xdf, 0x0f, 0xba, 0x29, 0xc5, 0xd9, 0x16,
+    0x0f, 0xbb, 0x50, 0x02, 0x41, 0x9f, 0x23, 0xc2, 0xe5, 0xfd, 0x0f, 0xb8,
+    0xe8, 0xc8, 0xb7, 0x42, 0x0f, 0xba, 0xb1, 0xc2, 0x00, 0x33, 0x0f, 0xbb,
+    0x70, 0xc4, 0xb4, 0xbe, 0x0f, 0xbb, 0x91, 0xc5, 0xd5, 0x60, 0x0f, 0xbb,
+    0x98, 0x22, 0xc1, 0x9f, 0x2b, 0x21, 0xc1, 0x9f, 0x53, 0x20, 0xc1, 0x9f,
+    0x84, 0x1f, 0xc1, 0x9f, 0xaf, 0x1e, 0xc1, 0x9f, 0xda, 0x1d, 0xc1, 0xa0,
+    0x05, 0x23, 0xc1, 0xa0, 0x29, 0x24, 0xc1, 0xa0, 0x54, 0x25, 0xc1, 0xa0,
+    0x7c, 0x26, 0x41, 0xa0, 0xa4, 0x1d, 0xc1, 0xa0, 0xd2, 0x1e, 0xc1, 0xa1,
+    0x0c, 0x1f, 0xc1, 0xa1, 0x3a, 0x20, 0xc1, 0xa1, 0x65, 0x21, 0xc1, 0xa1,
+    0x90, 0x22, 0xc1, 0xa1, 0xb8, 0x23, 0xc1, 0xa1, 0xe0, 0x24, 0xc1, 0xa2,
+    0x08, 0x25, 0xc1, 0xa2, 0x30, 0x26, 0x41, 0xa2, 0x58, 0x1d, 0xc1, 0xa2,
+    0x80, 0x1e, 0xc1, 0xa2, 0xb1, 0x1f, 0xc1, 0xa2, 0xdf, 0x20, 0xc1, 0xa3,
+    0x0a, 0x21, 0xc1, 0xa3, 0x32, 0x22, 0xc1, 0xa3, 0x5a, 0x23, 0xc1, 0xa3,
+    0x82, 0x24, 0xc1, 0xa3, 0xad, 0x25, 0xc1, 0xa3, 0xd5, 0x26, 0x41, 0xa4,
+    0x00, 0x1d, 0xc1, 0xa4, 0x2e, 0x1e, 0xc1, 0xa4, 0x59, 0x1f, 0xc1, 0xa4,
+    0x81, 0x20, 0xc1, 0xa4, 0xac, 0x21, 0xc1, 0xa4, 0xd7, 0x22, 0xc1, 0xa4,
+    0xff, 0x23, 0xc1, 0xa5, 0x2a, 0x24, 0xc1, 0xa5, 0x58, 0x25, 0xc1, 0xa5,
+    0x83, 0x26, 0x41, 0xa5, 0xb1, 0x1d, 0xc1, 0xa5, 0xdb, 0x1e, 0xc1, 0xa6,
+    0x03, 0x1f, 0xc1, 0xa6, 0x2b, 0x20, 0xc1, 0xa6, 0x53, 0x21, 0xc1, 0xa6,
+    0x7b, 0x22, 0xc1, 0xa6, 0xa3, 0x23, 0xc1, 0xa6, 0xd1, 0x24, 0xc1, 0xa6,
+    0xf9, 0x25, 0xc1, 0xa7, 0x21, 0x26, 0x41, 0xa7, 0x49, 0x1d, 0xc1, 0xa7,
+    0x69, 0x1e, 0xc1, 0xa7, 0x8d, 0x1f, 0xc1, 0xa7, 0xb5, 0xc2, 0xe6, 0x4a,
+    0x0a, 0x32, 0x30, 0xcf, 0x62, 0xe2, 0x01, 0x11, 0x99, 0xd2, 0x4e, 0x77,
+    0x01, 0x4a, 0x00, 0xd3, 0x44, 0x7c, 0x01, 0x0d, 0xb1, 0x4f, 0x01, 0x93,
+    0x41, 0xa7, 0xdd, 0xe0, 0x09, 0x07, 0x0f, 0xa8, 0x20, 0xc8, 0x52, 0x09,
+    0x01, 0x4d, 0x21, 0xc8, 0x4e, 0x9b, 0x01, 0x4c, 0xf0, 0xc9, 0x18, 0x66,
+    0x01, 0x10, 0xb8, 0xc2, 0x00, 0xd0, 0x08, 0xba, 0x21, 0x83, 0x08, 0xba,
+    0x18, 0xc2, 0x00, 0xd0, 0x08, 0xba, 0x11, 0x83, 0x08, 0xba, 0x08, 0xc2,
+    0x01, 0x5d, 0x08, 0xb8, 0xd1, 0xc2, 0x01, 0x30, 0x08, 0xb8, 0xb1, 0xc2,
+    0x01, 0x6f, 0x08, 0xb8, 0x28, 0xc6, 0x00, 0x41, 0x08, 0xb9, 0xe9, 0xcc,
+    0x82, 0x65, 0x08, 0xb9, 0xe0, 0x00, 0x41, 0xa7, 0xfb, 0xc4, 0x02, 0xb9,
+    0x01, 0x1a, 0xf1, 0xc8, 0x52, 0x09, 0x01, 0x1a, 0xc0, 0xc9, 0x52, 0x08,
+    0x01, 0x1b, 0xc0, 0xcb, 0x95, 0xf0, 0x01, 0x1b, 0x91, 0x45, 0x9a, 0x3d,
+    0xc1, 0xa8, 0x3f, 0xc8, 0xba, 0x22, 0x01, 0x1a, 0xe8, 0x00, 0xc1, 0xa8,
+    0x51, 0xca, 0x6c, 0xe2, 0x01, 0x1a, 0xb0, 0x00, 0xc1, 0xa8, 0x63, 0x43,
+    0x33, 0x60, 0x41, 0xa8, 0x75, 0xc9, 0xae, 0x22, 0x01, 0x1b, 0x69, 0xcc,
+    0x88, 0x89, 0x01, 0x1b, 0x18, 0xc9, 0x20, 0xa8, 0x01, 0x1b, 0x29, 0x42,
+    0x00, 0x15, 0xc1, 0xa8, 0x81, 0xc8, 0x52, 0x09, 0x01, 0x1a, 0xe1, 0xc9,
+    0x02, 0xfe, 0x01, 0x1a, 0x49, 0xc3, 0xba, 0x27, 0x01, 0x19, 0xf0, 0x46,
+    0x00, 0xe2, 0xc1, 0xa8, 0x8d, 0xd9, 0x1f, 0xae, 0x01, 0x12, 0x30, 0x87,
+    0x08, 0x59, 0xa9, 0xc2, 0x00, 0x4e, 0x08, 0x59, 0x48, 0xc3, 0x04, 0x65,
+    0x08, 0x59, 0xa1, 0x0a, 0xc1, 0xa8, 0x9c, 0x87, 0x08, 0x59, 0x78, 0x87,
+    0x08, 0x59, 0x59, 0xc2, 0x0c, 0x43, 0x08, 0x59, 0x50, 0xc2, 0x02, 0x6f,
+    0x08, 0x59, 0x39, 0xc2, 0x0c, 0x43, 0x08, 0x59, 0x31, 0x87, 0x08, 0x59,
+    0x29, 0x09, 0x41, 0xa8, 0xa6, 0xc2, 0x01, 0x7f, 0x08, 0x58, 0xe1, 0x87,
+    0x08, 0x58, 0xd8, 0xc2, 0x01, 0x7f, 0x08, 0x58, 0xd1, 0x87, 0x08, 0x58,
+    0xc9, 0xc2, 0x00, 0xac, 0x08, 0x58, 0xe8, 0xc2, 0x01, 0x7f, 0x08, 0x58,
+    0xb1, 0xc2, 0x09, 0x3b, 0x08, 0x58, 0xa9, 0x87, 0x08, 0x58, 0xa0, 0xc2,
+    0x00, 0x5f, 0x08, 0x58, 0x99, 0x87, 0x08, 0x58, 0x89, 0xc2, 0x0c, 0x43,
+    0x08, 0x58, 0x90, 0x97, 0x08, 0x58, 0x78, 0x8b, 0x08, 0x58, 0x68, 0x91,
+    0x08, 0x58, 0x58, 0x87, 0x08, 0x58, 0x48, 0x87, 0x08, 0x58, 0x33, 0x01,
+    0xa8, 0xb6, 0x83, 0x08, 0x58, 0x0b, 0x01, 0xa8, 0xba, 0x90, 0x08, 0x58,
+    0x21, 0x91, 0x08, 0x58, 0x10, 0x87, 0x08, 0x59, 0x01, 0xc2, 0x01, 0x7f,
+    0x08, 0x59, 0x08, 0x87, 0x08, 0x59, 0x81, 0xc2, 0x01, 0x7f, 0x08, 0x59,
+    0x90, 0x00, 0x41, 0xa8, 0xc2, 0x0a, 0xc1, 0xa8, 0xce, 0xc2, 0x00, 0xc4,
+    0x08, 0x08, 0x83, 0x01, 0xa8, 0xe0, 0x19, 0x41, 0xa8, 0xe6, 0x0b, 0xc1,
+    0xa8, 0xf6, 0x11, 0x41, 0xa9, 0x08, 0xc2, 0x22, 0xcc, 0x08, 0x08, 0x63,
+    0x01, 0xa9, 0x1a, 0xc4, 0x18, 0x10, 0x08, 0x08, 0x6a, 0x01, 0xa9, 0x27,
+    0x00, 0xc1, 0xa9, 0x34, 0x9b, 0x08, 0x08, 0xba, 0x01, 0xa9, 0x40, 0x00,
+    0xc1, 0xa9, 0x46, 0xc2, 0x0d, 0x10, 0x08, 0x08, 0xc2, 0x01, 0xa9, 0x52,
+    0xc9, 0xb3, 0x20, 0x08, 0x09, 0xb9, 0x08, 0xc1, 0xa9, 0x58, 0xce, 0x71,
+    0x22, 0x08, 0x09, 0xc9, 0xcd, 0x7d, 0xb9, 0x08, 0x09, 0xd0, 0xc4, 0x02,
+    0x6d, 0x08, 0x08, 0x01, 0xc3, 0x02, 0xa3, 0x08, 0x08, 0x08, 0x45, 0x00,
+    0x2d, 0xc1, 0xa9, 0x64, 0x44, 0x00, 0x4a, 0x41, 0xa9, 0xa4, 0xc2, 0x02,
+    0xae, 0x01, 0x2b, 0xcb, 0x01, 0xa9, 0xbc, 0xc4, 0x00, 0x49, 0x01, 0x2b,
+    0xc3, 0x01, 0xa9, 0xc2, 0x42, 0x00, 0x58, 0xc1, 0xa9, 0xc8, 0xc5, 0x00,
+    0x2c, 0x01, 0x2b, 0xd1, 0xc8, 0x00, 0x5f, 0x01, 0x28, 0x1b, 0x01, 0xa9,
+    0xd7, 0x4f, 0x61, 0x5c, 0xc1, 0xa9, 0xdd, 0x4c, 0x52, 0xbb, 0xc1, 0xa9,
+    0xe9, 0xca, 0x01, 0x68, 0x01, 0x28, 0x08, 0x45, 0x00, 0x5a, 0xc1, 0xa9,
+    0xf5, 0x43, 0x11, 0x19, 0x41, 0xaa, 0x10, 0x4b, 0x99, 0xb8, 0xc1, 0xaa,
+    0x28, 0x4b, 0x8e, 0x76, 0xc1, 0xaa, 0x3a, 0x4a, 0x11, 0x39, 0xc1, 0xaa,
+    0x4c, 0x4a, 0x5c, 0x42, 0x41, 0xaa, 0x5e, 0x4b, 0x99, 0xb8, 0xc1, 0xaa,
+    0x70, 0x4b, 0x8e, 0x76, 0xc1, 0xaa, 0x82, 0x4a, 0x5c, 0x42, 0xc1, 0xaa,
+    0x94, 0x4a, 0x11, 0x39, 0x41, 0xaa, 0xac, 0x4f, 0x66, 0xc0, 0xc1, 0xaa,
+    0xc4, 0xdc, 0x12, 0xc5, 0x01, 0x2a, 0x31, 0xdc, 0x13, 0xc1, 0x01, 0x2a,
+    0x21, 0x4f, 0x12, 0xca, 0x41, 0xaa, 0xd6, 0xd8, 0x25, 0xa3, 0x01, 0x1d,
+    0xb0, 0xc8, 0x1e, 0x3f, 0x01, 0x19, 0x09, 0xcc, 0x85, 0x71, 0x01, 0x5e,
+    0x59, 0xd0, 0x1d, 0xec, 0x01, 0x72, 0xd9, 0xd1, 0x1a, 0x4a, 0x01, 0x72,
+    0xe0, 0x05, 0xc1, 0xaa, 0xe8, 0xcc, 0x88, 0x65, 0x01, 0x71, 0x28, 0x05,
+    0xc1, 0xaa, 0xf4, 0xcc, 0x88, 0x65, 0x01, 0x71, 0x20, 0xd0, 0x5d, 0x52,
+    0x01, 0x4e, 0x91, 0xcf, 0x66, 0x66, 0x01, 0x4e, 0x88, 0xca, 0xa7, 0xec,
+    0x0f, 0xaa, 0x79, 0xca, 0x9e, 0x78, 0x0f, 0xcb, 0x18, 0xc5, 0xdb, 0xd7,
+    0x0f, 0xa6, 0x88, 0x97, 0x01, 0x8d, 0x00, 0x89, 0x01, 0x89, 0x5b, 0x01,
+    0xab, 0x00, 0x90, 0x01, 0x89, 0x78, 0x8a, 0x01, 0x8d, 0xc8, 0x90, 0x01,
+    0x89, 0x61, 0x97, 0x01, 0x8d, 0x19, 0x8a, 0x01, 0x8d, 0xc1, 0x99, 0x01,
+    0x8d, 0xe0, 0x99, 0x01, 0x8d, 0xe8, 0x8b, 0x01, 0x8d, 0x10, 0x8a, 0x01,
+    0x88, 0x99, 0x8b, 0x01, 0x8d, 0x09, 0x9b, 0x01, 0x8d, 0xd0, 0x8a, 0x01,
+    0x88, 0xa0, 0x8a, 0x01, 0x88, 0xa8, 0x8b, 0x01, 0x88, 0xf3, 0x01, 0xab,
+    0x04, 0x97, 0x01, 0x89, 0x03, 0x01, 0xab, 0x0a, 0x90, 0x01, 0x89, 0x13,
+    0x01, 0xab, 0x10, 0x8f, 0x01, 0x8d, 0x81, 0x8a, 0x01, 0x8d, 0xf8, 0x97,
+    0x01, 0x89, 0x09, 0xcf, 0x33, 0xad, 0x01, 0x89, 0x71, 0x91, 0x01, 0x8d,
+    0x31, 0x10, 0xc1, 0xab, 0x18, 0x8f, 0x01, 0x8d, 0x89, 0x87, 0x01, 0x8d,
+    0xf0, 0x8a, 0x01, 0x88, 0xe9, 0x8b, 0x01, 0x88, 0xf9, 0x90, 0x01, 0x89,
+    0x1b, 0x01, 0xab, 0x20, 0x94, 0x01, 0x89, 0x31, 0x87, 0x01, 0x8d, 0x20,
+    0x97, 0x01, 0x89, 0x49, 0x8a, 0x01, 0x89, 0x69, 0x94, 0x01, 0x8d, 0x41,
+    0xc2, 0x1b, 0x88, 0x01, 0x8d, 0x53, 0x01, 0xab, 0x28, 0x8f, 0x01, 0x8d,
+    0x60, 0xc2, 0x1b, 0x88, 0x01, 0x8d, 0x58, 0xa1, 0x0f, 0xd8, 0x43, 0x01,
+    0xab, 0x2c, 0x9f, 0x0f, 0xd8, 0x13, 0x01, 0xab, 0x37, 0xa2, 0x0f, 0xd8,
+    0x83, 0x01, 0xab, 0x50, 0xa0, 0x0f, 0xd8, 0x23, 0x01, 0xab, 0x54, 0xa3,
+    0x0f, 0xd8, 0xf8, 0xa2, 0x0f, 0xd8, 0x9b, 0x01, 0xab, 0x65, 0xa1, 0x0f,
+    0xd8, 0x5b, 0x01, 0xab, 0x69, 0xa3, 0x0f, 0xd9, 0x10, 0xa2, 0x0f, 0xd8,
+    0x8b, 0x01, 0xab, 0x74, 0xa0, 0x0f, 0xd8, 0x2b, 0x01, 0xab, 0x78, 0xa3,
+    0x0f, 0xd9, 0x01, 0xa1, 0x0f, 0xd8, 0x4a, 0x01, 0xab, 0x8a, 0xa3, 0x0f,
+    0xd9, 0x68, 0xa3, 0x0f, 0xd9, 0x31, 0xa2, 0x0f, 0xd8, 0xb2, 0x01, 0xab,
+    0x91, 0x05, 0xc1, 0xab, 0x95, 0x15, 0xc1, 0xab, 0xbc, 0x16, 0xc1, 0xab,
+    0xff, 0x06, 0xc1, 0xac, 0x1d, 0x14, 0xc1, 0xac, 0x30, 0x0e, 0xc1, 0xac,
+    0x42, 0xd6, 0x2c, 0xb2, 0x01, 0x3a, 0x99, 0x08, 0xc1, 0xac, 0x52, 0xc3,
+    0xe6, 0x74, 0x01, 0x38, 0x91, 0x0f, 0xc1, 0xac, 0x5a, 0x17, 0xc1, 0xac,
+    0x66, 0x0a, 0xc1, 0xac, 0x70, 0x12, 0xc1, 0xac, 0x7e, 0x43, 0x00, 0x5f,
+    0xc1, 0xac, 0x90, 0xc6, 0xca, 0x91, 0x01, 0x4e, 0x99, 0xc7, 0xc9, 0x3b,
+    0x01, 0x5e, 0x20, 0x4a, 0x14, 0xda, 0xc1, 0xac, 0x9c, 0x4f, 0x66, 0x93,
+    0x41, 0xac, 0xae, 0xca, 0x9f, 0xc2, 0x0f, 0xa5, 0xb9, 0xc9, 0xb3, 0x32,
+    0x0f, 0xa5, 0xb1, 0xcb, 0x99, 0x60, 0x0f, 0xa5, 0xa9, 0xc8, 0x77, 0x99,
+    0x0f, 0xa5, 0xa0, 0xc2, 0x00, 0x45, 0x0f, 0x9c, 0x43, 0x01, 0xac, 0xc2,
+    0x42, 0x00, 0x30, 0x41, 0xac, 0xc8, 0x0f, 0xc1, 0xac, 0xd8, 0xc3, 0x01,
+    0xad, 0x00, 0xda, 0xd2, 0x01, 0xac, 0xe7, 0x4a, 0xa2, 0x24, 0xc1, 0xac,
+    0xed, 0x4b, 0x95, 0x40, 0xc1, 0xac, 0xf9, 0x4a, 0x51, 0x89, 0xc1, 0xad,
+    0x05, 0x06, 0x41, 0xad, 0x29, 0x42, 0x00, 0xb0, 0xc1, 0xad, 0x43, 0xc4,
+    0xde, 0xcb, 0x00, 0xda, 0xf0, 0xc4, 0x26, 0x78, 0x00, 0xda, 0xc9, 0xc5,
+    0x06, 0xdb, 0x00, 0xda, 0xc1, 0x15, 0xc1, 0xad, 0x4f, 0x08, 0xc1, 0xad,
+    0x5b, 0x16, 0xc1, 0xad, 0x67, 0xc3, 0x05, 0x14, 0x00, 0xda, 0x89, 0xc4,
+    0x15, 0xe7, 0x00, 0xda, 0x80, 0x03, 0xc1, 0xad, 0x73, 0xc9, 0xa9, 0xfc,
+    0x00, 0xda, 0x51, 0xc8, 0xbe, 0x12, 0x00, 0xda, 0x49, 0x07, 0xc1, 0xad,
+    0x8e, 0x16, 0xc1, 0xad, 0x9a, 0x0d, 0xc1, 0xad, 0xa7, 0xc2, 0x00, 0xd0,
+    0x00, 0xd9, 0x99, 0xc2, 0x0d, 0xf6, 0x00, 0xd9, 0x93, 0x01, 0xad, 0xb4,
+    0xc2, 0x01, 0x4a, 0x00, 0xd9, 0x79, 0xc2, 0x00, 0xdb, 0x00, 0xd9, 0x73,
+    0x01, 0xad, 0xba, 0xc2, 0x00, 0x39, 0x00, 0xd9, 0x6b, 0x01, 0xad, 0xc3,
+    0xc2, 0x19, 0x2c, 0x00, 0xd9, 0x61, 0xc2, 0x01, 0xc3, 0x00, 0xd9, 0x59,
+    0xc2, 0x01, 0x5d, 0x00, 0xd9, 0x4b, 0x01, 0xad, 0xcc, 0xc2, 0x00, 0xb0,
+    0x00, 0xd9, 0x3b, 0x01, 0xad, 0xd2, 0x10, 0xc1, 0xad, 0xd8, 0xc2, 0x0e,
+    0x9a, 0x00, 0xd9, 0x23, 0x01, 0xad, 0xeb, 0xc2, 0x25, 0x3b, 0x00, 0xd8,
+    0xd3, 0x01, 0xad, 0xf1, 0xc2, 0x00, 0x64, 0x00, 0xd8, 0xc3, 0x01, 0xad,
+    0xf7, 0xc2, 0x01, 0x30, 0x00, 0xd8, 0xab, 0x01, 0xad, 0xfd, 0xc5, 0xde,
+    0x0c, 0x00, 0xd8, 0x8b, 0x01, 0xae, 0x03, 0xc5, 0xdb, 0x5f, 0x00, 0xd8,
+    0x4b, 0x01, 0xae, 0x09, 0xc5, 0xd7, 0xbd, 0x00, 0xd8, 0x3a, 0x01, 0xae,
+    0x0f, 0xc5, 0xd8, 0xbc, 0x00, 0xda, 0x13, 0x01, 0xae, 0x15, 0x16, 0xc1,
+    0xae, 0x1b, 0xc8, 0xb5, 0xaa, 0x00, 0xd9, 0xe3, 0x01, 0xae, 0x2a, 0xc7,
+    0xc4, 0x79, 0x00, 0xd9, 0xd3, 0x01, 0xae, 0x30, 0xc4, 0xc5, 0x6e, 0x00,
+    0xd9, 0xc3, 0x01, 0xae, 0x36, 0xc3, 0x96, 0x9c, 0x00, 0xd9, 0xb2, 0x01,
+    0xae, 0x3c, 0xc7, 0xc3, 0x8b, 0x00, 0xd9, 0xa1, 0xc5, 0xd4, 0x75, 0x00,
+    0xd8, 0x21, 0xc6, 0xcf, 0x59, 0x00, 0xd8, 0x19, 0xc5, 0xde, 0x48, 0x00,
+    0xd8, 0x11, 0x44, 0xdf, 0x3f, 0x41, 0xae, 0x42, 0x44, 0x08, 0xcb, 0xc1,
+    0xae, 0x4e, 0x43, 0x01, 0xc8, 0xc1, 0xae, 0x5a, 0xc8, 0xaf, 0x82, 0x0b,
+    0x57, 0x90, 0x8b, 0x0b, 0x57, 0x69, 0x87, 0x0b, 0x57, 0x63, 0x01, 0xae,
+    0x66, 0x97, 0x0b, 0x57, 0x53, 0x01, 0xae, 0x70, 0x91, 0x0b, 0x57, 0x43,
+    0x01, 0xae, 0x76, 0x83, 0x0b, 0x57, 0x39, 0xc2, 0x01, 0x4a, 0x0b, 0x56,
+    0xdb, 0x01, 0xae, 0x7a, 0xc2, 0x00, 0xb0, 0x0b, 0x57, 0x29, 0x1b, 0xc1,
+    0xae, 0x80, 0xc2, 0x5d, 0xb3, 0x0b, 0x57, 0x19, 0xc2, 0x01, 0x5d, 0x0b,
+    0x57, 0x11, 0xc2, 0x00, 0xf1, 0x0b, 0x57, 0x09, 0xc2, 0x00, 0x89, 0x0b,
+    0x56, 0xf9, 0x06, 0xc1, 0xae, 0x8c, 0x09, 0xc1, 0xae, 0x96, 0xc2, 0x01,
+    0x6c, 0x0b, 0x56, 0xe1, 0xc4, 0xdf, 0xdf, 0x0b, 0x56, 0xd1, 0xc2, 0x00,
+    0x81, 0x0b, 0x56, 0xc9, 0x0d, 0xc1, 0xae, 0xa2, 0xc3, 0x00, 0x50, 0x0b,
+    0x56, 0xa1, 0xc2, 0x00, 0x87, 0x0b, 0x56, 0x99, 0xc2, 0x00, 0x40, 0x0b,
+    0x56, 0x90, 0x45, 0xd6, 0x6e, 0xc1, 0xae, 0xac, 0x83, 0x05, 0x35, 0x59,
+    0x07, 0xc1, 0xae, 0xd0, 0x17, 0xc1, 0xae, 0xda, 0x8b, 0x05, 0x36, 0xe8,
+    0x83, 0x05, 0x35, 0x09, 0x97, 0x05, 0x35, 0x19, 0xc3, 0x17, 0x29, 0x05,
+    0x35, 0xd1, 0x07, 0xc1, 0xae, 0xe4, 0x91, 0x05, 0x36, 0xfb, 0x01, 0xae,
+    0xf2, 0x8b, 0x05, 0x37, 0x29, 0xc2, 0x00, 0xb0, 0x05, 0x37, 0x48, 0x07,
+    0xc1, 0xae, 0xfe, 0x0b, 0xc1, 0xaf, 0x0c, 0x97, 0x05, 0x36, 0x61, 0xc2,
+    0x10, 0x11, 0x05, 0x36, 0x88, 0x03, 0xc1, 0xaf, 0x16, 0x8b, 0x05, 0x37,
+    0x21, 0x07, 0x41, 0xaf, 0x1e, 0xc2, 0x16, 0x5a, 0x05, 0x35, 0x41, 0xc3,
+    0x4f, 0x43, 0x05, 0x35, 0x89, 0x0c, 0xc1, 0xaf, 0x26, 0x97, 0x05, 0x35,
+    0xeb, 0x01, 0xaf, 0x38, 0xc3, 0x01, 0xe2, 0x05, 0x36, 0x19, 0x16, 0xc1,
+    0xaf, 0x3e, 0x8b, 0x05, 0x36, 0x79, 0x09, 0xc1, 0xaf, 0x4a, 0x83, 0x05,
+    0x36, 0xd8, 0x83, 0x05, 0x35, 0x51, 0xc4, 0xe2, 0x9f, 0x05, 0x35, 0x71,
+    0x97, 0x05, 0x36, 0x69, 0x8b, 0x05, 0x36, 0xe1, 0xc2, 0x7f, 0xc0, 0x05,
+    0x36, 0xf0, 0x07, 0xc1, 0xaf, 0x5a, 0x97, 0x05, 0x35, 0xa9, 0x8b, 0x05,
+    0x36, 0x71, 0x04, 0xc1, 0xaf, 0x64, 0x83, 0x05, 0x37, 0x19, 0x91, 0x05,
+    0x37, 0x30, 0xc2, 0x5d, 0xa1, 0x05, 0x35, 0xa1, 0x0a, 0xc1, 0xaf, 0x70,
+    0x8b, 0x05, 0x35, 0xb9, 0xc3, 0xd7, 0xe2, 0x05, 0x35, 0xc9, 0xc4, 0xbf,
+    0xf1, 0x05, 0x37, 0x60, 0xc2, 0x7f, 0xc0, 0x05, 0x35, 0xf9, 0xc2, 0x92,
+    0xb5, 0x05, 0x36, 0x09, 0x83, 0x05, 0x36, 0x10, 0xc2, 0x0f, 0xe1, 0x05,
+    0x36, 0x49, 0x83, 0x05, 0x36, 0xd0, 0xc2, 0x02, 0xe0, 0x05, 0x36, 0x59,
+    0x97, 0x05, 0x36, 0xc1, 0xc2, 0x00, 0x7a, 0x05, 0x36, 0xc9, 0xc5, 0xd8,
+    0xe9, 0x05, 0x37, 0x68, 0x4c, 0x85, 0x4d, 0xc1, 0xaf, 0x84, 0xc2, 0x01,
+    0xc3, 0x05, 0x37, 0xa8, 0xe0, 0x06, 0x87, 0x01, 0x3d, 0x58, 0xcb, 0x96,
+    0x74, 0x0f, 0xac, 0x11, 0xda, 0x1c, 0xee, 0x0f, 0xa8, 0xc8, 0xc4, 0x40,
+    0x89, 0x00, 0x00, 0x41, 0x5a, 0x1a, 0x30, 0x41, 0xaf, 0x90, 0x4c, 0x8a,
+    0xc9, 0xc1, 0xaf, 0x9c, 0xc9, 0xad, 0xc8, 0x00, 0xdf, 0x30, 0xc7, 0xc6,
+    0xc5, 0x00, 0xdf, 0x99, 0xc5, 0xc8, 0x5d, 0x00, 0xdf, 0x90, 0x8a, 0x00,
+    0xdf, 0x89, 0xc2, 0x00, 0x75, 0x00, 0xdf, 0x80, 0x97, 0x00, 0xdf, 0x73,
+    0x01, 0xaf, 0xac, 0x45, 0xc6, 0xd3, 0xc1, 0xaf, 0xb2, 0x91, 0x00, 0xdf,
+    0x61, 0x8b, 0x00, 0xdf, 0x51, 0x87, 0x00, 0xdf, 0x3b, 0x01, 0xaf, 0xba,
+    0xc8, 0xbf, 0x0a, 0x00, 0xdf, 0x40, 0x97, 0x00, 0xdf, 0x29, 0x8b, 0x00,
+    0xdf, 0x21, 0x0f, 0xc1, 0xaf, 0xbe, 0x10, 0xc1, 0xaf, 0xcb, 0xc2, 0x00,
+    0x64, 0x00, 0xdf, 0x09, 0x15, 0xc1, 0xaf, 0xe7, 0xc2, 0x00, 0xdb, 0x00,
+    0xde, 0xf1, 0xc2, 0x19, 0x2c, 0x00, 0xde, 0xd9, 0xc2, 0x00, 0x39, 0x00,
+    0xde, 0x91, 0xc2, 0x0e, 0x9a, 0x00, 0xde, 0x89, 0xc2, 0x25, 0x3b, 0x00,
+    0xde, 0x81, 0xc2, 0x01, 0x30, 0x00, 0xde, 0x71, 0xc2, 0x00, 0xb0, 0x00,
+    0xde, 0x3b, 0x01, 0xaf, 0xf7, 0xc2, 0x01, 0x4a, 0x00, 0xde, 0x59, 0xc7,
+    0xc6, 0xd3, 0x00, 0xde, 0x31, 0xc2, 0x01, 0x5d, 0x00, 0xde, 0x29, 0xc2,
+    0x00, 0xd0, 0x00, 0xde, 0x11, 0x83, 0x00, 0xde, 0x00, 0x0d, 0xc1, 0xaf,
+    0xfd, 0xc2, 0x00, 0xd0, 0x00, 0x4d, 0xc9, 0x15, 0xc1, 0xb0, 0x0a, 0xc2,
+    0x00, 0xdb, 0x00, 0x4d, 0x91, 0x14, 0xc1, 0xb0, 0x1a, 0x1b, 0xc1, 0xb0,
+    0x2d, 0xc2, 0x01, 0xc3, 0x00, 0x4d, 0x71, 0x04, 0xc1, 0xb0, 0x37, 0x12,
+    0xc1, 0xb0, 0x41, 0x10, 0xc1, 0xb0, 0x4b, 0x06, 0xc1, 0xb0, 0x61, 0x16,
+    0xc1, 0xb0, 0x6f, 0x0c, 0xc1, 0xb0, 0x7d, 0x05, 0xc1, 0xb0, 0x87, 0x09,
+    0xc1, 0xb0, 0x91, 0x83, 0x00, 0x4c, 0x2b, 0x01, 0xb0, 0x9b, 0x91, 0x00,
+    0x4c, 0x99, 0x8b, 0x00, 0x4c, 0x3b, 0x01, 0xb0, 0xa7, 0x97, 0x00, 0x4c,
+    0x4b, 0x01, 0xb0, 0xab, 0x18, 0xc1, 0xb0, 0xaf, 0x87, 0x00, 0x4c, 0x78,
+    0x44, 0x00, 0xbb, 0xc1, 0xb0, 0xbb, 0xca, 0xa0, 0x26, 0x00, 0x4f, 0xf0,
+    0x03, 0xc1, 0xb0, 0xd1, 0x91, 0x00, 0x4e, 0x59, 0x87, 0x00, 0x4e, 0x39,
+    0x48, 0xb2, 0x2d, 0xc1, 0xb0, 0xdd, 0x97, 0x00, 0x4e, 0x0b, 0x01, 0xb0,
+    0xeb, 0x8b, 0x00, 0x4d, 0xfa, 0x01, 0xb0, 0xef, 0xcd, 0x73, 0x0d, 0x00,
+    0x4e, 0xb9, 0xc3, 0x7c, 0x50, 0x00, 0x4c, 0x01, 0xd0, 0x50, 0xcf, 0x00,
+    0x4f, 0xe8, 0xc4, 0x15, 0xe7, 0x00, 0x4f, 0x31, 0xc3, 0x05, 0x14, 0x00,
+    0x4f, 0x39, 0x16, 0xc1, 0xb0, 0xf3, 0x08, 0xc1, 0xb0, 0xff, 0x15, 0xc1,
+    0xb1, 0x0b, 0xc5, 0x06, 0xdb, 0x00, 0x4f, 0x71, 0xc4, 0x26, 0x78, 0x00,
+    0x4f, 0x78, 0xc4, 0x01, 0xc3, 0x00, 0x4f, 0x91, 0xc4, 0x00, 0xba, 0x00,
+    0x4f, 0x98, 0x4a, 0x78, 0x64, 0xc1, 0xb1, 0x17, 0xd3, 0x44, 0x8f, 0x00,
+    0x4f, 0xc8, 0xe0, 0x06, 0x07, 0x01, 0x5a, 0xf0, 0xc2, 0x10, 0x11, 0x00,
+    0xd0, 0xd9, 0x91, 0x00, 0xd0, 0xd1, 0x87, 0x00, 0xd0, 0xc9, 0x97, 0x00,
+    0xd0, 0xc1, 0x8b, 0x00, 0xd0, 0xb8, 0xc2, 0x00, 0xd0, 0x00, 0xd0, 0xb1,
+    0x83, 0x00, 0xd0, 0xa9, 0xc2, 0x0d, 0xf6, 0x00, 0xd0, 0xa1, 0xc2, 0x02,
+    0x41, 0x00, 0xd0, 0x99, 0xc2, 0x00, 0xdb, 0x00, 0xd0, 0x91, 0xc2, 0x00,
+    0x39, 0x00, 0xd0, 0x89, 0xc2, 0x19, 0x2c, 0x00, 0xd0, 0x81, 0x10, 0xc1,
+    0xb1, 0x2a, 0xc2, 0x25, 0x3b, 0x00, 0xd0, 0x69, 0xc2, 0x00, 0x64, 0x00,
+    0xd0, 0x61, 0xc2, 0x0e, 0x9a, 0x00, 0xd0, 0x49, 0xc2, 0x01, 0x6f, 0x00,
+    0xd0, 0x41, 0x0f, 0xc1, 0xb1, 0x3c, 0xc2, 0x01, 0x5d, 0x00, 0xd0, 0x29,
+    0xc2, 0x00, 0xb0, 0x00, 0xd0, 0x21, 0xc2, 0x01, 0x30, 0x00, 0xd0, 0x09,
+    0xc2, 0x02, 0x2b, 0x00, 0xd0, 0x00, 0x83, 0x00, 0xba, 0x41, 0xc2, 0x01,
+    0x30, 0x00, 0xba, 0x28, 0x45, 0xda, 0xf1, 0xc1, 0xb1, 0x46, 0xc5, 0xd5,
+    0x4c, 0x01, 0x40, 0x00, 0xc6, 0x57, 0xec, 0x08, 0x83, 0xf9, 0xc3, 0x05,
+    0x14, 0x08, 0x82, 0x93, 0x01, 0xb1, 0x7b, 0xc4, 0x26, 0x78, 0x08, 0x82,
+    0xd3, 0x01, 0xb1, 0x7f, 0xc5, 0x06, 0xdb, 0x08, 0x82, 0xcb, 0x01, 0xb1,
+    0x85, 0x15, 0xc1, 0xb1, 0x89, 0x08, 0xc1, 0xb1, 0x9b, 0x16, 0x41, 0xb1,
+    0xa3, 0x91, 0x08, 0x80, 0x8b, 0x01, 0xb1, 0xb1, 0x0e, 0xc1, 0xb1, 0xb7,
+    0xc2, 0x00, 0xd0, 0x08, 0x81, 0x99, 0xc2, 0x00, 0x39, 0x08, 0x81, 0x69,
+    0xc2, 0x19, 0x2c, 0x08, 0x81, 0x61, 0xc2, 0x01, 0xc3, 0x08, 0x81, 0x59,
+    0x04, 0xc1, 0xb1, 0xc1, 0x12, 0xc1, 0xb1, 0xcb, 0x10, 0xc1, 0xb1, 0xd5,
+    0x06, 0xc1, 0xb1, 0xeb, 0x16, 0xc1, 0xb1, 0xf9, 0x0c, 0xc1, 0xb2, 0x07,
+    0x05, 0xc1, 0xb2, 0x11, 0x09, 0xc1, 0xb2, 0x1b, 0x0d, 0xc1, 0xb2, 0x25,
+    0x83, 0x08, 0x80, 0x2b, 0x01, 0xb2, 0x2f, 0x87, 0x08, 0x80, 0x79, 0x18,
+    0xc1, 0xb2, 0x3b, 0x97, 0x08, 0x80, 0x4b, 0x01, 0xb2, 0x45, 0x8b, 0x08,
+    0x80, 0x3b, 0x01, 0xb2, 0x49, 0x15, 0x41, 0xb2, 0x4d, 0x4a, 0x6f, 0xc8,
+    0xc1, 0xb2, 0x5d, 0xc5, 0x1e, 0x96, 0x08, 0x82, 0x30, 0xd0, 0x5c, 0x82,
+    0x08, 0x83, 0x81, 0xcb, 0x93, 0xf6, 0x08, 0x80, 0x21, 0xcb, 0x8f, 0xe1,
+    0x08, 0x80, 0x19, 0xcb, 0x1e, 0x89, 0x08, 0x80, 0x01, 0xc8, 0x14, 0x38,
+    0x08, 0x80, 0x09, 0xc7, 0x40, 0xe5, 0x08, 0x80, 0x10, 0x45, 0x09, 0x98,
+    0xc1, 0xb2, 0x86, 0xcb, 0x97, 0xf5, 0x08, 0x82, 0x41, 0xc4, 0x19, 0x53,
+    0x08, 0x82, 0x38, 0x0e, 0xc1, 0xb2, 0xaa, 0xcc, 0x80, 0xa9, 0x08, 0x82,
+    0x61, 0x42, 0x00, 0x58, 0x41, 0xb2, 0xb6, 0x42, 0x0f, 0x7b, 0xc1, 0xb2,
+    0xc0, 0x4a, 0x9a, 0xb8, 0x41, 0xb2, 0xcc, 0xc6, 0x2e, 0x82, 0x0e, 0x86,
+    0xc9, 0xc6, 0xca, 0x9d, 0x0e, 0x86, 0xc0, 0x00, 0x41, 0xb2, 0xd8, 0x00,
+    0xc1, 0xb2, 0xe4, 0xc2, 0x01, 0x6f, 0x0e, 0x80, 0x82, 0x01, 0xb2, 0xf0,
+    0xc5, 0x57, 0xbd, 0x0e, 0x84, 0x49, 0xc6, 0xad, 0x17, 0x0e, 0x82, 0x51,
+    0xc6, 0xcb, 0xf9, 0x0e, 0x81, 0xd2, 0x01, 0xb2, 0xf4, 0x44, 0xe1, 0x8b,
+    0xc1, 0xb2, 0xfa, 0xc6, 0xcf, 0x11, 0x0e, 0x80, 0x60, 0x43, 0x0f, 0xf8,
+    0xc1, 0xb3, 0x02, 0xc5, 0xd5, 0x88, 0x0e, 0x80, 0x38, 0x46, 0xd0, 0xc1,
+    0xc1, 0xb3, 0x0e, 0x42, 0x0f, 0x7b, 0x41, 0xb3, 0x38, 0x11, 0xc1, 0xb3,
+    0x42, 0xc2, 0x01, 0x0f, 0x0e, 0x84, 0x29, 0x45, 0xdd, 0xa3, 0x41, 0xb3,
+    0x54, 0x45, 0xd7, 0x81, 0xc1, 0xb3, 0x60, 0x44, 0xcf, 0x3b, 0xc1, 0xb3,
+    0x6c, 0x42, 0x00, 0x4e, 0xc1, 0xb3, 0x76, 0x43, 0x07, 0xc5, 0x41, 0xb3,
+    0x82, 0x46, 0xd2, 0x7d, 0xc1, 0xb3, 0x8c, 0xca, 0x9b, 0x9e, 0x0e, 0x81,
+    0x40, 0xc4, 0x1a, 0x73, 0x0e, 0x87, 0x41, 0xc5, 0xd6, 0x00, 0x0e, 0x83,
+    0xf3, 0x01, 0xb3, 0x98, 0xca, 0x9a, 0x68, 0x0e, 0x82, 0x20, 0xc6, 0xcb,
+    0xa5, 0x0e, 0x87, 0x13, 0x01, 0xb3, 0x9e, 0xc7, 0xc0, 0xf9, 0x0e, 0x86,
+    0xf2, 0x01, 0xb3, 0xa2, 0xc4, 0x77, 0x35, 0x0e, 0x83, 0x48, 0xc3, 0x05,
+    0xa9, 0x0e, 0x83, 0x33, 0x01, 0xb3, 0xa6, 0x10, 0x41, 0xb3, 0xac, 0xca,
+    0x9e, 0xd2, 0x0e, 0x87, 0x39, 0x09, 0xc1, 0xb3, 0xb8, 0x03, 0xc1, 0xb3,
+    0xc7, 0x45, 0x1a, 0x57, 0xc1, 0xb3, 0xd3, 0xc3, 0x1f, 0x1d, 0x0e, 0x84,
+    0x32, 0x01, 0xb3, 0xe9, 0x44, 0x1a, 0x13, 0xc1, 0xb3, 0xef, 0x42, 0x00,
+    0xbd, 0x41, 0xb4, 0x07, 0x11, 0xc1, 0xb4, 0x13, 0xc4, 0x7a, 0x04, 0x0e,
+    0x82, 0x80, 0xd4, 0x39, 0x30, 0x0e, 0x86, 0x61, 0xd6, 0x2e, 0x80, 0x0e,
+    0x86, 0x59, 0x10, 0xc1, 0xb4, 0x22, 0x48, 0x1a, 0x02, 0xc1, 0xb4, 0x2e,
+    0x4f, 0x67, 0x47, 0xc1, 0xb4, 0x3a, 0x4a, 0xa3, 0x6e, 0xc1, 0xb4, 0x46,
+    0xc8, 0x9c, 0xe0, 0x0e, 0x81, 0xa2, 0x01, 0xb4, 0x62, 0xc8, 0xba, 0x3a,
+    0x0e, 0x85, 0x81, 0xca, 0xa2, 0xec, 0x0e, 0x85, 0x79, 0xcb, 0x92, 0x33,
+    0x0e, 0x85, 0x70, 0xc6, 0xce, 0xd5, 0x0e, 0x86, 0x51, 0xc6, 0xd1, 0x63,
+    0x0e, 0x86, 0x49, 0xc5, 0xd6, 0x9b, 0x0e, 0x86, 0x40, 0xc3, 0x63, 0x2b,
+    0x0e, 0x83, 0x39, 0xc8, 0x9c, 0xe0, 0x0e, 0x81, 0xd8, 0x8b, 0x0e, 0x82,
+    0xb1, 0xc2, 0x00, 0x45, 0x0e, 0x80, 0xc0, 0x08, 0xc1, 0xb4, 0x68, 0xc7,
+    0xc2, 0x9d, 0x0e, 0x84, 0xc0, 0xd5, 0x32, 0xc0, 0x0e, 0x85, 0x61, 0x43,
+    0x01, 0x55, 0x41, 0xb4, 0x74, 0xd4, 0x3d, 0xcc, 0x0e, 0x85, 0xb1, 0xc7,
+    0xc3, 0x45, 0x0e, 0x83, 0xd8, 0xcd, 0x79, 0x75, 0x0e, 0x83, 0xa1, 0xcb,
+    0x94, 0x17, 0x0e, 0x83, 0x00, 0x12, 0xc1, 0xb4, 0x80, 0xcb, 0x94, 0xbc,
+    0x0e, 0x85, 0x89, 0xcd, 0x7a, 0xfb, 0x0e, 0x85, 0x51, 0x16, 0xc1, 0xb4,
+    0x8c, 0x45, 0xd9, 0xed, 0xc1, 0xb4, 0x98, 0xce, 0x6d, 0x5c, 0x0e, 0x85,
+    0x20, 0x0b, 0xc1, 0xb4, 0xa4, 0x45, 0xaa, 0x6b, 0x41, 0xb4, 0xb4, 0xc6,
+    0xd0, 0xf1, 0x0e, 0x84, 0x41, 0xc5, 0x13, 0x43, 0x0e, 0x81, 0x89, 0xc4,
+    0xae, 0x15, 0x0e, 0x80, 0x78, 0x07, 0xc1, 0xb4, 0xca, 0xc3, 0x02, 0x44,
+    0x0e, 0x80, 0xa0, 0x45, 0x7c, 0xbe, 0xc1, 0xb4, 0xd9, 0xc3, 0xbe, 0x04,
+    0x0e, 0x81, 0x70, 0xc3, 0x63, 0x2b, 0x0e, 0x83, 0xa9, 0xc8, 0x9c, 0xe0,
+    0x0e, 0x81, 0x60, 0x00, 0xc1, 0xb4, 0xef, 0xca, 0x9c, 0xde, 0x0e, 0x81,
+    0x00, 0xc3, 0x63, 0x2b, 0x0e, 0x82, 0x39, 0xc8, 0x9c, 0xe0, 0x0e, 0x80,
+    0xa8, 0x45, 0xb9, 0x3c, 0xc1, 0xb5, 0x01, 0x0e, 0x41, 0xb5, 0x1a, 0x42,
+    0x06, 0x4e, 0xc1, 0xb5, 0x24, 0xc5, 0xd8, 0x85, 0x0e, 0x80, 0xf0, 0xc3,
+    0x63, 0x2b, 0x0e, 0x82, 0xc9, 0xc8, 0x9c, 0xe0, 0x0e, 0x81, 0x30, 0xc6,
+    0xd0, 0x0d, 0x0e, 0x81, 0xc3, 0x01, 0xb5, 0x33, 0x43, 0x13, 0x4f, 0xc1,
+    0xb5, 0x39, 0xc9, 0x94, 0x92, 0x0e, 0x80, 0x10, 0x00, 0xc1, 0xb5, 0x43,
+    0xca, 0x9c, 0xde, 0x0e, 0x81, 0x08, 0xc2, 0x0d, 0x10, 0x08, 0xe3, 0x48,
+    0xc2, 0x0d, 0x10, 0x08, 0xe3, 0x40, 0xc3, 0x45, 0x6b, 0x08, 0xe3, 0x39,
+    0xc2, 0x00, 0x5f, 0x08, 0xe2, 0xf0, 0xc3, 0x0d, 0x0f, 0x08, 0xe3, 0x31,
+    0xc2, 0x00, 0x33, 0x08, 0xe2, 0xe8, 0xc4, 0x0d, 0x0e, 0x08, 0xe3, 0x29,
+    0xc3, 0x02, 0xdf, 0x08, 0xe2, 0xe0, 0xc4, 0x18, 0x12, 0x08, 0xe3, 0x21,
+    0x91, 0x08, 0xe2, 0xd8, 0xc4, 0x18, 0x10, 0x08, 0xe2, 0xb9, 0xc2, 0x22,
+    0xcc, 0x08, 0xe2, 0xb0, 0xc3, 0x0d, 0x14, 0x08, 0xe2, 0xa9, 0xc3, 0x09,
+    0x9e, 0x08, 0xe2, 0xa0, 0xc4, 0x02, 0xde, 0x08, 0xe2, 0x99, 0xc2, 0x02,
+    0xa0, 0x08, 0xe2, 0x90, 0x94, 0x08, 0xe1, 0xa8, 0x8e, 0x08, 0xe0, 0x41,
+    0x94, 0x08, 0xe0, 0x32, 0x01, 0xb5, 0x55, 0xc2, 0x00, 0xd0, 0x08, 0xe0,
+    0xd9, 0x83, 0x08, 0xe0, 0xd0, 0xc2, 0x00, 0xd0, 0x08, 0xe0, 0xc9, 0x83,
+    0x08, 0xe0, 0xc0, 0x46, 0x01, 0x92, 0xc1, 0xb5, 0x59, 0x04, 0xc1, 0xb5,
+    0x65, 0xd5, 0x37, 0x6d, 0x01, 0x2e, 0xf9, 0xc6, 0xcc, 0x1d, 0x0f, 0xac,
+    0x69, 0x12, 0xc1, 0xb5, 0x71, 0xcc, 0x85, 0x7d, 0x0f, 0xac, 0x59, 0xe0,
+    0x05, 0xe7, 0x01, 0x49, 0xf8, 0x46, 0x01, 0x92, 0xc1, 0xb5, 0x7d, 0xcf,
+    0x68, 0x37, 0x01, 0x3e, 0x99, 0x15, 0xc1, 0xb5, 0x89, 0xda, 0x1a, 0x7e,
+    0x01, 0x3a, 0x79, 0xc6, 0xcd, 0x8b, 0x01, 0x38, 0x71, 0xd5, 0x37, 0x6d,
+    0x01, 0x2e, 0xf1, 0x4f, 0x60, 0x6c, 0x41, 0xb5, 0x95, 0xdb, 0x14, 0xf4,
+    0x0f, 0xdb, 0x79, 0x45, 0x02, 0xde, 0x41, 0xb5, 0xa1, 0xc6, 0x02, 0xd1,
+    0x01, 0x2f, 0x09, 0xd4, 0x39, 0x94, 0x01, 0x2e, 0xd9, 0xc5, 0x06, 0xe2,
+    0x01, 0x2c, 0x21, 0xcc, 0x01, 0xdb, 0x0f, 0xdc, 0x78, 0xcd, 0x15, 0x02,
+    0x01, 0x2c, 0x11, 0xcc, 0x06, 0xdb, 0x01, 0x2c, 0x08, 0xc6, 0xcd, 0x4f,
+    0x0f, 0xd5, 0x59, 0xd0, 0x54, 0xdc, 0x0f, 0xa8, 0x28, 0xc9, 0x33, 0xad,
+    0x01, 0x72, 0x40, 0xce, 0x6f, 0xfc, 0x01, 0x3f, 0xf9, 0xcc, 0x82, 0x35,
+    0x01, 0x3f, 0xcb, 0x01, 0xb5, 0xad, 0xc5, 0x01, 0xa2, 0x01, 0x3f, 0xb2,
+    0x01, 0xb5, 0xb3, 0xcc, 0x82, 0x35, 0x01, 0x3f, 0xc3, 0x01, 0xb5, 0xb9,
+    0xc5, 0x01, 0xa2, 0x01, 0x3f, 0xab, 0x01, 0xb5, 0xbf, 0xce, 0x6f, 0xfc,
+    0x01, 0x59, 0x98, 0x46, 0x00, 0x2c, 0xc1, 0xb5, 0xc5, 0xc4, 0x32, 0xbc,
+    0x01, 0x3e, 0xf0, 0xe0, 0x00, 0x47, 0x01, 0x57, 0x30, 0x45, 0x00, 0x8c,
+    0xc1, 0xb5, 0xd1, 0xd7, 0x2a, 0x99, 0x01, 0x52, 0xc8, 0xcf, 0x64, 0xd1,
+    0x01, 0x52, 0xe1, 0xcb, 0x98, 0x42, 0x01, 0x52, 0xd1, 0x42, 0x00, 0x58,
+    0xc1, 0xb5, 0xe3, 0xc8, 0x52, 0x09, 0x01, 0x52, 0xf8, 0x10, 0xc1, 0xb5,
+    0xef, 0x14, 0x41, 0xb5, 0xf9, 0x43, 0x01, 0xd0, 0xc1, 0xb6, 0x05, 0xd5,
+    0x36, 0xb0, 0x0f, 0xab, 0xd8, 0x45, 0x00, 0x2d, 0xc1, 0xb6, 0x2c, 0xd6,
+    0x29, 0x86, 0x01, 0x70, 0x60, 0xc9, 0x9b, 0x77, 0x01, 0x3e, 0xa9, 0x43,
+    0x02, 0x6f, 0x41, 0xb6, 0x5a, 0xd5, 0x32, 0x18, 0x01, 0x3e, 0x29, 0x07,
+    0xc1, 0xb6, 0x66, 0xcd, 0x25, 0xae, 0x00, 0x02, 0xdb, 0x01, 0xb6, 0x72,
+    0x0b, 0xc1, 0xb6, 0x76, 0xcc, 0x6f, 0xb7, 0x0f, 0xaf, 0x41, 0xd3, 0x1f,
+    0xcd, 0x01, 0x70, 0x10, 0xcb, 0x90, 0x86, 0x01, 0x36, 0xe1, 0xcc, 0x00,
+    0x33, 0x00, 0x03, 0xdb, 0x01, 0xb6, 0x82, 0xc6, 0xb7, 0x3b, 0x01, 0x18,
+    0x41, 0xcd, 0x69, 0x65, 0x01, 0x80, 0x60, 0x0a, 0xc1, 0xb6, 0x86, 0xc3,
+    0x00, 0x3a, 0x01, 0x15, 0x19, 0x14, 0xc1, 0xb6, 0x98, 0xd5, 0x08, 0x89,
+    0x01, 0x80, 0xa0, 0x0b, 0xc1, 0xb6, 0xa4, 0xc4, 0x20, 0xe6, 0x01, 0x18,
+    0x50, 0xc7, 0xc9, 0xb2, 0x01, 0x1d, 0xc1, 0xcd, 0x77, 0xfc, 0x01, 0x71,
+    0x00, 0x00, 0x41, 0xb6, 0xb0, 0x45, 0x00, 0x5a, 0xc1, 0xb6, 0xc2, 0xd9,
+    0x1f, 0xc7, 0x01, 0x70, 0x20, 0xcb, 0x93, 0xd5, 0x0f, 0xac, 0x71, 0xcb,
+    0x8a, 0x0a, 0x01, 0x4e, 0xc1, 0x45, 0x01, 0xfd, 0x41, 0xb6, 0xda, 0x45,
+    0x04, 0x90, 0xc1, 0xb6, 0xf6, 0x44, 0x01, 0x5e, 0x41, 0xb7, 0x02, 0xc6,
+    0xcf, 0x35, 0x0f, 0xb6, 0x29, 0xd5, 0x2c, 0xf5, 0x01, 0x70, 0xe0, 0xca,
+    0x01, 0xfd, 0x01, 0x0f, 0x33, 0x01, 0xb7, 0x0e, 0xc9, 0xb0, 0x6b, 0x01,
+    0x0c, 0xe0, 0x42, 0x00, 0x2c, 0xc1, 0xb7, 0x14, 0x42, 0x02, 0xa0, 0xc1,
+    0xb7, 0x20, 0xd5, 0x37, 0xc1, 0x0f, 0xc5, 0x10, 0x00, 0xc1, 0xb7, 0x2c,
+    0xc5, 0x14, 0xa5, 0x01, 0x48, 0xc8, 0xc5, 0xca, 0xa4, 0x0f, 0xb3, 0x61,
+    0xd7, 0x2a, 0x6b, 0x0f, 0xc5, 0x30, 0xcb, 0x82, 0xba, 0x01, 0x0f, 0x01,
+    0x46, 0x00, 0x59, 0x41, 0xb7, 0x49, 0x42, 0x00, 0xe3, 0xc1, 0xb7, 0x58,
+    0xcf, 0x5b, 0xc3, 0x0f, 0xc2, 0x80, 0x03, 0xc1, 0xb7, 0x64, 0x45, 0x11,
+    0x3a, 0x41, 0xb7, 0x70, 0x45, 0x04, 0x90, 0xc1, 0xb7, 0x7c, 0xd8, 0x23,
+    0xf3, 0x0f, 0xc5, 0x01, 0xdf, 0x0c, 0x65, 0x0f, 0xc5, 0x40, 0xd0, 0x56,
+    0xda, 0x0f, 0xc1, 0xa1, 0xe0, 0x01, 0xe7, 0x0f, 0xc5, 0x50, 0xd0, 0x5a,
+    0x22, 0x0f, 0xa8, 0x69, 0xcd, 0x0b, 0x91, 0x01, 0x19, 0x49, 0xd4, 0x3b,
+    0x9c, 0x01, 0x4f, 0xe1, 0xdb, 0x18, 0x39, 0x00, 0x05, 0x58, 0xdc, 0x14,
+    0x4d, 0x01, 0x3d, 0x51, 0xdb, 0x15, 0x60, 0x01, 0x49, 0xc8, 0xc7, 0x00,
+    0xfa, 0x01, 0x03, 0x31, 0xc8, 0xb6, 0xca, 0x01, 0x01, 0x69, 0xc9, 0xb3,
+    0x9e, 0x01, 0x01, 0x51, 0xc4, 0x01, 0xc3, 0x01, 0x00, 0x70, 0xd6, 0x2d,
+    0x4c, 0x00, 0x2c, 0x71, 0xc4, 0xb9, 0x3c, 0x0f, 0xc8, 0xd9, 0xcb, 0x8f,
+    0xf7, 0x00, 0x7e, 0xb2, 0x01, 0xb7, 0x88, 0xcc, 0x07, 0xc7, 0x01, 0x13,
+    0xb1, 0x43, 0x00, 0xe2, 0xc1, 0xb7, 0x8e, 0xd0, 0x5a, 0x92, 0x01, 0x53,
+    0xeb, 0x01, 0xb7, 0x9a, 0xcb, 0x1a, 0x1a, 0x01, 0x54, 0x28, 0xcf, 0x09,
+    0xf8, 0x01, 0x4b, 0xb1, 0x44, 0x00, 0x58, 0xc1, 0xb7, 0xa0, 0x15, 0xc1,
+    0xb7, 0xa6, 0x44, 0x07, 0xc7, 0x41, 0xb7, 0xb2, 0xd8, 0x24, 0x3b, 0x01,
+    0x54, 0x39, 0xcf, 0x62, 0xb5, 0x01, 0x54, 0x48, 0xc2, 0x0e, 0x9a, 0x00,
+    0xe2, 0x79, 0xc2, 0x02, 0x1c, 0x00, 0xe0, 0xc9, 0x83, 0x00, 0xe0, 0x60,
+    0x16, 0xc1, 0xb7, 0xb8, 0x15, 0xc1, 0xb7, 0xc2, 0xc2, 0x00, 0xd0, 0x00,
+    0xe0, 0x59, 0x83, 0x00, 0xe0, 0x50, 0xc2, 0x00, 0xd0, 0x00, 0xe1, 0x09,
+    0x83, 0x00, 0xe1, 0x00, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0xf1, 0x83, 0x00,
+    0xe0, 0xe8, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0xb1, 0x83, 0x00, 0xe0, 0xa8,
+    0xc2, 0x00, 0xdb, 0x00, 0xe0, 0xa1, 0x83, 0x00, 0xe0, 0x98, 0xc2, 0x00,
+    0xdb, 0x00, 0xe0, 0x91, 0x83, 0x00, 0xe0, 0x88, 0xc2, 0x00, 0xd0, 0x00,
+    0xe0, 0x81, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0x79, 0x83, 0x00, 0xe0, 0x70,
+    0x83, 0x00, 0xe0, 0x69, 0xc2, 0x19, 0x2c, 0x00, 0xe0, 0x49, 0xc2, 0x01,
+    0x30, 0x00, 0xe0, 0x28, 0xc2, 0x00, 0xd0, 0x00, 0xe0, 0x39, 0x83, 0x00,
+    0xe0, 0x30, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0x21, 0x83, 0x00, 0xe0, 0x18,
+    0xc2, 0x00, 0xd0, 0x00, 0xe0, 0x11, 0xc2, 0x00, 0xdb, 0x00, 0xe0, 0x09,
+    0x83, 0x00, 0xe0, 0x00, 0xc4, 0x18, 0x10, 0x00, 0xe2, 0x39, 0xc2, 0x22,
+    0xcc, 0x00, 0xe2, 0x30, 0xc3, 0x0d, 0x14, 0x00, 0xe2, 0x29, 0xc3, 0x09,
+    0x9e, 0x00, 0xe2, 0x20, 0xc4, 0x02, 0xde, 0x00, 0xe2, 0x19, 0xc2, 0x02,
+    0xa0, 0x00, 0xe2, 0x10, 0xc5, 0xda, 0x79, 0x00, 0xe1, 0xfb, 0x01, 0xb7,
+    0xcc, 0xc5, 0x4e, 0x18, 0x00, 0xe1, 0xd8, 0xc5, 0x33, 0x5d, 0x00, 0xe1,
+    0xb9, 0xc3, 0x00, 0xea, 0x00, 0xe1, 0xb0, 0xc2, 0x00, 0x39, 0x00, 0xe1,
+    0x29, 0xc2, 0x19, 0x2c, 0x00, 0xe1, 0x20, 0xc3, 0x01, 0x95, 0x00, 0xe1,
+    0xa8, 0xc6, 0xd3, 0xbb, 0x00, 0xe1, 0xa0, 0x97, 0x00, 0xe1, 0x58, 0x91,
+    0x00, 0xe1, 0x48, 0x15, 0xc1, 0xb7, 0xd2, 0xcc, 0x1a, 0x8c, 0x0f, 0xbc,
+    0x71, 0x14, 0xc1, 0xb7, 0xe4, 0x44, 0x00, 0x49, 0xc1, 0xb7, 0xf0, 0xcc,
+    0x07, 0xbb, 0x01, 0x3a, 0xc1, 0xca, 0xa7, 0xc4, 0x0f, 0xaf, 0xc1, 0x08,
+    0xc1, 0xb7, 0xf6, 0xcb, 0x58, 0xc7, 0x0f, 0xbd, 0x11, 0xd5, 0x34, 0x8e,
+    0x0f, 0xbd, 0xd9, 0x16, 0x41, 0xb8, 0x02, 0xc5, 0xd4, 0xe3, 0x0f, 0xaf,
+    0x92, 0x01, 0xb8, 0x0e, 0xc2, 0x00, 0xd0, 0x08, 0xfd, 0x81, 0x83, 0x05,
+    0x27, 0x60, 0x83, 0x05, 0x26, 0x89, 0xc2, 0x00, 0xd0, 0x05, 0x26, 0x90,
+    0x83, 0x05, 0x26, 0x99, 0xc2, 0x02, 0x1c, 0x05, 0x26, 0xe0, 0x83, 0x05,
+    0x26, 0xa1, 0xc2, 0x00, 0xd0, 0x05, 0x26, 0xa9, 0x15, 0xc1, 0xb8, 0x14,
+    0x44, 0x05, 0x14, 0x41, 0xb8, 0x1e, 0x83, 0x05, 0x26, 0xb1, 0xc2, 0x00,
+    0xd0, 0x05, 0x27, 0x68, 0x83, 0x05, 0x26, 0xb9, 0xc2, 0x00, 0xd0, 0x05,
+    0x26, 0xc0, 0x83, 0x05, 0x26, 0xd1, 0xc2, 0x00, 0xd0, 0x05, 0x26, 0xd8,
+    0x83, 0x05, 0x27, 0x01, 0xc2, 0x01, 0x30, 0x05, 0x27, 0x28, 0x83, 0x05,
+    0x27, 0x11, 0xc2, 0x00, 0xd0, 0x05, 0x27, 0x58, 0xc2, 0x00, 0xd0, 0x05,
+    0x27, 0x19, 0x83, 0x05, 0x27, 0x20, 0x83, 0x05, 0x27, 0x31, 0xc2, 0x00,
+    0xd0, 0x05, 0x27, 0x40, 0x87, 0x05, 0x27, 0x78, 0x97, 0x05, 0x27, 0x88,
+    0x87, 0x05, 0x27, 0xb8, 0x87, 0x05, 0x27, 0xa9, 0x8a, 0x05, 0x27, 0xb0,
+    0xc9, 0x1b, 0x0a, 0x01, 0x01, 0x41, 0xca, 0x33, 0xdc, 0x00, 0x00, 0x5b,
+    0x01, 0xb8, 0x2a, 0xc4, 0x1b, 0x05, 0x00, 0x00, 0x51, 0x4c, 0x87, 0x8d,
+    0x41, 0xb8, 0x30, 0x48, 0xba, 0xc2, 0xc1, 0xb8, 0x3c, 0x42, 0x01, 0x60,
+    0x41, 0xb8, 0x64, 0xc4, 0x26, 0x78, 0x00, 0xca, 0x79, 0xc5, 0x06, 0xdb,
+    0x00, 0xca, 0x71, 0x15, 0xc1, 0xb8, 0x76, 0x08, 0xc1, 0xb8, 0x82, 0x16,
+    0xc1, 0xb8, 0x8e, 0xc3, 0x05, 0x14, 0x00, 0xca, 0x39, 0xc4, 0x15, 0xe7,
+    0x00, 0xca, 0x30, 0x44, 0x00, 0xbb, 0xc1, 0xb8, 0x9a, 0x4c, 0x29, 0xba,
+    0xc1, 0xb8, 0xb2, 0x50, 0x5c, 0xf2, 0x41, 0xb8, 0xe0, 0x46, 0x00, 0xb9,
+    0xc1, 0xb8, 0xf2, 0xcf, 0x69, 0x72, 0x00, 0xc8, 0x00, 0x16, 0xc1, 0xb9,
+    0x0f, 0x09, 0xc1, 0xb9, 0x1f, 0xc2, 0x00, 0xd0, 0x00, 0xc8, 0xe1, 0x15,
+    0xc1, 0xb9, 0x2f, 0xc2, 0x01, 0x4a, 0x00, 0xc8, 0xc1, 0xc2, 0x00, 0xdb,
+    0x00, 0xc8, 0xb9, 0xc2, 0x00, 0x39, 0x00, 0xc8, 0xb1, 0xc2, 0x19, 0x2c,
+    0x00, 0xc8, 0xab, 0x01, 0xb9, 0x3f, 0xc2, 0x01, 0xc3, 0x00, 0xc8, 0xa1,
+    0x04, 0xc1, 0xb9, 0x43, 0x12, 0xc1, 0xb9, 0x4d, 0x10, 0xc1, 0xb9, 0x57,
+    0x06, 0xc1, 0xb9, 0x61, 0x0c, 0xc1, 0xb9, 0x6b, 0x05, 0xc1, 0xb9, 0x75,
+    0x0d, 0x41, 0xb9, 0x7f, 0x90, 0x08, 0x49, 0xc0, 0x9b, 0x08, 0x49, 0xb8,
+    0x90, 0x08, 0x49, 0xb0, 0x90, 0x08, 0x49, 0xa8, 0x96, 0x08, 0x49, 0xa0,
+    0x95, 0x08, 0x49, 0x70, 0x04, 0xc1, 0xb9, 0x89, 0x44, 0x0b, 0x0d, 0xc1,
+    0xb9, 0x95, 0x46, 0x76, 0x5f, 0xc1, 0xb9, 0xa1, 0xc9, 0x32, 0xb7, 0x01,
+    0x3e, 0xc9, 0xc7, 0xc4, 0x5d, 0x01, 0x3e, 0xc1, 0xc6, 0x02, 0xd1, 0x01,
+    0x2f, 0x79, 0x11, 0xc1, 0xb9, 0xad, 0x16, 0xc1, 0xb9, 0xb9, 0xd6, 0x2f,
+    0x72, 0x01, 0x50, 0xf1, 0x47, 0xc6, 0x9b, 0xc1, 0xb9, 0xc5, 0x47, 0xc1,
+    0x69, 0x41, 0xb9, 0xd1, 0xcc, 0x23, 0x9f, 0x01, 0x55, 0x68, 0x0e, 0xc1,
+    0xb9, 0xdd, 0x4f, 0x0b, 0x17, 0x41, 0xb9, 0xe9, 0x96, 0x01, 0x04, 0xe1,
+    0x95, 0x01, 0x04, 0xdb, 0x01, 0xb9, 0xf5, 0x92, 0x01, 0x04, 0xd1, 0x90,
+    0x01, 0x04, 0xc9, 0x8f, 0x01, 0x04, 0xc1, 0x8e, 0x01, 0x04, 0xb9, 0x8d,
+    0x01, 0x04, 0xb1, 0x8a, 0x01, 0x04, 0xa9, 0x9a, 0x01, 0x04, 0x99, 0x91,
+    0x01, 0x04, 0x91, 0x87, 0x01, 0x04, 0x89, 0x83, 0x01, 0x04, 0x81, 0x98,
+    0x00, 0xeb, 0x29, 0x97, 0x00, 0xeb, 0x21, 0x94, 0x00, 0xeb, 0x19, 0x8b,
+    0x00, 0xeb, 0x11, 0x8c, 0x01, 0x63, 0xe0, 0x4d, 0x37, 0xb4, 0xc1, 0xb9,
+    0xfb, 0xca, 0x9f, 0xe0, 0x00, 0x14, 0xbb, 0x01, 0xba, 0x7a, 0xce, 0x6b,
+    0xe2, 0x05, 0x3c, 0x78, 0x46, 0x00, 0x8b, 0x41, 0xba, 0x80, 0xcd, 0x7e,
+    0xf1, 0x00, 0x0e, 0x1b, 0x01, 0xba, 0x8c, 0x47, 0x10, 0x30, 0x41, 0xba,
+    0x92, 0xc2, 0x00, 0x74, 0x00, 0xe9, 0x29, 0xcd, 0x7c, 0xdc, 0x00, 0x0e,
+    0x10, 0xcc, 0x23, 0x3f, 0x00, 0x15, 0x08, 0x47, 0x80, 0x10, 0xc1, 0xba,
+    0x9e, 0xd1, 0x54, 0x97, 0x00, 0x15, 0x68, 0x46, 0x02, 0x0f, 0xc1, 0xba,
+    0xaa, 0x48, 0x19, 0x9b, 0x41, 0xbb, 0x60, 0x88, 0x05, 0x3f, 0xd9, 0x92,
+    0x05, 0x3f, 0xe0, 0xc9, 0x4f, 0x9d, 0x05, 0x3f, 0xe9, 0xc6, 0xcb, 0x3f,
+    0x05, 0x3f, 0xf0, 0x91, 0x00, 0x74, 0x09, 0x0a, 0x41, 0xbb, 0x6c, 0x44,
+    0x68, 0x00, 0xc1, 0xbb, 0x78, 0x91, 0x00, 0x74, 0xd9, 0x43, 0x60, 0xe8,
+    0x41, 0xbb, 0xa4, 0xc2, 0x0f, 0x7b, 0x00, 0x74, 0x39, 0xc2, 0x42, 0xcd,
+    0x00, 0x74, 0x69, 0x91, 0x00, 0x74, 0xc8, 0x42, 0x01, 0x7c, 0xc1, 0xbb,
+    0xb0, 0x49, 0xb1, 0xd3, 0x41, 0xbb, 0xbc, 0x91, 0x00, 0x74, 0xa9, 0x43,
+    0x60, 0xe8, 0x41, 0xbb, 0xc8, 0x08, 0xc1, 0xbb, 0xd4, 0xc3, 0x02, 0x45,
+    0x00, 0x74, 0xe9, 0xc4, 0xdf, 0x43, 0x00, 0x74, 0xf8, 0x42, 0x00, 0x48,
+    0x41, 0xbb, 0xe0, 0xc4, 0xdf, 0x43, 0x00, 0x75, 0x59, 0xc3, 0x02, 0x45,
+    0x00, 0x75, 0x70, 0x83, 0x00, 0x75, 0x91, 0x8f, 0x00, 0x75, 0x99, 0x9b,
+    0x00, 0x76, 0x19, 0x8b, 0x00, 0x76, 0x20, 0xc2, 0x00, 0xd1, 0x00, 0x75,
+    0x89, 0xc2, 0x00, 0x45, 0x00, 0x75, 0xd8, 0x8b, 0x00, 0x75, 0xa8, 0x9b,
+    0x00, 0x75, 0xb8, 0x97, 0x00, 0x75, 0xc8, 0x8b, 0x00, 0x76, 0x08, 0xc2,
+    0x01, 0xc8, 0x00, 0x75, 0xe1, 0xc3, 0x4d, 0xc3, 0x00, 0x75, 0xe8, 0xc2,
+    0x01, 0x23, 0x00, 0x76, 0x49, 0x8b, 0x00, 0x76, 0x50, 0xc2, 0x02, 0xa0,
+    0x00, 0x76, 0x91, 0xc4, 0x02, 0xde, 0x00, 0x76, 0x98, 0xc3, 0x09, 0x9e,
+    0x00, 0x76, 0xa1, 0xc3, 0x0d, 0x14, 0x00, 0x76, 0xa8, 0xc2, 0x22, 0xcc,
+    0x00, 0x76, 0xb1, 0xc4, 0x18, 0x10, 0x00, 0x76, 0xb8, 0x45, 0x01, 0x93,
+    0xc1, 0xbb, 0xec, 0xd1, 0x47, 0x70, 0x0f, 0xdc, 0xc8, 0x46, 0x02, 0xae,
+    0xc1, 0xbb, 0xf8, 0x5b, 0x18, 0xc0, 0x41, 0xbc, 0x0a, 0xc6, 0x0b, 0x09,
+    0x01, 0x3a, 0x91, 0xc6, 0x02, 0xd1, 0x0f, 0xa9, 0xf8, 0xe0, 0x03, 0x67,
+    0x01, 0x1d, 0x88, 0x45, 0x01, 0x93, 0xc1, 0xbc, 0x16, 0xd2, 0x43, 0x27,
+    0x0f, 0xdc, 0xc0, 0x5b, 0x16, 0xa4, 0xc1, 0xbc, 0x22, 0x46, 0x01, 0xc8,
+    0x41, 0xbc, 0x2e, 0xe0, 0x00, 0x27, 0x01, 0x1d, 0x80, 0x45, 0x00, 0x27,
+    0xc1, 0xbc, 0x40, 0x4d, 0x3d, 0x55, 0x41, 0xbc, 0x4c, 0xe0, 0x08, 0x67,
+    0x0f, 0xdb, 0x40, 0x0f, 0xc1, 0xbc, 0x52, 0xcc, 0x0d, 0x9e, 0x01, 0x2e,
+    0xd0, 0x44, 0x02, 0x9a, 0x41, 0xbc, 0x58, 0xcd, 0x3f, 0xe8, 0x0f, 0xdc,
+    0x19, 0xce, 0x08, 0x79, 0x0f, 0xdc, 0x28, 0x00, 0x41, 0xbc, 0x5e, 0xcc,
+    0x8a, 0x45, 0x01, 0x0f, 0x78, 0x45, 0x01, 0x95, 0xc1, 0xbc, 0x76, 0xc9,
+    0x61, 0x53, 0x01, 0x48, 0x50, 0xcd, 0x7e, 0x3b, 0x01, 0x0c, 0xf9, 0x4e,
+    0x6f, 0xa8, 0x41, 0xbc, 0x82, 0x00, 0x41, 0xbc, 0x8e, 0x44, 0x00, 0x49,
+    0xc1, 0xbc, 0xac, 0x45, 0x00, 0x2c, 0x41, 0xbc, 0xb6, 0xd0, 0x58, 0x62,
+    0x0f, 0xc2, 0x09, 0xc5, 0x01, 0xa2, 0x0f, 0xc2, 0x28, 0x00, 0x41, 0xbc,
+    0xc0, 0xca, 0xa8, 0x0a, 0x01, 0x0d, 0x40, 0xcc, 0x81, 0xed, 0x01, 0x4a,
+    0x89, 0xcd, 0x7e, 0xfe, 0x01, 0x4a, 0x68, 0xcd, 0x7e, 0xfe, 0x01, 0x4a,
+    0x79, 0xcc, 0x81, 0xed, 0x01, 0x4a, 0x60, 0xdc, 0x13, 0x6d, 0x01, 0x52,
+    0x51, 0x46, 0x00, 0xd4, 0xc1, 0xbc, 0xcc, 0x45, 0x00, 0x8c, 0x41, 0xbc,
+    0xd8, 0xc3, 0x7e, 0x1c, 0x08, 0x1c, 0x91, 0xc2, 0x00, 0x06, 0x08, 0x1c,
+    0xa8, 0xce, 0x64, 0xe1, 0x0f, 0xdc, 0xb9, 0xde, 0x0f, 0x04, 0x01, 0x3b,
+    0x18, 0x45, 0x00, 0x2d, 0xc1, 0xbc, 0xea, 0x50, 0x0f, 0x0a, 0xc1, 0xbc,
+    0xfc, 0xca, 0x0e, 0xbe, 0x0f, 0xbf, 0x80, 0x45, 0x01, 0xfd, 0xc1, 0xbd,
+    0x08, 0xdc, 0x14, 0xa1, 0x01, 0x3d, 0xe9, 0xdb, 0x15, 0x7b, 0x01, 0x3c,
+    0xa0, 0x03, 0xc1, 0xbd, 0x1a, 0x45, 0x1a, 0x38, 0xc1, 0xbd, 0x26, 0x0b,
+    0xc1, 0xbd, 0x32, 0xc6, 0xa8, 0x2a, 0x01, 0x3a, 0x41, 0xda, 0x19, 0x94,
+    0x0f, 0xb3, 0x88, 0x45, 0x20, 0x6c, 0xc1, 0xbd, 0x3e, 0x4e, 0x47, 0x15,
+    0x41, 0xbd, 0x4a, 0x03, 0xc1, 0xbd, 0x56, 0x42, 0x00, 0x27, 0xc1, 0xbd,
+    0x62, 0x43, 0x00, 0x4a, 0xc1, 0xbd, 0x6c, 0xd8, 0x21, 0x9b, 0x0f, 0xb3,
+    0x98, 0x49, 0x0a, 0xe6, 0xc1, 0xbd, 0x78, 0xdf, 0x03, 0xa8, 0x01, 0x3c,
+    0xf1, 0x4e, 0x22, 0x43, 0x41, 0xbd, 0x84, 0x44, 0x02, 0xc3, 0xc1, 0xbd,
+    0x90, 0xc7, 0xc0, 0x74, 0x01, 0x38, 0xc0, 0x49, 0x2c, 0x46, 0xc1, 0xbd,
+    0x9a, 0x51, 0x08, 0xa9, 0x41, 0xbd, 0xa0, 0x45, 0x3a, 0x0c, 0xc1, 0xbd,
+    0xac, 0x42, 0x01, 0x7f, 0xc1, 0xbd, 0xb2, 0xc5, 0x02, 0xd2, 0x01, 0x5a,
+    0xc2, 0x01, 0xbd, 0xbe, 0x46, 0x82, 0xba, 0xc1, 0xbd, 0xca, 0xcc, 0x30,
+    0xf2, 0x01, 0x3c, 0xb9, 0x11, 0x41, 0xbd, 0xd0, 0xdc, 0x12, 0x8d, 0x01,
+    0x3c, 0xe1, 0x44, 0x00, 0x2d, 0x41, 0xbd, 0xe2, 0xc9, 0x68, 0x55, 0x01,
+    0x3c, 0xb1, 0xcf, 0x65, 0x58, 0x01, 0x38, 0xb0, 0xc7, 0x0b, 0x00, 0x01,
+    0x39, 0x89, 0xd1, 0x36, 0x21, 0x0f, 0xb3, 0xa1, 0x51, 0x48, 0x5a, 0x41,
+    0xbd, 0xf1, 0xd2, 0x4e, 0x65, 0x01, 0x39, 0x71, 0xd0, 0x5a, 0xc2, 0x01,
+    0x38, 0xe1, 0xd4, 0x38, 0xb8, 0x01, 0x5a, 0xb0, 0xdb, 0x15, 0x2a, 0x01,
+    0x39, 0x21, 0x44, 0x0d, 0x14, 0x41, 0xbe, 0x00, 0xd1, 0x56, 0x62, 0x01,
+    0x37, 0xe0, 0xca, 0x95, 0xd0, 0x0f, 0xa4, 0xf9, 0x45, 0x00, 0x8c, 0xc1,
+    0xbe, 0x0c, 0xc5, 0x07, 0x73, 0x0f, 0xd7, 0xb0, 0xa0, 0x0d, 0x87, 0xd1,
+    0x9f, 0x0d, 0x87, 0xc9, 0x9e, 0x0d, 0x87, 0xc1, 0xa3, 0x0d, 0x87, 0xe9,
+    0xa2, 0x0d, 0x87, 0xe1, 0xa1, 0x0d, 0x87, 0xd8, 0xa4, 0x0d, 0x87, 0xb9,
+    0xa3, 0x0d, 0x87, 0xb1, 0xa2, 0x0d, 0x87, 0xa9, 0xa1, 0x0d, 0x87, 0xa1,
+    0xa0, 0x0d, 0x87, 0x99, 0x9f, 0x0d, 0x87, 0x91, 0x9e, 0x0d, 0x87, 0x88,
+    0xa1, 0x0d, 0x87, 0x81, 0xa0, 0x0d, 0x87, 0x79, 0x9f, 0x0d, 0x87, 0x71,
+    0x9e, 0x0d, 0x87, 0x68, 0xa3, 0x0d, 0x88, 0x39, 0xa2, 0x0d, 0x88, 0x31,
+    0xa1, 0x0d, 0x88, 0x29, 0xa0, 0x0d, 0x88, 0x21, 0x9f, 0x0d, 0x88, 0x19,
+    0x9e, 0x0d, 0x88, 0x10, 0xa1, 0x0d, 0x88, 0x09, 0xa0, 0x0d, 0x88, 0x01,
+    0x9f, 0x0d, 0x87, 0xf9, 0x9e, 0x0d, 0x87, 0xf0, 0x9e, 0x0d, 0x85, 0xd1,
+    0xa5, 0x0d, 0x86, 0x09, 0xa4, 0x0d, 0x86, 0x01, 0xa3, 0x0d, 0x85, 0xf9,
+    0xa2, 0x0d, 0x85, 0xf1, 0xa1, 0x0d, 0x85, 0xe9, 0xa0, 0x0d, 0x85, 0xe1,
+    0x9f, 0x0d, 0x85, 0xd8, 0xa4, 0x0d, 0x85, 0xc9, 0xa3, 0x0d, 0x85, 0xc1,
+    0xa2, 0x0d, 0x85, 0xb9, 0xa1, 0x0d, 0x85, 0xb1, 0xa0, 0x0d, 0x85, 0xa9,
+    0x9f, 0x0d, 0x85, 0xa1, 0x9e, 0x0d, 0x85, 0x98, 0xa0, 0x0d, 0x85, 0x91,
+    0x9f, 0x0d, 0x85, 0x89, 0x9e, 0x0d, 0x85, 0x80, 0xa4, 0x0d, 0x85, 0x79,
+    0xa3, 0x0d, 0x85, 0x71, 0xa2, 0x0d, 0x85, 0x69, 0xa1, 0x0d, 0x85, 0x61,
+    0xa0, 0x0d, 0x85, 0x59, 0x9f, 0x0d, 0x85, 0x51, 0x9e, 0x0d, 0x85, 0x48,
+    0x9e, 0x0d, 0x84, 0xf3, 0x01, 0xbe, 0x1e, 0xa6, 0x0d, 0x85, 0x31, 0xa5,
+    0x0d, 0x85, 0x29, 0xa4, 0x0d, 0x85, 0x21, 0xa3, 0x0d, 0x85, 0x19, 0xa2,
+    0x0d, 0x85, 0x11, 0xa1, 0x0d, 0x85, 0x09, 0xa0, 0x0d, 0x85, 0x01, 0x9f,
+    0x0d, 0x84, 0xf8, 0xa2, 0x0d, 0x84, 0xe9, 0xa1, 0x0d, 0x84, 0xe1, 0xa0,
+    0x0d, 0x84, 0xd9, 0x9f, 0x0d, 0x84, 0xd1, 0x9e, 0x0d, 0x84, 0xc8, 0xc2,
+    0x00, 0xe8, 0x0d, 0x84, 0xc1, 0xa3, 0x0d, 0x84, 0xb9, 0xa2, 0x0d, 0x84,
+    0xb1, 0xa1, 0x0d, 0x84, 0xa9, 0xa0, 0x0d, 0x84, 0xa1, 0x9f, 0x0d, 0x84,
+    0x99, 0x9e, 0x0d, 0x84, 0x90, 0xa0, 0x0d, 0x84, 0x89, 0x9f, 0x0d, 0x84,
+    0x81, 0x9e, 0x0d, 0x84, 0x78, 0xc2, 0x00, 0xac, 0x0d, 0x84, 0x71, 0xa4,
+    0x0d, 0x84, 0x69, 0xa3, 0x0d, 0x84, 0x61, 0xa2, 0x0d, 0x84, 0x59, 0xa1,
+    0x0d, 0x84, 0x51, 0xa0, 0x0d, 0x84, 0x49, 0x9f, 0x0d, 0x84, 0x41, 0x9e,
+    0x0d, 0x84, 0x38, 0xa6, 0x0d, 0x84, 0x31, 0xa5, 0x0d, 0x84, 0x29, 0xa4,
+    0x0d, 0x84, 0x21, 0xa3, 0x0d, 0x84, 0x19, 0xa2, 0x0d, 0x84, 0x11, 0xa1,
+    0x0d, 0x84, 0x09, 0xa0, 0x0d, 0x84, 0x01, 0x9f, 0x0d, 0x83, 0xf9, 0x9e,
+    0x0d, 0x83, 0xf0, 0x9f, 0x0d, 0x88, 0xf1, 0x9e, 0x0d, 0x88, 0xe8, 0xa0,
+    0x0d, 0x81, 0xd1, 0x9f, 0x0d, 0x81, 0xc9, 0x9e, 0x0d, 0x81, 0xc1, 0xc2,
+    0x06, 0x52, 0x0d, 0x81, 0xd8, 0xa3, 0x0d, 0x81, 0xb9, 0xa2, 0x0d, 0x81,
+    0xb1, 0xa1, 0x0d, 0x81, 0xa9, 0xa0, 0x0d, 0x81, 0xa1, 0x9f, 0x0d, 0x81,
+    0x99, 0x9e, 0x0d, 0x81, 0x90, 0xa4, 0x0d, 0x81, 0x89, 0xa3, 0x0d, 0x81,
+    0x81, 0xa2, 0x0d, 0x81, 0x79, 0xa1, 0x0d, 0x81, 0x71, 0xa0, 0x0d, 0x81,
+    0x69, 0x9f, 0x0d, 0x81, 0x61, 0x9e, 0x0d, 0x81, 0x58, 0xa5, 0x0d, 0x81,
+    0x51, 0xa4, 0x0d, 0x81, 0x49, 0xa3, 0x0d, 0x81, 0x41, 0xa2, 0x0d, 0x81,
+    0x39, 0xa1, 0x0d, 0x81, 0x31, 0xa0, 0x0d, 0x81, 0x29, 0x9f, 0x0d, 0x81,
+    0x21, 0x9e, 0x0d, 0x81, 0x18, 0xc2, 0x00, 0x3c, 0x0d, 0x81, 0x11, 0x9e,
+    0x0d, 0x80, 0xbb, 0x01, 0xbe, 0x26, 0xa6, 0x0d, 0x80, 0xf9, 0xa5, 0x0d,
+    0x80, 0xf1, 0xa4, 0x0d, 0x80, 0xe9, 0xa3, 0x0d, 0x80, 0xe1, 0xa2, 0x0d,
+    0x80, 0xd9, 0xa1, 0x0d, 0x80, 0xd1, 0xa0, 0x0d, 0x80, 0xc9, 0x9f, 0x0d,
+    0x80, 0xc0, 0xa1, 0x0d, 0x88, 0xc9, 0xa0, 0x0d, 0x88, 0xc1, 0x9f, 0x0d,
+    0x88, 0xb9, 0x9e, 0x0d, 0x88, 0xb1, 0xa2, 0x0d, 0x88, 0xd1, 0xa3, 0x0d,
+    0x88, 0xd9, 0xa4, 0x0d, 0x88, 0xe0, 0xa1, 0x0d, 0x88, 0xa9, 0xa0, 0x0d,
+    0x88, 0xa1, 0x9f, 0x0d, 0x88, 0x99, 0x9e, 0x0d, 0x88, 0x90, 0xa2, 0x0d,
+    0x88, 0x89, 0xa1, 0x0d, 0x88, 0x81, 0xa0, 0x0d, 0x88, 0x79, 0x9f, 0x0d,
+    0x88, 0x71, 0x9e, 0x0d, 0x88, 0x68, 0xa2, 0x0d, 0x88, 0x61, 0xa1, 0x0d,
+    0x88, 0x59, 0xa0, 0x0d, 0x88, 0x51, 0x9f, 0x0d, 0x88, 0x49, 0x9e, 0x0d,
+    0x88, 0x40, 0xc2, 0x42, 0xcd, 0x0d, 0x87, 0x11, 0xa2, 0x0d, 0x87, 0x09,
+    0xa1, 0x0d, 0x87, 0x01, 0xa0, 0x0d, 0x86, 0xf9, 0x9f, 0x0d, 0x86, 0xf1,
+    0x9e, 0x0d, 0x86, 0xe8, 0x9e, 0x0d, 0x87, 0x19, 0x9f, 0x0d, 0x87, 0x21,
+    0xa0, 0x0d, 0x87, 0x29, 0xa1, 0x0d, 0x87, 0x30, 0x9e, 0x0d, 0x87, 0x39,
+    0x9f, 0x0d, 0x87, 0x41, 0xa0, 0x0d, 0x87, 0x49, 0xa1, 0x0d, 0x87, 0x51,
+    0xa2, 0x0d, 0x87, 0x59, 0xa3, 0x0d, 0x87, 0x60, 0xa2, 0x0d, 0x86, 0xd9,
+    0xa1, 0x0d, 0x86, 0xd1, 0xa0, 0x0d, 0x86, 0xc9, 0x9f, 0x0d, 0x86, 0xc1,
+    0x9e, 0x0d, 0x86, 0xb9, 0xa3, 0x0d, 0x86, 0xe0, 0xc2, 0x01, 0xc3, 0x0d,
+    0x86, 0xb1, 0x9f, 0x0d, 0x86, 0xa9, 0x9e, 0x0d, 0x86, 0xa0, 0xa1, 0x0d,
+    0x86, 0x99, 0xa0, 0x0d, 0x86, 0x91, 0x9f, 0x0d, 0x86, 0x89, 0x9e, 0x0d,
+    0x86, 0x80, 0xa4, 0x0d, 0x86, 0x79, 0xa3, 0x0d, 0x86, 0x71, 0xa2, 0x0d,
+    0x86, 0x69, 0xa1, 0x0d, 0x86, 0x61, 0xa0, 0x0d, 0x86, 0x59, 0x9f, 0x0d,
+    0x86, 0x51, 0x9e, 0x0d, 0x86, 0x48, 0xa4, 0x0d, 0x86, 0x41, 0xa3, 0x0d,
+    0x86, 0x39, 0xa2, 0x0d, 0x86, 0x31, 0xa1, 0x0d, 0x86, 0x29, 0xa0, 0x0d,
+    0x86, 0x21, 0x9f, 0x0d, 0x86, 0x19, 0x9e, 0x0d, 0x86, 0x10, 0xc2, 0x00,
+    0x39, 0x0d, 0x83, 0xe9, 0xa3, 0x0d, 0x83, 0xe1, 0xa2, 0x0d, 0x83, 0xd9,
+    0xa1, 0x0d, 0x83, 0xd1, 0xa0, 0x0d, 0x83, 0xc9, 0x9f, 0x0d, 0x83, 0xc1,
+    0x9e, 0x0d, 0x83, 0xb8, 0xa6, 0x0d, 0x83, 0xb1, 0xa5, 0x0d, 0x83, 0xa9,
+    0xa4, 0x0d, 0x83, 0xa1, 0xa3, 0x0d, 0x83, 0x99, 0xa2, 0x0d, 0x83, 0x91,
+    0xa1, 0x0d, 0x83, 0x89, 0xa0, 0x0d, 0x83, 0x81, 0x9f, 0x0d, 0x83, 0x79,
+    0x9e, 0x0d, 0x83, 0x70, 0x9f, 0x0d, 0x83, 0x19, 0x9e, 0x0d, 0x83, 0x11,
+    0xa0, 0x0d, 0x83, 0x21, 0xa1, 0x0d, 0x83, 0x29, 0xa2, 0x0d, 0x83, 0x31,
+    0xa3, 0x0d, 0x83, 0x39, 0xa4, 0x0d, 0x83, 0x40, 0xa1, 0x0d, 0x83, 0x09,
+    0xa0, 0x0d, 0x83, 0x01, 0x9f, 0x0d, 0x82, 0xf9, 0x9e, 0x0d, 0x82, 0xf0,
+    0x9e, 0x0d, 0x83, 0x49, 0x9f, 0x0d, 0x83, 0x51, 0xa0, 0x0d, 0x83, 0x59,
+    0xa1, 0x0d, 0x83, 0x61, 0xc2, 0x00, 0xf1, 0x0d, 0x83, 0x68, 0xa4, 0x0d,
+    0x82, 0xe9, 0xa3, 0x0d, 0x82, 0xe1, 0xa2, 0x0d, 0x82, 0xd9, 0xa1, 0x0d,
+    0x82, 0xd1, 0xa0, 0x0d, 0x82, 0xc9, 0x9f, 0x0d, 0x82, 0xc1, 0x9e, 0x0d,
+    0x82, 0xb8, 0xa2, 0x0d, 0x82, 0xb1, 0xa1, 0x0d, 0x82, 0xa9, 0xa0, 0x0d,
+    0x82, 0xa1, 0x9f, 0x0d, 0x82, 0x99, 0x9e, 0x0d, 0x82, 0x90, 0xa5, 0x0d,
+    0x82, 0x89, 0xa4, 0x0d, 0x82, 0x81, 0xa3, 0x0d, 0x82, 0x79, 0xa2, 0x0d,
+    0x82, 0x71, 0xa1, 0x0d, 0x82, 0x69, 0xa0, 0x0d, 0x82, 0x61, 0x9f, 0x0d,
+    0x82, 0x59, 0x9e, 0x0d, 0x82, 0x50, 0xa3, 0x0d, 0x82, 0x49, 0xa2, 0x0d,
+    0x82, 0x41, 0xa1, 0x0d, 0x82, 0x39, 0xa0, 0x0d, 0x82, 0x31, 0x9f, 0x0d,
+    0x82, 0x29, 0x9e, 0x0d, 0x82, 0x20, 0xa5, 0x0d, 0x82, 0x19, 0xa4, 0x0d,
+    0x82, 0x11, 0xa3, 0x0d, 0x82, 0x09, 0xa2, 0x0d, 0x82, 0x01, 0xa1, 0x0d,
+    0x81, 0xf9, 0xa0, 0x0d, 0x81, 0xf1, 0x9f, 0x0d, 0x81, 0xe9, 0x9e, 0x0d,
+    0x81, 0xe0, 0xca, 0xa2, 0x7e, 0x07, 0xda, 0x79, 0x48, 0xb7, 0xf2, 0x41,
+    0xbe, 0x2e, 0xc2, 0x00, 0x67, 0x00, 0x2f, 0x23, 0x01, 0xbe, 0x40, 0xc3,
+    0xba, 0x37, 0x00, 0x2e, 0xdb, 0x01, 0xbe, 0x46, 0xc3, 0x0b, 0xc8, 0x00,
+    0x2e, 0x8b, 0x01, 0xbe, 0x4c, 0xc3, 0x04, 0xac, 0x00, 0x2e, 0xab, 0x01,
+    0xbe, 0x52, 0x16, 0xc1, 0xbe, 0x58, 0x15, 0xc1, 0xbe, 0x73, 0xc4, 0x5d,
+    0xe2, 0x00, 0x2f, 0x43, 0x01, 0xbe, 0x85, 0xc3, 0xe5, 0x78, 0x00, 0x2f,
+    0x3b, 0x01, 0xbe, 0x8b, 0x46, 0x26, 0xf7, 0xc1, 0xbe, 0x91, 0xc3, 0x20,
+    0x18, 0x00, 0x2f, 0x03, 0x01, 0xbe, 0xb5, 0xc3, 0x00, 0x4e, 0x00, 0x2e,
+    0xf3, 0x01, 0xbe, 0xbb, 0xc5, 0xa2, 0x83, 0x00, 0x2e, 0xe3, 0x01, 0xbe,
+    0xc1, 0xc3, 0x4a, 0xb9, 0x00, 0x2e, 0xcb, 0x01, 0xbe, 0xc7, 0xc5, 0x4a,
+    0xb3, 0x00, 0x2e, 0xb3, 0x01, 0xbe, 0xcd, 0xc2, 0x01, 0x7f, 0x00, 0x2e,
+    0xa3, 0x01, 0xbe, 0xd3, 0xc5, 0x40, 0x9a, 0x00, 0x2e, 0x9b, 0x01, 0xbe,
+    0xdd, 0xc5, 0x9c, 0xa2, 0x00, 0x2e, 0x93, 0x01, 0xbe, 0xe3, 0x03, 0xc1,
+    0xbe, 0xe9, 0x45, 0x06, 0xa6, 0x41, 0xbe, 0xf3, 0xd4, 0x3d, 0xa4, 0x07,
+    0xd8, 0xf1, 0x13, 0xc1, 0xbf, 0x23, 0x15, 0xc1, 0xbf, 0x32, 0xc4, 0xe4,
+    0x8b, 0x00, 0x2d, 0xf9, 0xc5, 0xdb, 0x23, 0x00, 0x2d, 0xe9, 0xcf, 0x64,
+    0xa4, 0x00, 0x2d, 0xe1, 0x0a, 0xc1, 0xbf, 0x42, 0xc5, 0x79, 0xbe, 0x00,
+    0x2d, 0xb9, 0xc5, 0xd5, 0x7e, 0x00, 0x2d, 0xa8, 0x43, 0x09, 0x3b, 0xc1,
+    0xbf, 0x57, 0xcb, 0x97, 0x7c, 0x00, 0x2e, 0x31, 0xc9, 0xae, 0xb2, 0x00,
+    0x2e, 0x19, 0xc5, 0xd4, 0x16, 0x00, 0x2e, 0x01, 0xc5, 0xda, 0xa6, 0x00,
+    0x2d, 0xf0, 0xc4, 0xe1, 0x23, 0x00, 0x2d, 0x71, 0x03, 0x41, 0xbf, 0x63,
+    0xc3, 0x51, 0x3f, 0x00, 0x2d, 0x69, 0xc4, 0x40, 0xe8, 0x00, 0x2d, 0x38,
+    0xcc, 0x89, 0x9d, 0x00, 0x2d, 0x51, 0xc3, 0x17, 0xc9, 0x00, 0x2c, 0xd0,
+    0x07, 0xc1, 0xbf, 0x6f, 0xc5, 0xd5, 0x24, 0x00, 0x2c, 0xb0, 0xc3, 0x75,
+    0x8b, 0x00, 0x2d, 0x41, 0xc9, 0xaf, 0xc9, 0x00, 0x2c, 0xf8, 0xc3, 0x15,
+    0xe7, 0x00, 0x2d, 0x09, 0xc4, 0x56, 0x4f, 0x00, 0x2c, 0xc8, 0xc9, 0xb3,
+    0xef, 0x00, 0x2c, 0x99, 0xc4, 0xa0, 0x89, 0x00, 0x2c, 0x90, 0xc3, 0x26,
+    0x1a, 0x00, 0x2c, 0xe3, 0x01, 0xbf, 0x7b, 0xc6, 0xcb, 0x63, 0x00, 0x2c,
+    0xf0, 0xc4, 0xde, 0xbb, 0x00, 0x2d, 0x19, 0xc7, 0xc3, 0x6f, 0x00, 0x2d,
+    0x21, 0xc5, 0xdd, 0x35, 0x00, 0x2d, 0x2a, 0x01, 0xbf, 0x81, 0x05, 0xc1,
+    0xbf, 0x87, 0xcf, 0x61, 0xb6, 0x02, 0x6e, 0x09, 0x03, 0xc1, 0xbf, 0x99,
+    0xc6, 0xd2, 0xb3, 0x02, 0x6f, 0x21, 0x19, 0xc1, 0xbf, 0xa3, 0xd6, 0x2d,
+    0xa4, 0x02, 0x6f, 0x99, 0xcf, 0x67, 0x56, 0x02, 0x6f, 0xa9, 0xcb, 0x92,
+    0x1d, 0x02, 0x6f, 0xc1, 0xcb, 0x90, 0x39, 0x02, 0x6f, 0xc8, 0xd9, 0x1f,
+    0x95, 0x02, 0x6e, 0x11, 0xc8, 0xbb, 0xf2, 0x02, 0x6f, 0xd0, 0xc9, 0xae,
+    0xc4, 0x02, 0x6f, 0x39, 0xc6, 0xcc, 0x17, 0x02, 0x6f, 0x41, 0xc9, 0xb1,
+    0x94, 0x02, 0x6f, 0xa0, 0xc5, 0xd5, 0x79, 0x02, 0x6e, 0x29, 0xca, 0x9e,
+    0x50, 0x02, 0x6e, 0x98, 0xc6, 0xd3, 0x37, 0x02, 0x6e, 0x41, 0xcd, 0x7f,
+    0xdb, 0x02, 0x6f, 0xe8, 0x44, 0x3e, 0x62, 0xc1, 0xbf, 0xaf, 0xc3, 0x00,
+    0x88, 0x02, 0x6e, 0xa8, 0xc3, 0x05, 0x9f, 0x02, 0x6e, 0xb9, 0xc4, 0x07,
+    0xc8, 0x02, 0x6f, 0x00, 0xc6, 0xcc, 0xb9, 0x02, 0x6e, 0xc1, 0xc8, 0xba,
+    0x5a, 0x02, 0x6f, 0xe0, 0xc7, 0x12, 0x48, 0x02, 0x6f, 0x29, 0xc7, 0x50,
+    0x25, 0x02, 0x6f, 0x70, 0xa1, 0x0f, 0xdb, 0xc1, 0x9f, 0x0f, 0xdb, 0xb1,
+    0xa0, 0x0f, 0xdb, 0xb9, 0xa2, 0x0f, 0xdb, 0xc9, 0xa3, 0x0f, 0xdb, 0xd1,
+    0xa4, 0x0f, 0xdb, 0xd9, 0xc4, 0xe1, 0x7b, 0x0f, 0xdc, 0x08, 0x45, 0x04,
+    0x90, 0xc1, 0xbf, 0xb9, 0xc2, 0x00, 0xb1, 0x01, 0x00, 0xa8, 0xa6, 0x01,
+    0x1d, 0xe9, 0xa4, 0x01, 0x1d, 0xe1, 0xa0, 0x01, 0x1d, 0xd9, 0x9e, 0x01,
+    0x1d, 0xd0, 0x42, 0x00, 0x03, 0xc1, 0xbf, 0xc5, 0xcc, 0x89, 0x55, 0x0f,
+    0xb5, 0x28, 0xc6, 0xce, 0x1b, 0x0f, 0x9e, 0x39, 0xc4, 0x00, 0x87, 0x0f,
+    0xa1, 0xa0, 0xcb, 0x93, 0x0f, 0x0f, 0x9f, 0x09, 0xc8, 0x37, 0x8f, 0x0f,
+    0x9f, 0x02, 0x01, 0xbf, 0xd4, 0xc4, 0xce, 0x15, 0x01, 0x34, 0x91, 0xc6,
+    0xca, 0xb5, 0x01, 0x31, 0x69, 0xc6, 0xcf, 0x6b, 0x0f, 0xb7, 0x00, 0xc2,
+    0x02, 0xa7, 0x0f, 0xc9, 0xf1, 0x89, 0x0f, 0xa2, 0xe0, 0xda, 0x1a, 0xb2,
+    0x0f, 0xc8, 0xf1, 0xd8, 0x23, 0x7b, 0x0f, 0xd7, 0x80, 0xc4, 0x26, 0x78,
+    0x08, 0x69, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0x69, 0xc1, 0x15, 0xc1, 0xbf,
+    0xd8, 0x08, 0xc1, 0xbf, 0xe4, 0x16, 0xc1, 0xbf, 0xf0, 0xc3, 0x05, 0x14,
+    0x08, 0x69, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0x69, 0x80, 0x42, 0x01, 0x6f,
+    0xc1, 0xbf, 0xfc, 0xc8, 0xbe, 0xea, 0x08, 0x69, 0x20, 0xc9, 0xaa, 0xb0,
+    0x08, 0x69, 0x19, 0xc5, 0xd9, 0xe8, 0x08, 0x69, 0x10, 0x91, 0x08, 0x69,
+    0x09, 0x87, 0x08, 0x69, 0x01, 0x97, 0x08, 0x68, 0xf9, 0x8b, 0x08, 0x68,
+    0xf1, 0x83, 0x08, 0x68, 0xe8, 0xc2, 0x02, 0x41, 0x08, 0x68, 0xe1, 0x10,
+    0xc1, 0xc0, 0x0e, 0x0d, 0xc1, 0xc0, 0x1e, 0xc2, 0x19, 0x2c, 0x08, 0x68,
+    0xc1, 0xc2, 0x01, 0x4a, 0x08, 0x68, 0xb1, 0xc2, 0x01, 0xc3, 0x08, 0x68,
+    0xa1, 0xc2, 0x00, 0xdb, 0x08, 0x68, 0x99, 0xc2, 0x01, 0x30, 0x08, 0x68,
+    0x91, 0x14, 0xc1, 0xc0, 0x2e, 0x06, 0xc1, 0xc0, 0x38, 0xc2, 0x00, 0x87,
+    0x08, 0x68, 0x49, 0xc2, 0x00, 0xd0, 0x08, 0x68, 0x39, 0xc2, 0x00, 0x64,
+    0x08, 0x68, 0x31, 0xc2, 0x25, 0x3b, 0x08, 0x68, 0x29, 0x16, 0xc1, 0xc0,
+    0x42, 0x83, 0x08, 0x68, 0x01, 0xc2, 0x01, 0x5d, 0x08, 0x68, 0x09, 0xc2,
+    0x00, 0xb0, 0x08, 0x68, 0x11, 0xc2, 0x02, 0x1c, 0x08, 0x68, 0x71, 0x15,
+    0x41, 0xc0, 0x4c, 0x97, 0x00, 0xb9, 0x99, 0x8b, 0x00, 0xb9, 0x90, 0xc2,
+    0x00, 0xd0, 0x00, 0xb9, 0x89, 0xc2, 0x0d, 0xf6, 0x00, 0xb9, 0x81, 0xc2,
+    0x01, 0x4a, 0x00, 0xb9, 0x79, 0xc2, 0x00, 0xdb, 0x00, 0xb9, 0x71, 0xc2,
+    0x00, 0x39, 0x00, 0xb9, 0x69, 0xc2, 0x19, 0x2c, 0x00, 0xb9, 0x61, 0xc2,
+    0x01, 0xc3, 0x00, 0xb9, 0x59, 0xc2, 0x01, 0x5d, 0x00, 0xb9, 0x51, 0xc2,
+    0x00, 0xb0, 0x00, 0xb9, 0x49, 0x10, 0xc1, 0xc0, 0x56, 0xc2, 0x0e, 0x9a,
+    0x00, 0xb9, 0x39, 0xc2, 0x01, 0x6f, 0x00, 0xb9, 0x31, 0xc2, 0x01, 0x30,
+    0x00, 0xb9, 0x21, 0xc2, 0x02, 0x2b, 0x00, 0xb9, 0x19, 0x97, 0x00, 0xb9,
+    0x11, 0x8b, 0x00, 0xb9, 0x09, 0x83, 0x00, 0xb9, 0x00, 0x49, 0xb0, 0x7d,
+    0xc1, 0xc0, 0x60, 0x0c, 0xc1, 0xc0, 0xad, 0xd4, 0x3a, 0x5c, 0x01, 0x81,
+    0x71, 0xd4, 0x3a, 0x34, 0x01, 0x81, 0x79, 0x47, 0x02, 0x0e, 0xc1, 0xc0,
+    0xb9, 0xc6, 0x92, 0x0c, 0x01, 0x8b, 0x20, 0xc3, 0x05, 0x14, 0x01, 0x81,
+    0x09, 0x16, 0xc1, 0xc1, 0x16, 0x08, 0xc1, 0xc1, 0x24, 0x15, 0xc1, 0xc1,
+    0x30, 0xc5, 0x06, 0xdb, 0x01, 0x81, 0x41, 0xc4, 0x26, 0x78, 0x01, 0x81,
+    0x48, 0xc3, 0x05, 0x14, 0x08, 0x47, 0xdb, 0x01, 0xc1, 0x3c, 0x16, 0xc1,
+    0xc1, 0x42, 0xc4, 0x0d, 0x13, 0x08, 0x47, 0xe0, 0x16, 0xc1, 0xc1, 0x4e,
+    0x15, 0xc1, 0xc1, 0x5a, 0xc4, 0xb9, 0x7e, 0x08, 0x47, 0x91, 0xc2, 0x00,
+    0x67, 0x08, 0x47, 0x81, 0x03, 0xc1, 0xc1, 0x64, 0xc3, 0x20, 0x18, 0x08,
+    0x47, 0x69, 0xc3, 0x00, 0x4e, 0x08, 0x47, 0x61, 0xc6, 0xcf, 0xd7, 0x08,
+    0x47, 0x59, 0xc4, 0xe0, 0xe7, 0x08, 0x47, 0x51, 0xc4, 0x4a, 0xb9, 0x08,
+    0x47, 0x49, 0xc2, 0x01, 0x7f, 0x08, 0x47, 0x23, 0x01, 0xc1, 0x70, 0xc4,
+    0xdf, 0x07, 0x08, 0x47, 0x31, 0xc3, 0x7e, 0x89, 0x08, 0x47, 0x29, 0xcb,
+    0x95, 0x8d, 0x08, 0x47, 0x19, 0xc5, 0x9c, 0xa2, 0x08, 0x47, 0x11, 0xc4,
+    0xe3, 0x27, 0x08, 0x47, 0x08, 0xca, 0x3b, 0x06, 0x07, 0xfb, 0x29, 0x47,
+    0x02, 0x0e, 0xc1, 0xc1, 0x76, 0xd1, 0x2f, 0xfb, 0x07, 0xfc, 0xf1, 0xd6,
+    0x2f, 0xf6, 0x07, 0xfc, 0xf8, 0x0d, 0xc1, 0xc1, 0xb1, 0x15, 0xc1, 0xc1,
+    0xc0, 0xc5, 0xd6, 0x8c, 0x07, 0xfd, 0x4b, 0x01, 0xc1, 0xcc, 0xc5, 0xda,
+    0xe7, 0x07, 0xfd, 0x89, 0x12, 0xc1, 0xc1, 0xd0, 0x8b, 0x07, 0xfe, 0xe3,
+    0x01, 0xc1, 0xdf, 0x05, 0xc1, 0xc1, 0xe5, 0x16, 0xc1, 0xc1, 0xf1, 0xc5,
+    0x90, 0xe4, 0x07, 0xfd, 0xf1, 0x83, 0x07, 0xfe, 0x13, 0x01, 0xc1, 0xfd,
+    0x1b, 0xc1, 0xc2, 0x01, 0x87, 0x07, 0xfe, 0x3b, 0x01, 0xc2, 0x1b, 0x91,
+    0x07, 0xfe, 0x63, 0x01, 0xc2, 0x23, 0x19, 0xc1, 0xc2, 0x27, 0x97, 0x07,
+    0xfe, 0x99, 0xc5, 0xd9, 0x61, 0x07, 0xfd, 0x22, 0x01, 0xc2, 0x39, 0xd1,
+    0x4e, 0xd0, 0x0f, 0xb4, 0x28, 0x47, 0x78, 0xc0, 0x41, 0xc2, 0x3d, 0x45,
+    0x03, 0x14, 0xc1, 0xc2, 0x49, 0x83, 0x01, 0x82, 0xa9, 0x8b, 0x01, 0x82,
+    0xb9, 0x97, 0x01, 0x82, 0xc9, 0x87, 0x01, 0x82, 0xd9, 0x91, 0x01, 0x82,
+    0xe8, 0x83, 0x01, 0x82, 0x59, 0x8b, 0x01, 0x82, 0x69, 0x97, 0x01, 0x82,
+    0x79, 0x87, 0x01, 0x82, 0x89, 0x91, 0x01, 0x82, 0x98, 0x83, 0x01, 0x82,
+    0x61, 0x8b, 0x01, 0x82, 0x71, 0x97, 0x01, 0x82, 0x81, 0x87, 0x01, 0x82,
+    0x91, 0x91, 0x01, 0x82, 0xa0, 0x83, 0x01, 0x82, 0xb1, 0x8b, 0x01, 0x82,
+    0xc1, 0x97, 0x01, 0x82, 0xd1, 0x87, 0x01, 0x82, 0xe1, 0x91, 0x01, 0x82,
+    0xf0, 0x83, 0x01, 0x82, 0xf9, 0x8b, 0x01, 0x83, 0x09, 0x97, 0x01, 0x83,
+    0x21, 0x87, 0x01, 0x83, 0x31, 0x91, 0x01, 0x83, 0x40, 0x83, 0x01, 0x83,
+    0x01, 0x8b, 0x01, 0x83, 0x11, 0x97, 0x01, 0x83, 0x29, 0x87, 0x01, 0x83,
+    0x39, 0x91, 0x01, 0x83, 0x48, 0x83, 0x01, 0x83, 0x51, 0x8b, 0x01, 0x83,
+    0x59, 0x97, 0x01, 0x83, 0x61, 0x87, 0x01, 0x83, 0x69, 0x91, 0x01, 0x83,
+    0x70, 0x83, 0x01, 0x83, 0x79, 0x8b, 0x01, 0x83, 0x91, 0x97, 0x01, 0x83,
+    0xa9, 0x87, 0x01, 0x83, 0xc1, 0x91, 0x01, 0x83, 0xd8, 0x83, 0x01, 0x83,
+    0x81, 0x8b, 0x01, 0x83, 0x99, 0x97, 0x01, 0x83, 0xb1, 0x87, 0x01, 0x83,
+    0xc9, 0x91, 0x01, 0x83, 0xe0, 0x83, 0x01, 0x83, 0x89, 0x8b, 0x01, 0x83,
+    0xa1, 0x97, 0x01, 0x83, 0xb9, 0x87, 0x01, 0x83, 0xd1, 0x91, 0x01, 0x83,
+    0xe8, 0x83, 0x01, 0x83, 0xf1, 0x8b, 0x01, 0x83, 0xf9, 0x97, 0x01, 0x84,
+    0x01, 0x87, 0x01, 0x84, 0x09, 0x91, 0x01, 0x84, 0x10, 0x83, 0x01, 0x84,
+    0x21, 0x97, 0x01, 0x84, 0x31, 0x91, 0x01, 0x84, 0x40, 0x83, 0x01, 0x84,
+    0x49, 0x8b, 0x01, 0x84, 0x51, 0x97, 0x01, 0x84, 0x59, 0x87, 0x01, 0x84,
+    0x61, 0x91, 0x01, 0x84, 0x68, 0x83, 0x01, 0x84, 0x79, 0x8b, 0x01, 0x84,
+    0x81, 0x87, 0x01, 0x84, 0x89, 0x91, 0x01, 0x84, 0x90, 0xc6, 0x1c, 0xb4,
+    0x01, 0x02, 0x19, 0xce, 0x6b, 0x17, 0x01, 0x70, 0xd0, 0x45, 0x6b, 0x02,
+    0xc1, 0xc2, 0x6f, 0xcc, 0x0d, 0x9e, 0x01, 0x2e, 0xc9, 0xc6, 0x1c, 0xb4,
+    0x01, 0x2e, 0xc1, 0xcc, 0x01, 0xdb, 0x0f, 0xdc, 0x81, 0x42, 0x00, 0x58,
+    0x41, 0xc2, 0x7b, 0xc9, 0x16, 0x2f, 0x01, 0x37, 0x39, 0x0e, 0xc1, 0xc2,
+    0x81, 0xc8, 0xb5, 0x82, 0x01, 0x09, 0x39, 0xc8, 0xb9, 0x82, 0x01, 0x02,
+    0xa1, 0xd0, 0x0f, 0x09, 0x00, 0x05, 0x09, 0xcd, 0x2c, 0xb2, 0x00, 0x05,
+    0xf9, 0xcb, 0x10, 0xc9, 0x01, 0x70, 0xc0, 0xda, 0x1b, 0xb6, 0x01, 0x35,
+    0x21, 0x51, 0x55, 0xda, 0x41, 0xc2, 0x90, 0x00, 0x41, 0xc2, 0xa2, 0xc9,
+    0x57, 0x36, 0x01, 0x1d, 0x71, 0x45, 0x00, 0x8c, 0xc1, 0xc2, 0xb4, 0x03,
+    0x41, 0xc2, 0xd8, 0x47, 0x34, 0x2f, 0xc1, 0xc2, 0xe4, 0x47, 0x02, 0x0e,
+    0x41, 0xc2, 0xf7, 0x47, 0x34, 0x2f, 0xc1, 0xc3, 0x50, 0x47, 0x02, 0x0e,
+    0x41, 0xc3, 0x63, 0xc5, 0x53, 0x93, 0x01, 0x09, 0xc9, 0x49, 0x1b, 0x0b,
+    0x41, 0xc3, 0xc6, 0xd1, 0x31, 0xb3, 0x0f, 0xae, 0xd1, 0xc4, 0x05, 0x4b,
+    0x01, 0x4f, 0x08, 0xd3, 0x41, 0x4b, 0x0f, 0x65, 0xa1, 0x47, 0x34, 0x2f,
+    0xc1, 0xc3, 0xd6, 0xca, 0xa6, 0xc0, 0x0f, 0x65, 0x81, 0x49, 0x53, 0xa9,
+    0xc1, 0xc4, 0x1b, 0xcb, 0x5f, 0x92, 0x0f, 0x65, 0x61, 0xc9, 0x41, 0x55,
+    0x0f, 0x65, 0x00, 0xd5, 0x36, 0x08, 0x01, 0x4f, 0x28, 0x08, 0xc1, 0xc4,
+    0x27, 0x16, 0xc1, 0xc4, 0x33, 0xc3, 0x05, 0x14, 0x0e, 0x9b, 0x90, 0xda,
+    0x1b, 0x00, 0x01, 0x81, 0xb9, 0x4b, 0x19, 0xd1, 0x41, 0xc4, 0x3f, 0x48,
+    0x0a, 0x53, 0xc1, 0xc4, 0x6f, 0x49, 0xb0, 0xb3, 0xc1, 0xc4, 0x7b, 0xcd,
+    0x7e, 0x2e, 0x01, 0x7f, 0xa1, 0x4e, 0x71, 0xbc, 0xc1, 0xc4, 0x87, 0xc8,
+    0x02, 0xf5, 0x01, 0x7f, 0xd8, 0xc7, 0xc2, 0x88, 0x01, 0x8c, 0x99, 0x0a,
+    0xc1, 0xc4, 0x9d, 0xc7, 0xc5, 0xf3, 0x01, 0x8c, 0xb0, 0x43, 0x09, 0x9e,
+    0xc1, 0xc4, 0xa9, 0xc9, 0xac, 0x2a, 0x01, 0x8c, 0xc8, 0xca, 0x9e, 0xfa,
+    0x01, 0x8c, 0xb9, 0xc7, 0xc7, 0xa5, 0x01, 0x8c, 0xf8, 0x16, 0xc1, 0xc4,
+    0xb5, 0xc3, 0x05, 0x14, 0x08, 0x42, 0xc2, 0x01, 0xc4, 0xc8, 0x16, 0xc1,
+    0xc4, 0xcc, 0x15, 0xc1, 0xc4, 0xd8, 0x03, 0xc1, 0xc4, 0xe2, 0xc3, 0x20,
+    0x18, 0x08, 0x42, 0x69, 0xc3, 0x00, 0x4e, 0x08, 0x42, 0x61, 0xc6, 0xcf,
+    0xd7, 0x08, 0x42, 0x59, 0xc4, 0xe0, 0xe7, 0x08, 0x42, 0x51, 0xc4, 0x4a,
+    0xb9, 0x08, 0x42, 0x49, 0xc2, 0x01, 0x7f, 0x08, 0x42, 0x23, 0x01, 0xc4,
+    0xee, 0xc5, 0x4a, 0xb3, 0x08, 0x42, 0x31, 0xc3, 0x7e, 0x89, 0x08, 0x42,
+    0x29, 0xc6, 0x40, 0x9a, 0x08, 0x42, 0x19, 0xc5, 0x9c, 0xa2, 0x08, 0x42,
+    0x11, 0xc4, 0xe3, 0x27, 0x08, 0x42, 0x09, 0xc2, 0x00, 0x67, 0x08, 0x42,
+    0x81, 0xc4, 0xb9, 0x7e, 0x08, 0x42, 0x91, 0xc4, 0x5d, 0xe2, 0x08, 0x42,
+    0x98, 0xc7, 0xc9, 0x0a, 0x0f, 0xa2, 0xd1, 0xc3, 0x1c, 0xe4, 0x0f, 0xa2,
+    0x91, 0xc6, 0xa8, 0xc4, 0x0f, 0xa3, 0x09, 0xc5, 0xd4, 0xf7, 0x0f, 0xa3,
+    0x10, 0x45, 0xa6, 0x50, 0xc1, 0xc4, 0xf4, 0xc5, 0x02, 0xd2, 0x01, 0x2e,
+    0x5b, 0x01, 0xc5, 0x2b, 0xd4, 0x3a, 0x0c, 0x01, 0x3f, 0x0b, 0x01, 0xc5,
+    0x2f, 0xc8, 0xb8, 0x3a, 0x01, 0x33, 0x38, 0x07, 0xc1, 0xc5, 0x35, 0xd5,
+    0x31, 0xc4, 0x0f, 0xad, 0x59, 0x11, 0x41, 0xc5, 0x3f, 0xca, 0x9d, 0x2e,
+    0x0f, 0xc5, 0x69, 0xc3, 0x05, 0x14, 0x0f, 0xc5, 0x60, 0xc5, 0x0b, 0x0a,
+    0x01, 0x2d, 0x0b, 0x01, 0xc5, 0x4b, 0xc7, 0x37, 0x27, 0x01, 0x38, 0x21,
+    0xc9, 0xb0, 0x1a, 0x01, 0x33, 0x21, 0xc2, 0x05, 0x1d, 0x0f, 0x99, 0x1b,
+    0x01, 0xc5, 0x4f, 0x0f, 0xc1, 0xc5, 0x53, 0xca, 0x50, 0x80, 0x01, 0x30,
+    0xb1, 0xc3, 0x0e, 0x6b, 0x01, 0x30, 0x31, 0xc9, 0xb3, 0x83, 0x07, 0xf2,
+    0x30, 0x03, 0xc1, 0xc5, 0x5f, 0x43, 0x00, 0x4a, 0xc1, 0xc5, 0x6b, 0x45,
+    0x0a, 0xe1, 0x41, 0xc5, 0x75, 0xc6, 0x3a, 0x1a, 0x01, 0x2e, 0x3b, 0x01,
+    0xc5, 0x7b, 0x48, 0xbe, 0x32, 0xc1, 0xc5, 0x7f, 0x43, 0x01, 0x47, 0x41,
+    0xc5, 0x8b, 0x14, 0xc1, 0xc5, 0x97, 0xd7, 0x28, 0x5a, 0x01, 0x36, 0xb9,
+    0xc8, 0x36, 0xb4, 0x01, 0x30, 0x79, 0xd2, 0x49, 0xaf, 0x0f, 0xab, 0xf0,
+    0x0e, 0xc1, 0xc5, 0xa3, 0x4c, 0x0e, 0x55, 0xc1, 0xc5, 0xb0, 0xcc, 0x7d,
+    0x5f, 0x01, 0x31, 0xc8, 0x44, 0x00, 0x2d, 0xc1, 0xc5, 0xbc, 0xc8, 0x46,
+    0x71, 0x01, 0x2d, 0x68, 0x4a, 0x03, 0x3d, 0xc1, 0xc5, 0xc8, 0x4a, 0x01,
+    0xa9, 0x41, 0xc5, 0xd4, 0x46, 0x01, 0xdc, 0xc1, 0xc5, 0xe9, 0xca, 0x9c,
+    0x2a, 0x01, 0x5e, 0xe8, 0xcc, 0x88, 0x59, 0x01, 0x2d, 0x89, 0x42, 0x00,
+    0xc4, 0x41, 0xc5, 0xf9, 0x46, 0x05, 0x87, 0xc1, 0xc6, 0x05, 0xce, 0x51,
+    0x6a, 0x01, 0x58, 0xf0, 0xd5, 0x35, 0xde, 0x0f, 0xc4, 0x39, 0xd0, 0x35,
+    0xe3, 0x0f, 0xc3, 0xf9, 0xd0, 0x5c, 0x32, 0x0f, 0xc3, 0x39, 0xca, 0x35,
+    0xe9, 0x0f, 0xc3, 0x79, 0xd1, 0x50, 0x46, 0x0f, 0xc3, 0xb8, 0xd5, 0x35,
+    0xde, 0x0f, 0xc4, 0x31, 0xd1, 0x50, 0x46, 0x0f, 0xc3, 0xb1, 0xca, 0x35,
+    0xe9, 0x0f, 0xc3, 0x71, 0xd0, 0x5c, 0x32, 0x0f, 0xc3, 0x31, 0xd0, 0x35,
+    0xe3, 0x0f, 0xc3, 0xf0, 0xd5, 0x35, 0xde, 0x0f, 0xc4, 0x29, 0xd1, 0x50,
+    0x46, 0x0f, 0xc3, 0xa9, 0xca, 0x35, 0xe9, 0x0f, 0xc3, 0x69, 0xd0, 0x5c,
+    0x32, 0x0f, 0xc3, 0x29, 0xd0, 0x35, 0xe3, 0x0f, 0xc3, 0xe8, 0xd5, 0x35,
+    0xde, 0x0f, 0xc4, 0x21, 0xd1, 0x50, 0x46, 0x0f, 0xc3, 0xa1, 0xca, 0x35,
+    0xe9, 0x0f, 0xc3, 0x61, 0xd0, 0x5c, 0x32, 0x0f, 0xc3, 0x21, 0xd0, 0x35,
+    0xe3, 0x0f, 0xc3, 0xe0, 0xc5, 0xdc, 0xfe, 0x0f, 0x9c, 0x81, 0xcc, 0x87,
+    0x15, 0x0f, 0x99, 0x60, 0xc6, 0xcc, 0x83, 0x0f, 0xb5, 0xf1, 0xc4, 0x51,
+    0xb7, 0x0f, 0x98, 0x51, 0xc7, 0xc5, 0x75, 0x0f, 0xa0, 0x19, 0xc4, 0xe3,
+    0xcf, 0x0f, 0xc9, 0xe8, 0xc4, 0x26, 0x78, 0x0f, 0x17, 0xc9, 0xc5, 0x06,
+    0xdb, 0x0f, 0x17, 0xc1, 0x15, 0xc1, 0xc6, 0x17, 0x08, 0xc1, 0xc6, 0x23,
+    0x16, 0xc1, 0xc6, 0x2f, 0xc3, 0x05, 0x14, 0x0f, 0x17, 0x89, 0xc4, 0x15,
+    0xe7, 0x0f, 0x17, 0x80, 0xc3, 0xd8, 0x41, 0x0f, 0x17, 0x73, 0x01, 0xc6,
+    0x3b, 0xc3, 0x12, 0xe0, 0x0f, 0x17, 0x62, 0x01, 0xc6, 0x41, 0x1b, 0xc1,
+    0xc6, 0x47, 0x97, 0x0f, 0x16, 0xf3, 0x01, 0xc6, 0x51, 0x10, 0xc1, 0xc6,
+    0x57, 0x83, 0x0f, 0x16, 0x0b, 0x01, 0xc6, 0x67, 0x87, 0x0f, 0x16, 0xdb,
+    0x01, 0xc6, 0x78, 0x91, 0x0f, 0x16, 0xab, 0x01, 0xc6, 0x7c, 0x8b, 0x0f,
+    0x16, 0xe3, 0x01, 0xc6, 0x83, 0x16, 0xc1, 0xc6, 0x89, 0x0e, 0xc1, 0xc6,
+    0x9f, 0xc2, 0x00, 0xd0, 0x0f, 0x16, 0xd1, 0x0d, 0xc1, 0xc6, 0xa9, 0xc2,
+    0x01, 0xc3, 0x0f, 0x16, 0xc1, 0xc2, 0x00, 0x39, 0x0f, 0x16, 0xb9, 0xc2,
+    0x02, 0x41, 0x0f, 0x16, 0x99, 0xc2, 0x01, 0x4a, 0x0f, 0x16, 0x91, 0xc2,
+    0x02, 0x1c, 0x0f, 0x16, 0x89, 0xc2, 0x25, 0x3b, 0x0f, 0x16, 0x81, 0x15,
+    0xc1, 0xc6, 0xb3, 0xc2, 0x00, 0x87, 0x0f, 0x16, 0x69, 0x12, 0xc1, 0xc6,
+    0xbd, 0xc2, 0x01, 0x30, 0x0f, 0x16, 0x29, 0xc2, 0x0e, 0x9a, 0x0f, 0x16,
+    0x21, 0xc2, 0x00, 0x64, 0x0f, 0x16, 0x19, 0xc2, 0x01, 0x5d, 0x0f, 0x16,
+    0x10, 0xc6, 0x2a, 0xfe, 0x08, 0xc7, 0x91, 0xc6, 0xcf, 0x9b, 0x08, 0xc7,
+    0x89, 0x15, 0xc1, 0xc6, 0xc7, 0x08, 0xc1, 0xc6, 0xd3, 0x16, 0x41, 0xc6,
+    0xdf, 0xc4, 0x26, 0x78, 0x08, 0xc7, 0x49, 0xc5, 0x06, 0xdb, 0x08, 0xc7,
+    0x41, 0x15, 0xc1, 0xc6, 0xf1, 0x08, 0xc1, 0xc6, 0xfd, 0x16, 0xc1, 0xc7,
+    0x09, 0xc3, 0x05, 0x14, 0x08, 0xc7, 0x09, 0xc4, 0x15, 0xe7, 0x08, 0xc7,
+    0x00, 0xc4, 0xdf, 0x7f, 0x08, 0xc6, 0xf9, 0x15, 0xc1, 0xc7, 0x15, 0x0a,
+    0xc1, 0xc7, 0x21, 0xc2, 0x05, 0x1c, 0x08, 0xc6, 0xc1, 0xc2, 0x02, 0xaa,
+    0x08, 0xc6, 0xb9, 0x83, 0x08, 0xc6, 0x0b, 0x01, 0xc7, 0x31, 0xc2, 0x0e,
+    0x9a, 0x08, 0xc6, 0xa1, 0x10, 0xc1, 0xc7, 0x3f, 0xc3, 0x02, 0x10, 0x08,
+    0xc6, 0x91, 0x91, 0x08, 0xc6, 0x4b, 0x01, 0xc7, 0x4b, 0x87, 0x08, 0xc6,
+    0x43, 0x01, 0xc7, 0x51, 0x17, 0xc1, 0xc7, 0x55, 0x1b, 0xc1, 0xc7, 0x5d,
+    0xc2, 0x00, 0xe8, 0x08, 0xc6, 0x61, 0xc2, 0x01, 0x30, 0x08, 0xc6, 0x59,
+    0xc2, 0x25, 0x9f, 0x08, 0xc6, 0x31, 0xc2, 0x00, 0x8c, 0x08, 0xc6, 0x10,
+    0xc4, 0xdf, 0x7f, 0x08, 0xc5, 0xf9, 0x15, 0xc1, 0xc7, 0x6c, 0x0a, 0xc1,
+    0xc7, 0x78, 0xc2, 0x05, 0x1c, 0x08, 0xc5, 0xc1, 0xc2, 0x02, 0xaa, 0x08,
+    0xc5, 0xb9, 0x83, 0x08, 0xc5, 0x0b, 0x01, 0xc7, 0x88, 0xc2, 0x0e, 0x9a,
+    0x08, 0xc5, 0xa1, 0x10, 0xc1, 0xc7, 0x96, 0xc3, 0x02, 0x10, 0x08, 0xc5,
+    0x91, 0x91, 0x08, 0xc5, 0x4b, 0x01, 0xc7, 0xa2, 0x87, 0x08, 0xc5, 0x43,
+    0x01, 0xc7, 0xa8, 0x17, 0xc1, 0xc7, 0xac, 0x1b, 0xc1, 0xc7, 0xb4, 0xc2,
+    0x00, 0xe8, 0x08, 0xc5, 0x61, 0xc2, 0x01, 0x30, 0x08, 0xc5, 0x59, 0xc2,
+    0x25, 0x9f, 0x08, 0xc5, 0x31, 0xc2, 0x00, 0x8c, 0x08, 0xc5, 0x10, 0xc3,
+    0x02, 0x6e, 0x01, 0x18, 0x39, 0xc7, 0x80, 0x2f, 0x07, 0xf2, 0x78, 0xc5,
+    0x00, 0x2c, 0x01, 0x49, 0x99, 0xc4, 0x00, 0x49, 0x01, 0x59, 0xf8, 0xcf,
+    0x1b, 0x25, 0x01, 0x02, 0xa9, 0xcc, 0x8c, 0x19, 0x0f, 0x9d, 0xa0, 0x05,
+    0xc1, 0xc7, 0xc3, 0xd7, 0x15, 0x2e, 0x01, 0x39, 0x19, 0xd8, 0x21, 0x23,
+    0x01, 0x39, 0x11, 0x44, 0x05, 0x18, 0xc1, 0xc7, 0xcf, 0xcb, 0x8d, 0xdc,
+    0x0f, 0x9a, 0x01, 0xd2, 0x22, 0x49, 0x0f, 0xbe, 0x30, 0xcb, 0x93, 0x5c,
+    0x0f, 0x9b, 0xe8, 0x00, 0xc1, 0xc7, 0xdb, 0xc9, 0xab, 0xd9, 0x0f, 0xb1,
+    0xb0, 0xd7, 0x29, 0x6e, 0x0f, 0xb0, 0x59, 0xd0, 0x59, 0x32, 0x0f, 0xb1,
+    0x88, 0xdf, 0x0d, 0x9b, 0x01, 0x36, 0xf1, 0x49, 0x0d, 0x20, 0x41, 0xc8,
+    0x24, 0xe0, 0x06, 0x87, 0x01, 0x3d, 0x60, 0xc9, 0xb2, 0xa2, 0x0f, 0x98,
+    0xe9, 0xc6, 0x00, 0x91, 0x0f, 0x98, 0xa8, 0xca, 0x5d, 0xa2, 0x07, 0xf8,
+    0x19, 0xc7, 0x68, 0xc6, 0x07, 0xff, 0x10, 0xc7, 0x0b, 0x00, 0x07, 0xf8,
+    0x51, 0xc8, 0x36, 0x21, 0x07, 0xf8, 0x31, 0xc9, 0x2d, 0x85, 0x07, 0xf8,
+    0x38, 0x45, 0x09, 0x98, 0xc1, 0xc8, 0x30, 0xca, 0x99, 0x61, 0x07, 0xf8,
+    0x20, 0x11, 0xc1, 0xc8, 0x54, 0xd0, 0x08, 0xf7, 0x07, 0xf9, 0xf1, 0xc8,
+    0x8e, 0x16, 0x07, 0xff, 0x00, 0xc8, 0x52, 0x00, 0x07, 0xf8, 0xd9, 0xc6,
+    0x27, 0x5e, 0x07, 0xf8, 0x78, 0x07, 0xc1, 0xc8, 0x60, 0x45, 0x0b, 0x12,
+    0xc1, 0xc8, 0x6c, 0xc7, 0x80, 0x2f, 0x07, 0xf9, 0xf8, 0xca, 0x0e, 0xbe,
+    0x07, 0xf8, 0xe9, 0xcf, 0x0f, 0x0a, 0x07, 0xf8, 0x08, 0xcf, 0x54, 0xbb,
+    0x07, 0xf8, 0xf1, 0xca, 0x1f, 0x0e, 0x07, 0xfa, 0x00, 0xcb, 0x2c, 0xb4,
+    0x07, 0xf8, 0xf9, 0xcc, 0x01, 0xbb, 0x07, 0xf8, 0x10, 0xce, 0x61, 0xd5,
+    0x07, 0xf9, 0xe1, 0x45, 0x00, 0x2d, 0x41, 0xc8, 0x78, 0xc9, 0x9f, 0xc3,
+    0x07, 0xff, 0x09, 0xcb, 0x8e, 0x13, 0x07, 0xf8, 0x29, 0xc8, 0x60, 0xf4,
+    0x07, 0xf8, 0x58, 0x00, 0x41, 0xc8, 0x90, 0xc9, 0xa8, 0x28, 0x0f, 0x9c,
+    0x39, 0x95, 0x0f, 0x9c, 0x30, 0xc5, 0x91, 0x52, 0x0f, 0xb4, 0x91, 0xcb,
+    0x92, 0xf9, 0x0f, 0xcf, 0x78, 0x49, 0xb2, 0xcf, 0xc1, 0xc8, 0x9c, 0xc2,
+    0x00, 0xac, 0x0b, 0x7a, 0x50, 0x44, 0x1a, 0xce, 0xc1, 0xc8, 0xa8, 0x15,
+    0xc1, 0xc8, 0xc4, 0x87, 0x0b, 0x7a, 0x41, 0x42, 0x07, 0x26, 0xc1, 0xc8,
+    0xd8, 0xc2, 0x01, 0x6f, 0x0b, 0x78, 0x71, 0x83, 0x0b, 0x78, 0x50, 0x83,
+    0x0b, 0x78, 0x83, 0x01, 0xc8, 0xe2, 0x1b, 0xc1, 0xc8, 0xe8, 0x09, 0xc1,
+    0xc8, 0xf2, 0x10, 0xc1, 0xc8, 0xfc, 0xc2, 0x00, 0xd0, 0x0b, 0x78, 0x88,
+    0x1c, 0xc1, 0xc9, 0x06, 0x42, 0x07, 0x26, 0xc1, 0xc9, 0x1c, 0xc2, 0x0e,
+    0x9a, 0x0b, 0x78, 0x79, 0x83, 0x0b, 0x78, 0x58, 0xc2, 0x16, 0x5a, 0x0b,
+    0x7a, 0x31, 0x83, 0x0b, 0x79, 0xd1, 0xc2, 0x0d, 0xf6, 0x0b, 0x79, 0xa1,
+    0xc2, 0x00, 0xd0, 0x0b, 0x79, 0x98, 0xc2, 0x00, 0x2c, 0x0b, 0x7a, 0x29,
+    0x83, 0x0b, 0x78, 0x08, 0xc2, 0x00, 0xd0, 0x0b, 0x7a, 0x21, 0x83, 0x0b,
+    0x79, 0x30, 0x8a, 0x0b, 0x7a, 0x19, 0x47, 0x78, 0xc0, 0x41, 0xc9, 0x26,
+    0x1c, 0xc1, 0xc9, 0x36, 0x15, 0xc1, 0xc9, 0x44, 0x83, 0x0b, 0x79, 0xd9,
+    0xc2, 0x00, 0xd0, 0x0b, 0x79, 0xa8, 0x16, 0xc1, 0xc9, 0x4e, 0xc4, 0xe2,
+    0x83, 0x0b, 0x79, 0x89, 0xc2, 0x02, 0x2b, 0x0b, 0x79, 0x01, 0xc3, 0x3a,
+    0x09, 0x0b, 0x78, 0x91, 0xc2, 0x00, 0xb0, 0x0b, 0x78, 0x10, 0x0a, 0xc1,
+    0xc9, 0x5c, 0x83, 0x0b, 0x78, 0xf8, 0xc2, 0x01, 0x30, 0x0b, 0x79, 0x11,
+    0x83, 0x0b, 0x79, 0x08, 0x0a, 0xc1, 0xc9, 0x66, 0xc2, 0x19, 0x2c, 0x0b,
+    0x78, 0xb9, 0x83, 0x0b, 0x78, 0xb0, 0xc2, 0x00, 0x87, 0x0b, 0x78, 0x49,
+    0x83, 0x0b, 0x78, 0x40, 0xc2, 0x00, 0xd0, 0x0b, 0x78, 0x29, 0x83, 0x0b,
+    0x78, 0x20, 0xc2, 0x00, 0xdb, 0x0b, 0x78, 0x19, 0x83, 0x0b, 0x78, 0x00,
+    0x8b, 0x0b, 0x7c, 0x39, 0xc2, 0x13, 0x38, 0x0b, 0x7b, 0xf9, 0xc2, 0x00,
+    0x75, 0x0b, 0x7b, 0x81, 0xc2, 0x06, 0xdb, 0x0b, 0x7b, 0x79, 0x97, 0x0b,
+    0x7b, 0x71, 0x83, 0x0b, 0x7b, 0x5a, 0x01, 0xc9, 0x70, 0x91, 0x0b, 0x7b,
+    0x2b, 0x01, 0xc9, 0x77, 0x89, 0x0b, 0x7c, 0x21, 0xc2, 0x00, 0x75, 0x0b,
+    0x7b, 0x49, 0x97, 0x0b, 0x7b, 0x41, 0x8b, 0x0b, 0x7b, 0x39, 0x87, 0x0b,
+    0x7b, 0x31, 0x83, 0x0b, 0x7b, 0x12, 0x01, 0xc9, 0x7d, 0x83, 0x0b, 0x7c,
+    0x29, 0x8b, 0x0b, 0x7b, 0xd1, 0x94, 0x0b, 0x7b, 0xbb, 0x01, 0xc9, 0x84,
+    0x90, 0x0b, 0x7a, 0xf2, 0x01, 0xc9, 0x88, 0x07, 0xc1, 0xc9, 0x8c, 0x89,
+    0x0b, 0x7c, 0x09, 0x97, 0x0b, 0x7b, 0xe1, 0x91, 0x0b, 0x7a, 0xd0, 0xc2,
+    0x03, 0xd4, 0x0b, 0x7c, 0x01, 0x8b, 0x0b, 0x7b, 0x90, 0x89, 0x0b, 0x7b,
+    0xf0, 0x97, 0x0b, 0x7b, 0xd9, 0x8b, 0x0b, 0x7b, 0xc9, 0x87, 0x0b, 0x7b,
+    0x9b, 0x01, 0xc9, 0x94, 0x90, 0x0b, 0x7a, 0xbb, 0x01, 0xc9, 0x98, 0xc2,
+    0x61, 0x75, 0x0b, 0x7a, 0xb1, 0x83, 0x0b, 0x7a, 0xa8, 0x94, 0x0b, 0x7b,
+    0xb0, 0x91, 0x0b, 0x7a, 0xd8, 0xca, 0xa1, 0x84, 0x0b, 0x7a, 0x99, 0xc7,
+    0xc1, 0x62, 0x0b, 0x7a, 0x90, 0xc5, 0x1e, 0xc8, 0x01, 0x12, 0x11, 0xc4,
+    0x00, 0xba, 0x01, 0x10, 0x92, 0x01, 0xc9, 0x9c, 0x4e, 0x75, 0x20, 0xc1,
+    0xc9, 0xa0, 0xcb, 0x58, 0xc7, 0x0f, 0xbd, 0x19, 0x46, 0x01, 0xfc, 0xc1,
+    0xc9, 0xac, 0x04, 0xc1, 0xc9, 0xb8, 0x45, 0x00, 0x2c, 0xc1, 0xc9, 0xc4,
+    0x44, 0x00, 0x49, 0xc1, 0xc9, 0xce, 0x08, 0xc1, 0xc9, 0xd8, 0xcc, 0x07,
+    0xbb, 0x01, 0x3a, 0xc9, 0x15, 0xc1, 0xc9, 0xea, 0xd2, 0x4c, 0x91, 0x01,
+    0x02, 0xf9, 0x46, 0x0f, 0x88, 0x41, 0xca, 0x02, 0xc5, 0x0a, 0x8a, 0x01,
+    0x72, 0x61, 0xd0, 0x0f, 0x09, 0x01, 0x72, 0x99, 0xcd, 0x2c, 0xb2, 0x01,
+    0x72, 0xa0, 0xca, 0x9c, 0x70, 0x0b, 0x74, 0xc9, 0x4c, 0x29, 0xba, 0x41,
+    0xca, 0x0e, 0xc4, 0x0a, 0x8b, 0x0b, 0x74, 0xb9, 0x4e, 0x0b, 0x18, 0x41,
+    0xca, 0x88, 0x16, 0xc1, 0xcb, 0x02, 0xc3, 0x05, 0x14, 0x0b, 0x74, 0x0b,
+    0x01, 0xcb, 0x14, 0xc4, 0x26, 0x78, 0x0b, 0x74, 0x49, 0xc5, 0x06, 0xdb,
+    0x0b, 0x74, 0x41, 0x15, 0xc1, 0xcb, 0x1a, 0x08, 0xc1, 0xcb, 0x26, 0xc4,
+    0x15, 0xe7, 0x0b, 0x74, 0x00, 0xc8, 0x4b, 0x5f, 0x0b, 0x74, 0x99, 0x07,
+    0xc1, 0xcb, 0x32, 0x15, 0xc1, 0xcb, 0x3e, 0x08, 0xc1, 0xcb, 0x4a, 0x16,
+    0x41, 0xcb, 0x56, 0xc8, 0xb5, 0x5a, 0x01, 0x1e, 0xc1, 0xc6, 0xcd, 0xe5,
+    0x01, 0x1e, 0xb9, 0x4a, 0x9b, 0x12, 0x41, 0xcb, 0x68, 0xca, 0x9c, 0x16,
+    0x01, 0x1e, 0xa1, 0xc5, 0x2e, 0xee, 0x01, 0x1e, 0x90, 0x1d, 0xc1, 0xcb,
+    0x74, 0x1e, 0x41, 0xcb, 0x9c, 0xc3, 0x05, 0x14, 0x0f, 0x46, 0x39, 0x16,
+    0xc1, 0xcb, 0xc4, 0x08, 0xc1, 0xcb, 0xd0, 0x15, 0xc1, 0xcb, 0xdc, 0xc5,
+    0x06, 0xdb, 0x0f, 0x46, 0x71, 0xc4, 0x26, 0x78, 0x0f, 0x46, 0x78, 0x16,
+    0xc1, 0xcb, 0xe8, 0x47, 0x0d, 0x04, 0xc1, 0xcb, 0xf2, 0xc8, 0x33, 0xee,
+    0x0f, 0x46, 0xb0, 0x49, 0x53, 0xa9, 0xc1, 0xcb, 0xfc, 0x47, 0x34, 0x2f,
+    0xc1, 0xcc, 0x18, 0x0e, 0x41, 0xcc, 0x3f, 0xcb, 0x91, 0x99, 0x08, 0x4c,
+    0xf3, 0x01, 0xcc, 0x4b, 0x47, 0x02, 0x0e, 0x41, 0xcc, 0x51, 0x00, 0x41,
+    0xcc, 0xb3, 0xc2, 0x02, 0xa0, 0x05, 0x5f, 0x91, 0xc4, 0x02, 0xde, 0x05,
+    0x5f, 0x98, 0xc3, 0x09, 0x9e, 0x05, 0x5f, 0xa1, 0xc3, 0x0d, 0x14, 0x05,
+    0x5f, 0xa8, 0xc2, 0x22, 0xcc, 0x05, 0x5f, 0xb1, 0xc4, 0x18, 0x10, 0x05,
+    0x5f, 0xb8, 0xc4, 0xe4, 0x73, 0x05, 0x5f, 0x51, 0xc7, 0xc6, 0x16, 0x05,
+    0x5f, 0x49, 0xc5, 0xd5, 0x3d, 0x05, 0x5f, 0x31, 0x03, 0xc1, 0xcc, 0xbf,
+    0x0b, 0xc1, 0xcc, 0xcd, 0xc4, 0xbd, 0x08, 0x05, 0x5f, 0x19, 0xc7, 0x40,
+    0xe5, 0x05, 0x57, 0xa9, 0x17, 0xc1, 0xcc, 0xd7, 0xc6, 0xce, 0x4b, 0x05,
+    0x5f, 0x38, 0x8b, 0x05, 0x5e, 0x7b, 0x01, 0xcc, 0xe1, 0x10, 0xc1, 0xcc,
+    0xe7, 0x16, 0xc1, 0xcd, 0x03, 0x12, 0xc1, 0xcd, 0x16, 0x0d, 0xc1, 0xcd,
+    0x23, 0x04, 0xc1, 0xcd, 0x32, 0x06, 0xc1, 0xcd, 0x3c, 0x09, 0xc1, 0xcd,
+    0x4c, 0x15, 0xc1, 0xcd, 0x58, 0x42, 0x11, 0xee, 0xc1, 0xcd, 0x6a, 0x91,
+    0x05, 0x57, 0x09, 0x87, 0x05, 0x57, 0x01, 0xc3, 0x18, 0x95, 0x05, 0x5e,
+    0xa1, 0xc5, 0xd5, 0x92, 0x05, 0x5e, 0x89, 0xc2, 0x05, 0x1d, 0x05, 0x5e,
+    0x71, 0xc3, 0xcc, 0x38, 0x05, 0x5e, 0x69, 0xc4, 0xb0, 0x02, 0x05, 0x5e,
+    0x61, 0xc3, 0x27, 0x01, 0x05, 0x5e, 0x1b, 0x01, 0xcd, 0x74, 0xc3, 0x02,
+    0xf9, 0x05, 0x5e, 0x13, 0x01, 0xcd, 0x7a, 0xc3, 0x0c, 0x26, 0x05, 0x5e,
+    0x59, 0x0c, 0x41, 0xcd, 0x80, 0xc7, 0xc0, 0x82, 0x0f, 0xb7, 0xa9, 0xc4,
+    0xd0, 0x81, 0x0f, 0xb7, 0x28, 0x00, 0x41, 0xcd, 0x8c, 0xc4, 0x00, 0x87,
+    0x0f, 0xa1, 0x69, 0xc4, 0xd0, 0xf1, 0x0f, 0xd5, 0x20, 0xc5, 0x61, 0xc0,
+    0x0e, 0x98, 0x01, 0x1b, 0x41, 0xcd, 0x9e, 0x46, 0x45, 0x87, 0xc1, 0xcd,
+    0xaa, 0xd9, 0x1e, 0x69, 0x08, 0xb3, 0x19, 0xcf, 0x62, 0x5b, 0x00, 0xc0,
+    0x30, 0xca, 0x01, 0x28, 0x08, 0xb3, 0x4b, 0x01, 0xcd, 0xb0, 0xdc, 0x14,
+    0x85, 0x00, 0xc0, 0x38, 0xd5, 0x01, 0x32, 0x08, 0xb3, 0x40, 0x46, 0x00,
+    0x8b, 0x41, 0xcd, 0xb6, 0x46, 0x00, 0x8b, 0x41, 0xcd, 0xc2, 0xd9, 0x1e,
+    0x9b, 0x08, 0xb3, 0x11, 0x45, 0x09, 0x98, 0x41, 0xcd, 0xce, 0xc2, 0x01,
+    0xc3, 0x00, 0xc1, 0x73, 0x01, 0xcd, 0xf2, 0x83, 0x00, 0xc1, 0x03, 0x01,
+    0xcd, 0xf8, 0x16, 0xc1, 0xce, 0x04, 0x42, 0x11, 0xee, 0xc1, 0xce, 0x14,
+    0x15, 0xc1, 0xce, 0x1f, 0x1c, 0xc1, 0xce, 0x2f, 0x0e, 0xc1, 0xce, 0x3f,
+    0xc3, 0x39, 0x6e, 0x00, 0xc1, 0xf1, 0x0d, 0xc1, 0xce, 0x49, 0xc2, 0x00,
+    0x87, 0x00, 0xc1, 0xc9, 0xc2, 0x01, 0x4a, 0x00, 0xc1, 0xc1, 0xc2, 0x00,
+    0x39, 0x00, 0xc1, 0xb9, 0xc2, 0x19, 0x2c, 0x00, 0xc1, 0xb1, 0xc2, 0x25,
+    0x3b, 0x00, 0xc1, 0xa9, 0xc2, 0x0e, 0x9a, 0x00, 0xc1, 0x99, 0xc2, 0x01,
+    0x30, 0x00, 0xc1, 0x69, 0xc2, 0x0f, 0x9a, 0x00, 0xc1, 0x61, 0xc2, 0x00,
+    0xb0, 0x00, 0xc1, 0x59, 0xc2, 0x01, 0x5d, 0x00, 0xc1, 0x51, 0xc2, 0x00,
+    0xc1, 0x00, 0xc1, 0x41, 0x87, 0x00, 0xc1, 0x0b, 0x01, 0xce, 0x53, 0x97,
+    0x00, 0xc1, 0x23, 0x01, 0xce, 0x57, 0x91, 0x00, 0xc1, 0x1b, 0x01, 0xce,
+    0x5b, 0x8b, 0x00, 0xc1, 0x10, 0x57, 0x28, 0x43, 0xc1, 0xce, 0x5f, 0xc8,
+    0x3b, 0x7a, 0x00, 0xc0, 0x29, 0xc8, 0x11, 0xf7, 0x00, 0xc0, 0x18, 0xc9,
+    0x11, 0xf6, 0x00, 0xc0, 0x49, 0xc5, 0x0a, 0x8a, 0x00, 0xc0, 0x40, 0xc3,
+    0x0d, 0xe5, 0x00, 0xc0, 0x21, 0xc3, 0x0a, 0x8c, 0x00, 0xc0, 0x10, 0xca,
+    0xa0, 0xf8, 0x0f, 0xa5, 0xc1, 0xc3, 0x32, 0x20, 0x0f, 0xa5, 0x80, 0x06,
+    0xc1, 0xce, 0x6f, 0x45, 0x00, 0xba, 0xc1, 0xce, 0x81, 0xd1, 0x50, 0xce,
+    0x08, 0xb2, 0x19, 0x4b, 0x6f, 0xc7, 0xc1, 0xce, 0x91, 0x47, 0x02, 0x0e,
+    0x41, 0xce, 0xb1, 0x47, 0x02, 0x0e, 0xc1, 0xcf, 0x16, 0xd9, 0x1d, 0x88,
+    0x05, 0x5a, 0xd8, 0x48, 0x0b, 0x17, 0xc1, 0xcf, 0x5c, 0x12, 0xc1, 0xcf,
+    0xfd, 0xca, 0x9c, 0xac, 0x0e, 0xb8, 0xd1, 0xcc, 0x8b, 0x65, 0x0e, 0xb8,
+    0xc1, 0xcc, 0x89, 0xfd, 0x0e, 0xb8, 0xb9, 0xce, 0x10, 0x3e, 0x0e, 0xb8,
+    0xb1, 0x46, 0x03, 0x13, 0xc1, 0xd0, 0x0f, 0xc5, 0xdb, 0xf0, 0x0e, 0xb7,
+    0xd8, 0x15, 0xc1, 0xd0, 0xaf, 0x46, 0x09, 0x97, 0xc1, 0xd0, 0xbb, 0x48,
+    0x0b, 0x17, 0xc1, 0xd0, 0xdf, 0x47, 0xc7, 0x4a, 0xc1, 0xd1, 0x80, 0x12,
+    0xc1, 0xd1, 0xae, 0xca, 0x9c, 0xac, 0x0e, 0xb7, 0x01, 0xcc, 0x8b, 0x65,
+    0x0e, 0xb6, 0xf1, 0xcc, 0x89, 0xfd, 0x0e, 0xb6, 0xe9, 0xce, 0x10, 0x3e,
+    0x0e, 0xb6, 0xe1, 0xc5, 0xdb, 0xf0, 0x0e, 0xb6, 0x09, 0x48, 0xbd, 0x42,
+    0x41, 0xd1, 0xc0, 0x46, 0x09, 0x97, 0xc1, 0xd1, 0xcc, 0x46, 0x03, 0x13,
+    0xc1, 0xd1, 0xf0, 0x48, 0x0b, 0x17, 0x41, 0xd2, 0x58, 0x4a, 0x43, 0x55,
+    0xc1, 0xd2, 0xc0, 0x46, 0x07, 0x2f, 0x41, 0xd2, 0xde, 0x46, 0x09, 0x97,
+    0xc1, 0xd2, 0xea, 0x46, 0x03, 0x13, 0xc1, 0xd3, 0x0e, 0x48, 0x0b, 0x17,
+    0x41, 0xd3, 0x76, 0x47, 0xbd, 0x43, 0xc1, 0xd3, 0xc2, 0xcf, 0x35, 0x0c,
+    0x01, 0x3e, 0x68, 0x44, 0x00, 0x2e, 0xc1, 0xd3, 0xce, 0xcd, 0x27, 0x2f,
+    0x01, 0x3e, 0x58, 0xd5, 0x35, 0x36, 0x01, 0x3f, 0x71, 0x46, 0x01, 0xfc,
+    0xc1, 0xd3, 0xe6, 0xd4, 0x38, 0xf4, 0x01, 0x3f, 0x51, 0xcd, 0x0b, 0x91,
+    0x01, 0x3f, 0x40, 0xc3, 0x03, 0x26, 0x0e, 0x97, 0x90, 0xc4, 0x14, 0x09,
+    0x0e, 0x97, 0x88, 0xc4, 0x14, 0x09, 0x0e, 0x97, 0x80, 0xc5, 0x14, 0x08,
+    0x0e, 0x97, 0x79, 0xc2, 0x00, 0x5f, 0x0e, 0x97, 0x28, 0xc4, 0x14, 0x09,
+    0x0e, 0x97, 0x70, 0xc6, 0x52, 0xcd, 0x0e, 0x97, 0x69, 0xc3, 0x02, 0xdf,
+    0x0e, 0x97, 0x18, 0xc4, 0x22, 0x44, 0x0e, 0x97, 0x61, 0x91, 0x0e, 0x97,
+    0x10, 0xc2, 0x19, 0x2c, 0x08, 0xf7, 0x59, 0x83, 0x08, 0xf7, 0x41, 0xc2,
+    0x01, 0x30, 0x08, 0xf7, 0x10, 0xc4, 0x26, 0x78, 0x08, 0xea, 0xc9, 0xc5,
+    0x06, 0xdb, 0x08, 0xea, 0xc1, 0x15, 0xc1, 0xd3, 0xf2, 0x08, 0xc1, 0xd3,
+    0xfe, 0x16, 0xc1, 0xd4, 0x0a, 0xc3, 0x05, 0x14, 0x08, 0xea, 0x89, 0xc4,
+    0x15, 0xe7, 0x08, 0xea, 0x80, 0xc6, 0xd1, 0x39, 0x08, 0xea, 0x39, 0xc4,
+    0xbb, 0x54, 0x08, 0xea, 0x30, 0xc5, 0x1e, 0x96, 0x08, 0xea, 0x29, 0x4a,
+    0x6f, 0xc8, 0x41, 0xd4, 0x16, 0xc7, 0xc3, 0xa7, 0x08, 0xea, 0x21, 0xc6,
+    0x1e, 0x89, 0x08, 0xea, 0x19, 0xc5, 0x33, 0x5d, 0x08, 0xea, 0x11, 0xc7,
+    0x40, 0xe5, 0x08, 0xea, 0x09, 0xc8, 0x14, 0x38, 0x08, 0xea, 0x00, 0x16,
+    0xc1, 0xd4, 0x36, 0x0c, 0xc1, 0xd4, 0x4a, 0x0d, 0xc1, 0xd4, 0x5a, 0x0e,
+    0xc1, 0xd4, 0x6a, 0xc2, 0x00, 0xd0, 0x08, 0xe9, 0x61, 0x15, 0xc1, 0xd4,
+    0x74, 0xc2, 0x02, 0x41, 0x08, 0xe9, 0x41, 0xc2, 0x00, 0x39, 0x08, 0xe9,
+    0x31, 0xc2, 0x19, 0x2c, 0x08, 0xe9, 0x29, 0xc2, 0x01, 0xc3, 0x08, 0xe9,
+    0x21, 0x04, 0xc1, 0xd4, 0x84, 0x12, 0xc1, 0xd4, 0x8e, 0x10, 0xc1, 0xd4,
+    0x98, 0x06, 0xc1, 0xd4, 0xae, 0x05, 0xc1, 0xd4, 0xbc, 0x09, 0xc1, 0xd4,
+    0xc6, 0x83, 0x08, 0xe8, 0x03, 0x01, 0xd4, 0xd0, 0x91, 0x08, 0xe8, 0x49,
+    0x87, 0x08, 0xe8, 0x31, 0x97, 0x08, 0xe8, 0x23, 0x01, 0xd4, 0xdc, 0x8b,
+    0x08, 0xe8, 0x12, 0x01, 0xd4, 0xe0, 0x44, 0x00, 0xbb, 0xc1, 0xd4, 0xe4,
+    0x50, 0x5c, 0xf2, 0x41, 0xd4, 0xf0, 0x91, 0x08, 0xe5, 0xa1, 0x87, 0x08,
+    0xe5, 0x99, 0x97, 0x08, 0xe5, 0x91, 0x8b, 0x08, 0xe5, 0x89, 0xc2, 0x04,
+    0xc6, 0x08, 0xe5, 0x80, 0x83, 0x08, 0xe4, 0x79, 0xc2, 0x00, 0xd0, 0x08,
+    0xe4, 0x71, 0x15, 0xc1, 0xd5, 0x4a, 0xc2, 0x00, 0xdb, 0x08, 0xe4, 0x59,
+    0xc2, 0x00, 0x39, 0x08, 0xe4, 0x51, 0xc2, 0x19, 0x2c, 0x08, 0xe4, 0x49,
+    0xc2, 0x00, 0x02, 0x08, 0xe4, 0x41, 0x1c, 0xc1, 0xd5, 0x54, 0xc2, 0x01,
+    0x4a, 0x08, 0xe4, 0x29, 0x06, 0xc1, 0xd5, 0x5e, 0x16, 0xc1, 0xd5, 0x68,
+    0xc2, 0x01, 0xc3, 0x08, 0xe4, 0x09, 0xc2, 0x01, 0x5d, 0x08, 0xe4, 0x01,
+    0x12, 0xc1, 0xd5, 0x76, 0x10, 0xc1, 0xd5, 0x80, 0xc2, 0x25, 0x3b, 0x08,
+    0xe3, 0xc1, 0x05, 0xc1, 0xd5, 0x90, 0xc2, 0x01, 0x30, 0x08, 0xe3, 0xa1,
+    0x0d, 0x41, 0xd5, 0x9a, 0xd8, 0x20, 0xf3, 0x01, 0x35, 0x39, 0xc4, 0x00,
+    0xba, 0x01, 0x35, 0x30, 0x05, 0xc1, 0xd5, 0xa4, 0x03, 0xc1, 0xd5, 0xb6,
+    0x18, 0xc1, 0xd5, 0xc2, 0xc4, 0x00, 0xb0, 0x00, 0x6a, 0x78, 0x18, 0xc1,
+    0xd5, 0xcc, 0x83, 0x00, 0x68, 0x2b, 0x01, 0xd5, 0xdc, 0x8b, 0x00, 0x68,
+    0x3b, 0x01, 0xd5, 0xee, 0x97, 0x00, 0x68, 0x4b, 0x01, 0xd5, 0xf2, 0x87,
+    0x00, 0x68, 0x73, 0x01, 0xd5, 0xf6, 0x91, 0x00, 0x68, 0x93, 0x01, 0xd5,
+    0xfa, 0x0d, 0xc1, 0xd5, 0xfe, 0x09, 0xc1, 0xd6, 0x08, 0x10, 0xc1, 0xd6,
+    0x12, 0x05, 0xc1, 0xd6, 0x26, 0x0c, 0xc1, 0xd6, 0x2e, 0x16, 0xc1, 0xd6,
+    0x38, 0x06, 0xc1, 0xd6, 0x46, 0x12, 0xc1, 0xd6, 0x5a, 0x04, 0xc1, 0xd6,
+    0x64, 0xc2, 0x01, 0xc3, 0x00, 0x69, 0x71, 0xc2, 0x19, 0x2c, 0x00, 0x69,
+    0x79, 0x14, 0xc1, 0xd6, 0x6e, 0x0e, 0xc1, 0xd6, 0x78, 0x15, 0xc1, 0xd6,
+    0x80, 0xc2, 0x00, 0xd0, 0x00, 0x69, 0xc8, 0x03, 0xc1, 0xd6, 0x90, 0x8b,
+    0x00, 0x69, 0xfb, 0x01, 0xd6, 0x9c, 0x97, 0x00, 0x6a, 0x0b, 0x01, 0xd6,
+    0xa0, 0x48, 0xb2, 0x2d, 0xc1, 0xd6, 0xa4, 0x87, 0x00, 0x6a, 0x33, 0x01,
+    0xd6, 0xb2, 0x91, 0x00, 0x6a, 0x52, 0x01, 0xd6, 0xb6, 0x44, 0x05, 0x14,
+    0xc1, 0xd6, 0xba, 0x46, 0x02, 0xdd, 0x41, 0xd6, 0xe0, 0x45, 0x09, 0x98,
+    0xc1, 0xd6, 0xf8, 0xc8, 0xbc, 0xda, 0x00, 0x6b, 0xc8, 0xc3, 0x09, 0x41,
+    0x00, 0x6b, 0x81, 0x44, 0x05, 0x14, 0x41, 0xd7, 0x1c, 0xcb, 0x92, 0x07,
+    0x08, 0x57, 0xb1, 0xc8, 0x02, 0x9f, 0x08, 0x57, 0xa9, 0x42, 0x00, 0x58,
+    0xc1, 0xd7, 0x28, 0xc7, 0x2c, 0xab, 0x08, 0x57, 0x89, 0xc4, 0x0e, 0x6a,
+    0x08, 0x57, 0x80, 0xc3, 0x05, 0x14, 0x08, 0x57, 0x5b, 0x01, 0xd7, 0x35,
+    0x16, 0xc1, 0xd7, 0x3b, 0xc4, 0x0d, 0x13, 0x08, 0x57, 0x60, 0xc5, 0x05,
+    0x02, 0x08, 0x57, 0x31, 0xc5, 0x00, 0xd4, 0x08, 0x57, 0x28, 0x16, 0xc1,
+    0xd7, 0x47, 0x15, 0xc1, 0xd7, 0x59, 0xc4, 0x5d, 0xe2, 0x08, 0x57, 0x09,
+    0x13, 0xc1, 0xd7, 0x69, 0x1a, 0xc1, 0xd7, 0x75, 0xc2, 0x14, 0xda, 0x08,
+    0x56, 0xe1, 0xc2, 0x00, 0x67, 0x08, 0x56, 0xd9, 0x03, 0xc1, 0xd7, 0x81,
+    0xc3, 0x20, 0x18, 0x08, 0x56, 0xb9, 0xc3, 0x00, 0x4e, 0x08, 0x56, 0xb1,
+    0x06, 0xc1, 0xd7, 0x93, 0xc6, 0xcf, 0xd7, 0x08, 0x56, 0x99, 0x0d, 0xc1,
+    0xd7, 0x9f, 0xc4, 0x4a, 0xb9, 0x08, 0x56, 0x79, 0xc2, 0x01, 0x7f, 0x08,
+    0x56, 0x33, 0x01, 0xd7, 0xab, 0x0c, 0xc1, 0xd7, 0xb1, 0x1c, 0xc1, 0xd7,
+    0xbd, 0xc3, 0x7e, 0x89, 0x08, 0x56, 0x39, 0x09, 0xc1, 0xd7, 0xc9, 0x04,
+    0x41, 0xd7, 0xd5, 0xd8, 0x22, 0xd3, 0x0f, 0xab, 0xa1, 0xc6, 0xd1, 0xdb,
+    0x0f, 0xc9, 0xa8, 0xc6, 0xd2, 0x9b, 0x0f, 0xa3, 0x99, 0xca, 0xa1, 0x66,
+    0x0f, 0xa3, 0x90, 0x03, 0xc1, 0xd7, 0xe1, 0xc3, 0xa7, 0x52, 0x00, 0x42,
+    0xb9, 0xc8, 0xb9, 0xc2, 0x00, 0x42, 0xb1, 0x0b, 0xc1, 0xd8, 0x28, 0xc7,
+    0xb9, 0xc3, 0x00, 0x42, 0x29, 0xc5, 0xd6, 0xc3, 0x00, 0x42, 0x00, 0xcc,
+    0x85, 0xd1, 0x08, 0x8b, 0xb1, 0x46, 0x02, 0x0f, 0x41, 0xd8, 0x30, 0xcb,
+    0x45, 0x8e, 0x08, 0x8b, 0xa9, 0xc9, 0xad, 0xb6, 0x08, 0x8b, 0x98, 0xc5,
+    0x06, 0xbb, 0x0f, 0x81, 0x49, 0xc8, 0xb5, 0xa2, 0x0f, 0x80, 0x11, 0xcb,
+    0x8f, 0x3c, 0x0f, 0x80, 0x30, 0xc8, 0xbd, 0xa2, 0x0f, 0x80, 0x01, 0x48,
+    0xae, 0x47, 0x41, 0xd8, 0x8a, 0xc9, 0xab, 0xbe, 0x0f, 0x80, 0x09, 0x46,
+    0xd1, 0xf9, 0xc1, 0xd8, 0x94, 0x48, 0xb5, 0x32, 0xc1, 0xd8, 0x9e, 0xc5,
+    0xc1, 0x78, 0x0f, 0x81, 0x31, 0xc5, 0xda, 0x60, 0x0f, 0x81, 0x38, 0xc9,
+    0xac, 0x06, 0x0f, 0x80, 0x19, 0x47, 0xbb, 0x83, 0x41, 0xd8, 0xa8, 0x46,
+    0xbb, 0x84, 0xc1, 0xd8, 0xb2, 0xc5, 0xd6, 0xf0, 0x0f, 0x81, 0x18, 0x46,
+    0xd2, 0xe9, 0xc1, 0xd8, 0xbc, 0x48, 0xbe, 0x4a, 0x41, 0xd8, 0xc6, 0x47,
+    0xc5, 0x7c, 0xc1, 0xd8, 0xd0, 0x47, 0xc7, 0x2e, 0x41, 0xd8, 0xda, 0xc2,
+    0x00, 0x3b, 0x0f, 0x81, 0x59, 0xc4, 0x8e, 0x88, 0x0f, 0x81, 0x20, 0x15,
+    0xc1, 0xd8, 0xe4, 0xc8, 0x87, 0xb5, 0x0f, 0x9d, 0xcb, 0x01, 0xd8, 0xf0,
+    0xc4, 0x23, 0x2e, 0x0f, 0x9d, 0xa8, 0xca, 0xa2, 0xba, 0x01, 0x33, 0x79,
+    0xcc, 0x83, 0xf1, 0x01, 0x33, 0x71, 0xc9, 0xb3, 0xb0, 0x01, 0x33, 0x68,
+    0x48, 0x1f, 0x1f, 0xc1, 0xd8, 0xf6, 0xcf, 0x65, 0x2b, 0x0f, 0x9d, 0xb0,
+    0x00, 0x41, 0xd9, 0x03, 0x14, 0xc1, 0xd9, 0x0f, 0xc2, 0x00, 0xd0, 0x08,
+    0x95, 0x31, 0xc2, 0x0d, 0xf6, 0x08, 0x95, 0x29, 0xc2, 0x02, 0x41, 0x08,
+    0x95, 0x21, 0xc2, 0x00, 0xdb, 0x08, 0x95, 0x19, 0xc2, 0x19, 0x2c, 0x08,
+    0x95, 0x09, 0xc2, 0x01, 0xc3, 0x08, 0x95, 0x01, 0x04, 0xc1, 0xd9, 0x1f,
+    0x12, 0xc1, 0xd9, 0x29, 0x10, 0xc1, 0xd9, 0x33, 0x06, 0xc1, 0xd9, 0x43,
+    0x16, 0xc1, 0xd9, 0x51, 0x0c, 0xc1, 0xd9, 0x5f, 0x05, 0xc1, 0xd9, 0x69,
+    0x09, 0xc1, 0xd9, 0x73, 0x0d, 0xc1, 0xd9, 0x7d, 0x87, 0x08, 0x94, 0x19,
+    0x83, 0x08, 0x94, 0x01, 0x8b, 0x08, 0x94, 0x09, 0x97, 0x08, 0x94, 0x10,
+    0xc4, 0x18, 0x10, 0x0b, 0x53, 0x39, 0xc2, 0x22, 0xcc, 0x0b, 0x53, 0x30,
+    0xc3, 0x0d, 0x14, 0x0b, 0x53, 0x29, 0xc3, 0x09, 0x9e, 0x0b, 0x53, 0x20,
+    0xc4, 0x02, 0xde, 0x0b, 0x53, 0x19, 0xc2, 0x02, 0xa0, 0x0b, 0x53, 0x10,
+    0xa2, 0x05, 0x53, 0xe9, 0x9f, 0x05, 0x53, 0xe0, 0x44, 0x00, 0xd0, 0xc1,
+    0xd9, 0x87, 0xc6, 0x00, 0x41, 0x00, 0x82, 0x58, 0xc7, 0x14, 0x39, 0x00,
+    0x81, 0xb1, 0xc3, 0x89, 0x6c, 0x00, 0x81, 0xd0, 0xc5, 0x40, 0xe7, 0x00,
+    0x81, 0xc1, 0xc4, 0x1e, 0x97, 0x00, 0x81, 0xc8, 0x9e, 0x00, 0x83, 0x49,
+    0x9f, 0x00, 0x83, 0x51, 0xa0, 0x00, 0x83, 0x59, 0xa1, 0x00, 0x83, 0x61,
+    0xa2, 0x00, 0x83, 0x68, 0x9e, 0x00, 0x84, 0xd1, 0xa0, 0x00, 0x84, 0xd8,
+    0x45, 0xc7, 0x97, 0xc1, 0xd9, 0x99, 0xcd, 0x7b, 0xb1, 0x00, 0x82, 0x70,
+    0xc3, 0x05, 0x14, 0x00, 0x84, 0xf1, 0xcb, 0x0f, 0x09, 0x00, 0x84, 0xf8,
+    0xc2, 0x02, 0xa0, 0x00, 0x84, 0x91, 0xc4, 0x02, 0xde, 0x00, 0x84, 0x98,
+    0xc3, 0x09, 0x9e, 0x00, 0x84, 0xa1, 0xc3, 0x0d, 0x14, 0x00, 0x84, 0xa8,
+    0xc2, 0x22, 0xcc, 0x00, 0x84, 0xb1, 0xc4, 0x18, 0x10, 0x00, 0x84, 0xb8,
+    0xc7, 0xc7, 0x97, 0x05, 0x53, 0xd1, 0x97, 0x00, 0x81, 0x50, 0xc2, 0x00,
+    0xd0, 0x00, 0x80, 0x0b, 0x01, 0xd9, 0xab, 0x83, 0x00, 0x80, 0x00, 0x83,
+    0x00, 0x80, 0x83, 0x01, 0xd9, 0xb1, 0x16, 0xc1, 0xd9, 0xb7, 0xc2, 0x00,
+    0xd0, 0x00, 0x80, 0x88, 0x0a, 0xc1, 0xd9, 0xc1, 0x83, 0x00, 0x80, 0xf1,
+    0xc2, 0x0d, 0xf6, 0x00, 0x82, 0x89, 0xcd, 0x7c, 0x19, 0x00, 0x83, 0x08,
+    0x83, 0x00, 0x80, 0x11, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0x19, 0xc7, 0xbd,
+    0xeb, 0x00, 0x81, 0xf8, 0xc2, 0x01, 0x30, 0x00, 0x80, 0x21, 0xc2, 0x19,
+    0x2c, 0x00, 0x80, 0x49, 0x10, 0xc1, 0xd9, 0xce, 0x83, 0x00, 0x80, 0xa0,
+    0x83, 0x00, 0x80, 0x29, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0x30, 0x83, 0x00,
+    0x80, 0x39, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0x40, 0x06, 0xc1, 0xd9, 0xd8,
+    0x83, 0x00, 0x80, 0x91, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0x98, 0x83, 0x00,
+    0x80, 0xa9, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0xb0, 0x83, 0x00, 0x80, 0xb9,
+    0xc2, 0x00, 0xd0, 0x00, 0x80, 0xc0, 0x83, 0x00, 0x80, 0xc9, 0x43, 0x01,
+    0x55, 0x41, 0xd9, 0xe2, 0x83, 0x00, 0x80, 0xd9, 0xcf, 0x65, 0x0d, 0x00,
+    0x84, 0x70, 0x83, 0x00, 0x80, 0xe1, 0xc2, 0x00, 0xdb, 0x00, 0x81, 0x00,
+    0x83, 0x00, 0x80, 0xe9, 0x51, 0x28, 0xa0, 0x41, 0xd9, 0xf8, 0x8b, 0x00,
+    0x81, 0x20, 0x97, 0x00, 0x81, 0x30, 0x51, 0x50, 0x02, 0x41, 0xda, 0x04,
+    0x94, 0x00, 0x82, 0x93, 0x01, 0xda, 0x16, 0x8e, 0x00, 0x82, 0xa2, 0x01,
+    0xda, 0x1a, 0xc4, 0x18, 0x10, 0x05, 0x4f, 0xb9, 0xc2, 0x22, 0xcc, 0x05,
+    0x4f, 0xb0, 0xc3, 0x0d, 0x14, 0x05, 0x4f, 0xa9, 0xc3, 0x09, 0x9e, 0x05,
+    0x4f, 0xa0, 0xc4, 0x02, 0xde, 0x05, 0x4f, 0x99, 0xc2, 0x02, 0xa0, 0x05,
+    0x4f, 0x90, 0xc5, 0xd5, 0xc9, 0x00, 0x84, 0xe2, 0x01, 0xda, 0x1e, 0x94,
+    0x00, 0x82, 0xb8, 0x8e, 0x00, 0x82, 0xc8, 0xc2, 0x04, 0xc6, 0x00, 0x84,
+    0x19, 0x87, 0x00, 0x84, 0x23, 0x01, 0xda, 0x22, 0xc7, 0xca, 0x30, 0x00,
+    0x84, 0x30, 0xc2, 0x19, 0x2c, 0x00, 0x81, 0xd9, 0xc2, 0x00, 0x39, 0x00,
+    0x81, 0xe1, 0xc2, 0x01, 0x4a, 0x00, 0x81, 0xe9, 0xc2, 0x00, 0xd0, 0x00,
+    0x81, 0xf0, 0xc2, 0x00, 0xc1, 0x00, 0x82, 0xf1, 0xc2, 0x01, 0xc3, 0x00,
+    0x82, 0xf9, 0xc2, 0x00, 0xdb, 0x00, 0x83, 0x00, 0x15, 0xc1, 0xda, 0x28,
+    0x83, 0x01, 0x85, 0x13, 0x01, 0xda, 0x42, 0x0f, 0xc1, 0xda, 0x48, 0x8b,
+    0x01, 0x85, 0x21, 0x97, 0x01, 0x85, 0x31, 0x87, 0x01, 0x85, 0x41, 0x91,
+    0x01, 0x85, 0x51, 0x0d, 0xc1, 0xda, 0x5f, 0x09, 0xc1, 0xda, 0x73, 0x1c,
+    0xc1, 0xda, 0x87, 0x16, 0xc1, 0xda, 0x9b, 0x06, 0xc1, 0xda, 0xaf, 0x90,
+    0x01, 0x87, 0x9b, 0x01, 0xda, 0xc3, 0x0a, 0xc1, 0xda, 0xd7, 0x04, 0xc1,
+    0xda, 0xeb, 0x12, 0xc1, 0xda, 0xff, 0x1b, 0xc1, 0xdb, 0x13, 0x14, 0xc1,
+    0xdb, 0x1f, 0x19, 0xc1, 0xdb, 0x33, 0x18, 0x41, 0xdb, 0x43, 0x97, 0x08,
+    0x85, 0xc1, 0x8b, 0x08, 0x85, 0xb1, 0x83, 0x08, 0x85, 0x80, 0x97, 0x08,
+    0x85, 0xa0, 0x8b, 0x08, 0x85, 0x90, 0xc5, 0x86, 0x20, 0x08, 0x86, 0x09,
+    0xcc, 0x45, 0x8d, 0x08, 0x85, 0xf8, 0xc5, 0x33, 0x5d, 0x08, 0x85, 0xd1,
+    0x42, 0x07, 0xb2, 0xc1, 0xdb, 0x57, 0xc8, 0x14, 0x38, 0x08, 0x84, 0x09,
+    0xcb, 0x1e, 0x89, 0x08, 0x84, 0x00, 0x83, 0x08, 0x85, 0x71, 0xc2, 0x0d,
+    0xf6, 0x08, 0x85, 0x69, 0xc2, 0x00, 0xd0, 0x08, 0x85, 0x60, 0x83, 0x08,
+    0x85, 0x49, 0xc2, 0x00, 0xd0, 0x08, 0x84, 0xe0, 0xc2, 0x00, 0xd0, 0x08,
+    0x85, 0x31, 0x83, 0x08, 0x85, 0x28, 0xc2, 0x00, 0xd0, 0x08, 0x85, 0x21,
+    0x83, 0x08, 0x85, 0x18, 0x83, 0x08, 0x85, 0x11, 0xc2, 0x00, 0xc1, 0x08,
+    0x84, 0xe9, 0xc2, 0x19, 0x2c, 0x08, 0x84, 0xb1, 0xc2, 0x01, 0x30, 0x08,
+    0x84, 0x88, 0xc2, 0x00, 0xd0, 0x08, 0x85, 0x09, 0x83, 0x08, 0x85, 0x01,
+    0x06, 0x41, 0xdb, 0x63, 0xc2, 0x00, 0xd0, 0x08, 0x84, 0xf9, 0x83, 0x08,
+    0x84, 0xf1, 0x16, 0x41, 0xdb, 0x73, 0xc2, 0x00, 0xd0, 0x08, 0x84, 0xa9,
+    0x83, 0x08, 0x84, 0xa0, 0xc2, 0x00, 0xd0, 0x08, 0x84, 0x99, 0x83, 0x08,
+    0x84, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0x84, 0x81, 0x83, 0x08, 0x84, 0x78,
+    0xc2, 0x00, 0xd0, 0x08, 0x84, 0x71, 0x83, 0x08, 0x84, 0x68, 0x97, 0x08,
+    0x84, 0x61, 0x8b, 0x08, 0x84, 0x51, 0x83, 0x08, 0x84, 0x20, 0x97, 0x08,
+    0x84, 0x40, 0x8b, 0x08, 0x84, 0x30, 0xc7, 0xca, 0x76, 0x05, 0x49, 0x68,
+    0x87, 0x05, 0x49, 0x48, 0x87, 0x05, 0x49, 0x30, 0x91, 0x05, 0x49, 0x29,
+    0x87, 0x05, 0x49, 0x18, 0x83, 0x05, 0x48, 0xf9, 0xc2, 0x01, 0x6f, 0x05,
+    0x48, 0x98, 0xc2, 0x00, 0xd0, 0x05, 0x48, 0xf1, 0x83, 0x05, 0x48, 0x90,
+    0xc2, 0x00, 0xd0, 0x05, 0x48, 0xb1, 0x83, 0x05, 0x48, 0xa8, 0x83, 0x05,
+    0x48, 0xa1, 0xc2, 0x19, 0x2c, 0x05, 0x48, 0x89, 0xc2, 0x01, 0x30, 0x05,
+    0x48, 0x68, 0xc2, 0x00, 0xd0, 0x05, 0x48, 0x79, 0x83, 0x05, 0x48, 0x70,
+    0xc2, 0x00, 0xd0, 0x05, 0x48, 0x59, 0x83, 0x05, 0x48, 0x50, 0xc4, 0x18,
+    0x10, 0x05, 0x48, 0x39, 0xc2, 0x22, 0xcc, 0x05, 0x48, 0x30, 0xc3, 0x0d,
+    0x14, 0x05, 0x48, 0x29, 0xc3, 0x09, 0x9e, 0x05, 0x48, 0x20, 0xc4, 0x02,
+    0xde, 0x05, 0x48, 0x19, 0xc2, 0x02, 0xa0, 0x05, 0x48, 0x10, 0x15, 0xc1,
+    0xdb, 0x7d, 0xcb, 0x1e, 0x89, 0x00, 0x64, 0x09, 0x03, 0xc1, 0xdb, 0x89,
+    0x42, 0x07, 0xb2, 0xc1, 0xdb, 0x95, 0xc5, 0x33, 0x5d, 0x00, 0x65, 0xe1,
+    0xcb, 0x8f, 0xe1, 0x00, 0x67, 0x89, 0xcb, 0x93, 0xf6, 0x00, 0x67, 0x90,
+    0x45, 0x02, 0x10, 0xc1, 0xdb, 0xa1, 0xc9, 0x36, 0x53, 0x00, 0x66, 0xa8,
+    0x03, 0xc1, 0xdc, 0x10, 0x8b, 0x00, 0x65, 0xfb, 0x01, 0xdc, 0x1c, 0x97,
+    0x00, 0x66, 0x0b, 0x01, 0xdc, 0x20, 0x48, 0xb2, 0x2d, 0xc1, 0xdc, 0x24,
+    0x87, 0x00, 0x66, 0x33, 0x01, 0xdc, 0x32, 0x91, 0x00, 0x66, 0x52, 0x01,
+    0xdc, 0x36, 0xc4, 0x15, 0xe7, 0x00, 0x67, 0x31, 0xc3, 0x05, 0x14, 0x00,
+    0x67, 0x39, 0x16, 0xc1, 0xdc, 0x3a, 0x08, 0xc1, 0xdc, 0x46, 0x15, 0xc1,
+    0xdc, 0x52, 0xc5, 0x06, 0xdb, 0x00, 0x67, 0x71, 0xc4, 0x26, 0x78, 0x00,
+    0x67, 0x78, 0x11, 0xc1, 0xdc, 0x5e, 0x0e, 0xc1, 0xdc, 0x71, 0x06, 0xc1,
+    0xdc, 0x86, 0x15, 0xc1, 0xdc, 0x96, 0x0a, 0xc1, 0xdc, 0xe0, 0x16, 0xc1,
+    0xdc, 0xf2, 0x0f, 0xc1, 0xdd, 0x17, 0x07, 0xc1, 0xdd, 0x29, 0x05, 0xc1,
+    0xdd, 0x4c, 0x0b, 0xc1, 0xdd, 0x64, 0xc5, 0xa0, 0xc1, 0x01, 0x78, 0x89,
+    0x12, 0xc1, 0xdd, 0x6e, 0x19, 0xc1, 0xdd, 0x84, 0x14, 0xc1, 0xdd, 0x9e,
+    0x03, 0xc1, 0xdd, 0xb8, 0x09, 0xc1, 0xdd, 0xd0, 0x04, 0xc1, 0xdd, 0xe9,
+    0x10, 0xc1, 0xde, 0x03, 0x08, 0xc1, 0xde, 0x0d, 0x42, 0x25, 0x3b, 0xc1,
+    0xde, 0x2f, 0xc3, 0x26, 0x9b, 0x01, 0x7b, 0x21, 0x18, 0xc1, 0xde, 0x39,
+    0xc6, 0xc6, 0x9b, 0x01, 0x7e, 0x40, 0x06, 0xc1, 0xde, 0x45, 0x05, 0xc1,
+    0xde, 0x5d, 0x04, 0xc1, 0xde, 0x9d, 0x03, 0xc1, 0xde, 0xdd, 0x26, 0xc1,
+    0xdf, 0x1d, 0x25, 0xc1, 0xdf, 0x5d, 0x24, 0xc1, 0xdf, 0x9d, 0x23, 0xc1,
+    0xdf, 0xdd, 0x22, 0xc1, 0xe0, 0x1d, 0x21, 0xc1, 0xe0, 0x5d, 0x20, 0xc1,
+    0xe0, 0x9d, 0x1f, 0xc1, 0xe0, 0xdd, 0x1e, 0xc1, 0xe1, 0x1d, 0x1d, 0x41,
+    0xe1, 0x5d, 0x08, 0xc1, 0xe1, 0x9d, 0x07, 0xc1, 0xe1, 0xdd, 0x06, 0xc1,
+    0xe2, 0x1d, 0x05, 0xc1, 0xe2, 0x5d, 0x04, 0xc1, 0xe2, 0x9d, 0x03, 0xc1,
+    0xe2, 0xdd, 0x26, 0xc1, 0xe3, 0x1d, 0x25, 0xc1, 0xe3, 0x5d, 0x24, 0xc1,
+    0xe3, 0x9d, 0x23, 0xc1, 0xe3, 0xdd, 0x22, 0xc1, 0xe4, 0x1d, 0x21, 0xc1,
+    0xe4, 0x5d, 0x20, 0xc1, 0xe4, 0x9d, 0x1f, 0xc1, 0xe4, 0xdd, 0x1e, 0xc1,
+    0xe5, 0x1d, 0x1d, 0x41, 0xe5, 0x5d, 0xc4, 0x18, 0x10, 0x08, 0x97, 0xb9,
+    0xc2, 0x22, 0xcc, 0x08, 0x97, 0xb0, 0xc3, 0x0d, 0x14, 0x08, 0x97, 0xa9,
+    0xc3, 0x09, 0x9e, 0x08, 0x97, 0xa0, 0xc4, 0x02, 0xde, 0x08, 0x97, 0x99,
+    0xc2, 0x02, 0xa0, 0x08, 0x97, 0x90, 0x8b, 0x08, 0x97, 0x31, 0x83, 0x08,
+    0x97, 0x01, 0x97, 0x08, 0x97, 0x40, 0x97, 0x08, 0x97, 0x20, 0x8b, 0x08,
+    0x97, 0x10, 0x83, 0x08, 0x96, 0xe9, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0xe0,
+    0x83, 0x08, 0x96, 0xc9, 0xc2, 0x00, 0x39, 0x08, 0x96, 0x50, 0xc2, 0x00,
+    0xd0, 0x08, 0x96, 0xb1, 0xc2, 0x01, 0x5d, 0x08, 0x96, 0xa9, 0x83, 0x08,
+    0x96, 0xa0, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0x99, 0x83, 0x08, 0x96, 0x90,
+    0x83, 0x08, 0x96, 0x89, 0xc2, 0x00, 0xc1, 0x08, 0x96, 0x61, 0xc2, 0x19,
+    0x2c, 0x08, 0x96, 0x29, 0xc2, 0x01, 0x30, 0x08, 0x95, 0xf8, 0xc2, 0x00,
+    0xd0, 0x08, 0x96, 0x81, 0x83, 0x08, 0x96, 0x79, 0x06, 0x41, 0xe5, 0x9d,
+    0xc2, 0x00, 0xd0, 0x08, 0x96, 0x71, 0x83, 0x08, 0x96, 0x69, 0x16, 0x41,
+    0xe5, 0xad, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0x21, 0xc2, 0x25, 0x3b, 0x08,
+    0x96, 0x19, 0x83, 0x08, 0x96, 0x10, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0x09,
+    0x83, 0x08, 0x96, 0x00, 0xc2, 0x00, 0xd0, 0x08, 0x95, 0xf1, 0xc2, 0x01,
+    0x30, 0x08, 0x95, 0xe9, 0x83, 0x08, 0x95, 0xe0, 0xc2, 0x00, 0xd0, 0x08,
+    0x95, 0xd9, 0x83, 0x08, 0x95, 0xd0, 0x97, 0x08, 0x95, 0xc9, 0x8b, 0x08,
+    0x95, 0xb9, 0x83, 0x08, 0x95, 0x88, 0x97, 0x08, 0x95, 0xa8, 0x8b, 0x08,
+    0x95, 0x98, 0x15, 0xc1, 0xe5, 0xb7, 0xc5, 0x33, 0x5d, 0x08, 0x91, 0xb1,
+    0xc6, 0x1e, 0x95, 0x08, 0x91, 0xa9, 0xc8, 0x14, 0x38, 0x08, 0x91, 0xa0,
+    0xcc, 0x45, 0x8d, 0x08, 0x91, 0xe1, 0xc5, 0x86, 0x20, 0x08, 0x91, 0xc8,
+    0x97, 0x08, 0x91, 0x99, 0x8b, 0x08, 0x91, 0x89, 0x83, 0x08, 0x91, 0x60,
+    0x8b, 0x08, 0x91, 0x70, 0xc2, 0x00, 0xdb, 0x08, 0x91, 0x59, 0x83, 0x08,
+    0x91, 0x38, 0xc2, 0x00, 0xd0, 0x08, 0x91, 0x19, 0xc2, 0x01, 0x5d, 0x08,
+    0x91, 0x11, 0x83, 0x08, 0x91, 0x08, 0xc2, 0x00, 0xd0, 0x08, 0x91, 0x01,
+    0x83, 0x08, 0x90, 0xf8, 0x83, 0x08, 0x90, 0xf1, 0xc2, 0x00, 0xc1, 0x08,
+    0x90, 0xc1, 0xc2, 0x19, 0x2c, 0x08, 0x90, 0x99, 0xc2, 0x01, 0x30, 0x08,
+    0x90, 0x68, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0xe9, 0x06, 0xc1, 0xe5, 0xc3,
+    0x83, 0x08, 0x90, 0xd8, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0xd1, 0x83, 0x08,
+    0x90, 0xc9, 0x16, 0x41, 0xe5, 0xd3, 0xc2, 0x25, 0x3b, 0x08, 0x90, 0x89,
+    0x83, 0x08, 0x90, 0x80, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0x79, 0x83, 0x08,
+    0x90, 0x70, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0x61, 0xc2, 0x01, 0x30, 0x08,
+    0x90, 0x59, 0x83, 0x08, 0x90, 0x50, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0x49,
+    0x83, 0x08, 0x90, 0x40, 0x97, 0x08, 0x90, 0x39, 0x8b, 0x08, 0x90, 0x29,
+    0x83, 0x08, 0x90, 0x08, 0x43, 0x4e, 0xf0, 0xc1, 0xe5, 0xdd, 0x12, 0xc1,
+    0xe5, 0xe5, 0x04, 0xc1, 0xe5, 0xf7, 0x45, 0xda, 0x97, 0xc1, 0xe6, 0x03,
+    0xc9, 0xb2, 0x51, 0x00, 0xcf, 0x81, 0x4a, 0xa2, 0x42, 0x41, 0xe6, 0x0f,
+    0x03, 0xc1, 0xe6, 0x23, 0x0d, 0xc1, 0xe6, 0x35, 0xcb, 0x93, 0x93, 0x00,
+    0xbe, 0xc9, 0x04, 0xc1, 0xe6, 0x47, 0xc7, 0xc2, 0x1f, 0x00, 0xbe, 0xb9,
+    0x05, 0xc1, 0xe6, 0x51, 0xc6, 0xcb, 0x69, 0x00, 0xbe, 0x89, 0xcd, 0x78,
+    0x23, 0x00, 0xbe, 0x81, 0x16, 0xc1, 0xe6, 0x5d, 0x14, 0xc1, 0xe6, 0x69,
+    0xcb, 0x99, 0xfa, 0x00, 0xbe, 0x49, 0xcd, 0x7d, 0x1d, 0x00, 0xbe, 0x41,
+    0xc7, 0xc4, 0x41, 0x00, 0xbe, 0x30, 0xc4, 0x18, 0x10, 0x00, 0xbf, 0x39,
+    0xc2, 0x22, 0xcc, 0x00, 0xbf, 0x30, 0xc3, 0x0d, 0x14, 0x00, 0xbf, 0x29,
+    0xc3, 0x09, 0x9e, 0x00, 0xbf, 0x20, 0xc4, 0x02, 0xde, 0x00, 0xbf, 0x19,
+    0xc2, 0x02, 0xa0, 0x00, 0xbf, 0x10, 0x03, 0xc1, 0xe6, 0x75, 0x11, 0xc1,
+    0xe6, 0x85, 0x87, 0x00, 0xbe, 0x09, 0x8b, 0x00, 0xbd, 0xbb, 0x01, 0xe6,
+    0x8d, 0x9b, 0x00, 0xbd, 0xcb, 0x01, 0xe6, 0x95, 0x97, 0x00, 0xbd, 0xda,
+    0x01, 0xe6, 0x9d, 0x83, 0x00, 0xbd, 0xa9, 0x93, 0x00, 0xbd, 0xa0, 0x03,
+    0xc1, 0xe6, 0xa5, 0x48, 0xb7, 0x6a, 0xc1, 0xe6, 0xb5, 0x87, 0x00, 0xbd,
+    0x79, 0x97, 0x00, 0xbd, 0x3b, 0x01, 0xe6, 0xc1, 0x8b, 0x00, 0xbd, 0x2a,
+    0x01, 0xe6, 0xcc, 0x9b, 0x00, 0xbd, 0x70, 0x9b, 0x00, 0xbd, 0x60, 0x83,
+    0x00, 0xbd, 0x09, 0x91, 0x00, 0xbc, 0xd8, 0x83, 0x00, 0xbc, 0xf9, 0xc2,
+    0x00, 0xfb, 0x00, 0xbc, 0xf1, 0xc2, 0x00, 0xd0, 0x00, 0xbc, 0xe8, 0x0a,
+    0xc1, 0xe6, 0xd0, 0x91, 0x00, 0xbc, 0xb0, 0x91, 0x00, 0xbc, 0x99, 0xc2,
+    0x00, 0x10, 0x00, 0xbc, 0x71, 0xc2, 0x42, 0xcd, 0x00, 0xbc, 0x49, 0xc2,
+    0x0f, 0x7b, 0x00, 0xbc, 0x20, 0x0a, 0xc1, 0xe6, 0xd8, 0x91, 0x00, 0xbc,
+    0x89, 0x83, 0x00, 0xbc, 0x79, 0x42, 0x00, 0x8e, 0x41, 0xe6, 0xe0, 0x91,
+    0x00, 0xbc, 0x61, 0x83, 0x00, 0xbc, 0x50, 0x0a, 0xc1, 0xe6, 0xe8, 0x91,
+    0x00, 0xbc, 0x39, 0x83, 0x00, 0xbc, 0x28, 0x0a, 0xc1, 0xe6, 0xf0, 0x91,
+    0x00, 0xbc, 0x11, 0x83, 0x00, 0xbc, 0x00, 0xc4, 0x22, 0xd6, 0x08, 0x52,
+    0xc1, 0xc4, 0x6e, 0x13, 0x08, 0x52, 0xa8, 0x11, 0xc1, 0xe6, 0xf8, 0xc4,
+    0x19, 0x53, 0x08, 0x52, 0xb0, 0xcb, 0x80, 0xaa, 0x08, 0x52, 0x99, 0xc5,
+    0x02, 0xd2, 0x08, 0x52, 0x90, 0xc8, 0x4b, 0x94, 0x08, 0x52, 0x39, 0xc7,
+    0x0d, 0x04, 0x08, 0x52, 0x30, 0xc5, 0x28, 0xee, 0x08, 0x52, 0x29, 0xc2,
+    0x00, 0xc4, 0x08, 0x52, 0x20, 0xc4, 0x02, 0xde, 0x08, 0x52, 0x11, 0xc2,
+    0x02, 0xa0, 0x08, 0x52, 0x08, 0xcb, 0x36, 0x51, 0x08, 0x50, 0x61, 0x45,
+    0x00, 0xba, 0x41, 0xe7, 0x02, 0xc7, 0x0e, 0x70, 0x08, 0x51, 0xd1, 0xcf,
+    0x65, 0xa3, 0x08, 0x50, 0x68, 0xc2, 0x00, 0xd0, 0x08, 0x51, 0xa9, 0x83,
+    0x08, 0x51, 0x60, 0x16, 0xc1, 0xe7, 0x18, 0xc2, 0x00, 0xd0, 0x08, 0x51,
+    0x01, 0x83, 0x08, 0x50, 0xf8, 0xc2, 0x00, 0xd0, 0x08, 0x51, 0x39, 0x83,
+    0x08, 0x51, 0x30, 0xc2, 0x00, 0xd0, 0x08, 0x51, 0x29, 0x83, 0x08, 0x51,
+    0x20, 0x83, 0x08, 0x51, 0x19, 0xc2, 0x00, 0xc1, 0x08, 0x50, 0xf1, 0xc2,
+    0x19, 0x2c, 0x08, 0x50, 0xc8, 0xc2, 0x00, 0xd0, 0x08, 0x51, 0x11, 0x83,
+    0x08, 0x51, 0x09, 0x06, 0x41, 0xe7, 0x26, 0xc2, 0x00, 0xd0, 0x08, 0x50,
+    0xb1, 0x83, 0x08, 0x50, 0xa8, 0xc2, 0x00, 0xd0, 0x08, 0x50, 0x99, 0x83,
+    0x08, 0x50, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0x50, 0x89, 0x83, 0x08, 0x50,
+    0x81, 0xc2, 0x02, 0x2b, 0x08, 0x51, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0x51,
+    0x69, 0xc2, 0x0d, 0xf6, 0x08, 0x51, 0x71, 0x83, 0x08, 0x51, 0x78, 0x46,
+    0x00, 0x8b, 0x41, 0xe7, 0x30, 0xca, 0xa7, 0x92, 0x0f, 0xd2, 0x53, 0x01,
+    0xe7, 0x3c, 0xc5, 0xa8, 0xf7, 0x0f, 0xd0, 0x0b, 0x01, 0xe7, 0x42, 0x0d,
+    0xc1, 0xe7, 0x48, 0xc6, 0xca, 0xfd, 0x0f, 0xd0, 0x1b, 0x01, 0xe7, 0x5a,
+    0xc4, 0xde, 0x83, 0x0f, 0xd0, 0x13, 0x01, 0xe7, 0x60, 0xc4, 0xe3, 0x93,
+    0x0f, 0xd0, 0x2b, 0x01, 0xe7, 0x66, 0x47, 0x45, 0x86, 0x41, 0xe7, 0x6c,
+    0x0b, 0xc1, 0xe7, 0x88, 0xca, 0xa0, 0x26, 0x08, 0xa2, 0xf0, 0x18, 0xc1,
+    0xe7, 0x94, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0xa1, 0x15, 0xc1, 0xe7, 0xa0,
+    0x10, 0xc1, 0xe7, 0xb0, 0x06, 0xc1, 0xe7, 0xc8, 0x16, 0xc1, 0xe7, 0xd6,
+    0x0c, 0xc1, 0xe7, 0xe4, 0x05, 0xc1, 0xe7, 0xee, 0x09, 0xc1, 0xe7, 0xf8,
+    0x0d, 0xc1, 0xe8, 0x02, 0x83, 0x08, 0xa0, 0x03, 0x01, 0xe8, 0x0c, 0x91,
+    0x08, 0xa0, 0x61, 0x87, 0x08, 0xa0, 0x51, 0x97, 0x08, 0xa0, 0x23, 0x01,
+    0xe8, 0x18, 0x8b, 0x08, 0xa0, 0x13, 0x01, 0xe8, 0x1c, 0x12, 0xc1, 0xe8,
+    0x20, 0x04, 0xc1, 0xe8, 0x2a, 0x0f, 0xc1, 0xe8, 0x34, 0xc2, 0x19, 0x2c,
+    0x08, 0xa1, 0x59, 0x14, 0xc1, 0xe8, 0x3e, 0x0e, 0xc1, 0xe8, 0x48, 0xc2,
+    0x01, 0x4a, 0x08, 0xa1, 0x80, 0x46, 0x00, 0x59, 0xc1, 0xe8, 0x52, 0x45,
+    0x09, 0x98, 0xc1, 0xe8, 0x5e, 0xc4, 0x19, 0x53, 0x08, 0xa2, 0x58, 0x03,
+    0xc1, 0xe8, 0x82, 0x91, 0x08, 0xa2, 0x01, 0x87, 0x08, 0xa1, 0xf1, 0x48,
+    0xb2, 0x2d, 0xc1, 0xe8, 0x8e, 0x97, 0x08, 0xa1, 0xc3, 0x01, 0xe8, 0x9c,
+    0x8b, 0x08, 0xa1, 0xb2, 0x01, 0xe8, 0xa0, 0xc8, 0xb9, 0x72, 0x00, 0xce,
+    0xf3, 0x01, 0xe8, 0xa4, 0x16, 0xc1, 0xe8, 0xa8, 0x46, 0x09, 0x97, 0xc1,
+    0xe8, 0xb4, 0x47, 0x02, 0x0e, 0xc1, 0xe8, 0xd8, 0x4b, 0x6f, 0xc7, 0x41,
+    0xe8, 0xea, 0xc9, 0xb2, 0xa2, 0x0f, 0x98, 0xd1, 0xc6, 0x00, 0x91, 0x0f,
+    0x98, 0x88, 0xca, 0xa2, 0x88, 0x01, 0x3a, 0x71, 0xc2, 0x15, 0x95, 0x0f,
+    0x8c, 0x79, 0xc2, 0x00, 0x03, 0x0f, 0x8c, 0x71, 0xc2, 0x0d, 0xf6, 0x0f,
+    0x8c, 0x69, 0xc2, 0x00, 0xb0, 0x0f, 0x8c, 0x61, 0xc2, 0x00, 0x63, 0x0f,
+    0x8c, 0x59, 0x55, 0x0b, 0x11, 0xc1, 0xe9, 0x0a, 0xcd, 0x2c, 0xb2, 0x0f,
+    0xde, 0x20, 0xca, 0xa3, 0xd2, 0x01, 0x27, 0xf9, 0x47, 0x34, 0x2f, 0xc1,
+    0xe9, 0x72, 0x55, 0x0b, 0x11, 0xc1, 0xe9, 0x88, 0xc8, 0x01, 0x92, 0x0f,
+    0xbe, 0xb1, 0xc6, 0x0b, 0x09, 0x0f, 0xbe, 0xc0, 0xc5, 0x0d, 0x20, 0x0f,
+    0xdd, 0xe9, 0xdc, 0x04, 0xcb, 0x0f, 0xdd, 0xf1, 0xc7, 0x3a, 0x19, 0x0f,
+    0xdd, 0xf8, 0xd6, 0x2d, 0xd0, 0x01, 0x14, 0x49, 0xd4, 0x3a, 0x20, 0x01,
+    0x14, 0x40, 0xe0, 0x07, 0x47, 0x01, 0x12, 0x38, 0xca, 0x37, 0x4e, 0x01,
+    0x13, 0xa9, 0xc5, 0x07, 0x62, 0x01, 0x13, 0x88, 0xca, 0x37, 0x4e, 0x01,
+    0x13, 0xa1, 0xc5, 0x07, 0x62, 0x01, 0x13, 0x80, 0xcf, 0x61, 0x11, 0x08,
+    0xcf, 0x21, 0x03, 0xc1, 0xe9, 0xf0, 0x91, 0x08, 0xce, 0xe1, 0x87, 0x08,
+    0xce, 0xd1, 0xc9, 0xb2, 0x2d, 0x08, 0xce, 0xb3, 0x01, 0xe9, 0xfc, 0x97,
+    0x08, 0xce, 0xa3, 0x01, 0xea, 0x00, 0x8b, 0x08, 0xce, 0x92, 0x01, 0xea,
+    0x04, 0xc7, 0xc3, 0x61, 0x08, 0xcf, 0x11, 0x03, 0xc1, 0xea, 0x08, 0x42,
+    0x07, 0xb2, 0x41, 0xea, 0x14, 0x14, 0xc1, 0xea, 0x20, 0x0e, 0xc1, 0xea,
+    0x2a, 0xc2, 0x00, 0xd0, 0x08, 0xce, 0x71, 0x15, 0xc1, 0xea, 0x34, 0x18,
+    0xc1, 0xea, 0x44, 0xc2, 0x19, 0x2c, 0x08, 0xce, 0x39, 0xc2, 0x01, 0xc3,
+    0x08, 0xce, 0x31, 0x04, 0xc1, 0xea, 0x51, 0x12, 0xc1, 0xea, 0x5b, 0x10,
+    0xc1, 0xea, 0x65, 0x06, 0xc1, 0xea, 0x7b, 0x16, 0xc1, 0xea, 0x89, 0x0c,
+    0xc1, 0xea, 0x97, 0x05, 0xc1, 0xea, 0xa1, 0x09, 0xc1, 0xea, 0xab, 0x0d,
+    0xc1, 0xea, 0xb5, 0x83, 0x08, 0xcd, 0x03, 0x01, 0xea, 0xbf, 0x91, 0x08,
+    0xcd, 0x61, 0x87, 0x08, 0xcd, 0x51, 0x97, 0x08, 0xcd, 0x23, 0x01, 0xea,
+    0xcb, 0x8b, 0x08, 0xcd, 0x12, 0x01, 0xea, 0xcf, 0xc3, 0x05, 0x14, 0x08,
+    0x45, 0x3b, 0x01, 0xea, 0xd3, 0x16, 0xc1, 0xea, 0xd9, 0x08, 0x41, 0xea,
+    0xe9, 0x16, 0xc1, 0xea, 0xf5, 0x15, 0xc1, 0xeb, 0x01, 0x46, 0x26, 0xf7,
+    0xc1, 0xeb, 0x0b, 0xc4, 0x5d, 0xe2, 0x08, 0x44, 0xd9, 0xc4, 0xb9, 0x7e,
+    0x08, 0x44, 0xd1, 0xc2, 0x00, 0x67, 0x08, 0x44, 0xc1, 0x03, 0xc1, 0xeb,
+    0x41, 0xc3, 0x20, 0x18, 0x08, 0x44, 0xa9, 0xc3, 0x00, 0x4e, 0x08, 0x44,
+    0x99, 0xc6, 0xcf, 0xd7, 0x08, 0x44, 0x89, 0xc4, 0xe0, 0xe7, 0x08, 0x44,
+    0x79, 0xc4, 0x4a, 0xb9, 0x08, 0x44, 0x69, 0xc2, 0x01, 0x7f, 0x08, 0x44,
+    0x3b, 0x01, 0xeb, 0x4d, 0xc5, 0x4a, 0xb3, 0x08, 0x44, 0x49, 0xc3, 0x7e,
+    0x89, 0x08, 0x44, 0x41, 0xc6, 0x40, 0x9a, 0x08, 0x44, 0x29, 0xc5, 0x9c,
+    0xa2, 0x08, 0x44, 0x21, 0xc4, 0xe3, 0x27, 0x08, 0x44, 0x18, 0x45, 0x20,
+    0x6c, 0xc1, 0xeb, 0x53, 0x45, 0x15, 0xa7, 0xc1, 0xeb, 0x7e, 0x46, 0x09,
+    0x91, 0x41, 0xeb, 0xa9, 0xde, 0x0e, 0x32, 0x0f, 0xaa, 0x19, 0x4a, 0x00,
+    0x27, 0x41, 0xeb, 0xc1, 0xe0, 0x0c, 0x07, 0x01, 0x3d, 0x88, 0xcc, 0x23,
+    0x9f, 0x01, 0x17, 0x60, 0x46, 0x1f, 0x87, 0xc1, 0xeb, 0xc7, 0xc3, 0x00,
+    0xbb, 0x00, 0x05, 0x60, 0xc3, 0x33, 0xa8, 0x01, 0x15, 0x69, 0xc4, 0x1e,
+    0xc9, 0x01, 0x12, 0x08, 0x43, 0x07, 0x28, 0xc1, 0xeb, 0xd3, 0xce, 0x66,
+    0xcf, 0x01, 0x12, 0x49, 0xd6, 0x2b, 0xc0, 0x01, 0x12, 0x21, 0xcc, 0x81,
+    0x99, 0x01, 0x10, 0x48, 0xca, 0x37, 0x4e, 0x01, 0x13, 0x69, 0xc5, 0x07,
+    0x62, 0x01, 0x13, 0x00, 0x86, 0x0f, 0xae, 0x51, 0xc2, 0x09, 0x3b, 0x0f,
+    0xae, 0x48, 0xd6, 0x2b, 0x68, 0x0f, 0xa6, 0xa0, 0x87, 0x0f, 0x09, 0x58,
+    0x91, 0x0f, 0x09, 0x48, 0x83, 0x0f, 0x09, 0x28, 0xc2, 0x00, 0x39, 0x0f,
+    0x09, 0x19, 0x83, 0x0f, 0x08, 0xb0, 0xc2, 0x00, 0xdb, 0x0f, 0x09, 0x09,
+    0x83, 0x0f, 0x08, 0xd0, 0xc2, 0x00, 0xdb, 0x0f, 0x09, 0x01, 0x83, 0x0f,
+    0x08, 0x00, 0x8a, 0x0f, 0x08, 0xf8, 0x12, 0xc1, 0xeb, 0xdf, 0xc2, 0x0f,
+    0x9a, 0x0f, 0x08, 0xc9, 0x16, 0xc1, 0xeb, 0xe9, 0xc2, 0x00, 0x39, 0x0f,
+    0x08, 0x89, 0xc2, 0x19, 0x2c, 0x0f, 0x08, 0x81, 0xc2, 0x00, 0x64, 0x0f,
+    0x08, 0x61, 0xc2, 0x02, 0x2b, 0x0f, 0x08, 0x39, 0x83, 0x0f, 0x08, 0x28,
+    0xc2, 0x00, 0xdb, 0x0f, 0x08, 0xe9, 0x83, 0x0f, 0x08, 0x78, 0xc2, 0x19,
+    0x2c, 0x0f, 0x08, 0xd9, 0x83, 0x0f, 0x08, 0x30, 0xc2, 0x8d, 0x8f, 0x0f,
+    0x08, 0xa1, 0x83, 0x0f, 0x08, 0x19, 0xc2, 0x0d, 0xf6, 0x0f, 0x08, 0x08,
+    0xcc, 0x86, 0x61, 0x0f, 0x09, 0xd9, 0xc6, 0xcc, 0x9b, 0x0f, 0x09, 0xd1,
+    0xc8, 0x7f, 0x59, 0x0f, 0x09, 0xc9, 0xc5, 0xd8, 0x2b, 0x0f, 0x09, 0xc1,
+    0xc6, 0x18, 0x8e, 0x0f, 0x09, 0xb8, 0x08, 0xc1, 0xeb, 0xf9, 0x07, 0xc1,
+    0xec, 0x29, 0x04, 0xc1, 0xec, 0x69, 0x26, 0xc1, 0xec, 0xa9, 0x25, 0xc1,
+    0xec, 0xe9, 0x24, 0xc1, 0xed, 0x29, 0x23, 0xc1, 0xed, 0x69, 0x22, 0xc1,
+    0xed, 0xa9, 0x21, 0xc1, 0xed, 0xe9, 0x20, 0xc1, 0xee, 0x29, 0x1f, 0xc1,
+    0xee, 0x69, 0x1e, 0xc1, 0xee, 0xa9, 0x1d, 0xc1, 0xee, 0xe9, 0x06, 0xc1,
+    0xef, 0x29, 0x05, 0xc1, 0xef, 0x69, 0x03, 0x41, 0xef, 0xa9, 0x08, 0xc1,
+    0xef, 0xe9, 0x07, 0xc1, 0xf0, 0x29, 0x06, 0xc1, 0xf0, 0x69, 0x05, 0xc1,
+    0xf0, 0xa9, 0x04, 0xc1, 0xf0, 0xe9, 0x03, 0xc1, 0xf1, 0x29, 0x26, 0xc1,
+    0xf1, 0x69, 0x25, 0xc1, 0xf1, 0xa9, 0x24, 0x41, 0xf1, 0xe9, 0x42, 0x00,
+    0x28, 0xc1, 0xf2, 0x29, 0xd1, 0x52, 0xcc, 0x01, 0x24, 0xa1, 0xcc, 0x48,
+    0x29, 0x01, 0x24, 0x88, 0xd1, 0x56, 0xa6, 0x01, 0x24, 0xc9, 0xcf, 0x66,
+    0xb1, 0x01, 0x24, 0x90, 0xd2, 0x48, 0x23, 0x01, 0x24, 0xc1, 0x0b, 0x41,
+    0xf2, 0x35, 0xd0, 0x59, 0x52, 0x01, 0x24, 0xb1, 0xd1, 0x53, 0x65, 0x01,
+    0x24, 0xa8, 0xc4, 0x18, 0x10, 0x00, 0x3e, 0x39, 0xc2, 0x22, 0xcc, 0x00,
+    0x3e, 0x30, 0xc3, 0x0d, 0x14, 0x00, 0x3e, 0x29, 0xc3, 0x09, 0x9e, 0x00,
+    0x3e, 0x20, 0xc4, 0x02, 0xde, 0x00, 0x3e, 0x19, 0xc2, 0x02, 0xa0, 0x00,
+    0x3e, 0x10, 0x44, 0xe4, 0x3f, 0xc1, 0xf2, 0x41, 0x83, 0x00, 0x3e, 0xb0,
+    0xc2, 0x19, 0x2c, 0x00, 0x3f, 0x13, 0x01, 0xf2, 0x53, 0x83, 0x00, 0x3f,
+    0x1a, 0x01, 0xf2, 0x59, 0xc2, 0x00, 0x39, 0x00, 0x3e, 0xd1, 0x83, 0x00,
+    0x3e, 0xc8, 0xc8, 0xbc, 0x92, 0x00, 0x3e, 0x88, 0x91, 0x00, 0x3e, 0x78,
+    0x87, 0x00, 0x3e, 0x58, 0xcb, 0x5a, 0x32, 0x00, 0x3f, 0x89, 0xc8, 0xae,
+    0xfb, 0x00, 0x3f, 0x81, 0xc9, 0x3d, 0x18, 0x00, 0x3f, 0x79, 0xcf, 0x64,
+    0x1d, 0x00, 0x3f, 0x70, 0xcb, 0x5a, 0x32, 0x00, 0x3f, 0x69, 0xc8, 0xae,
+    0xfb, 0x00, 0x3f, 0x61, 0xc9, 0x3d, 0x18, 0x00, 0x3f, 0x58, 0x46, 0x00,
+    0x8b, 0x41, 0xf2, 0x5f, 0x95, 0x0f, 0xae, 0x68, 0xc3, 0x23, 0x2f, 0x0f,
+    0xae, 0x2b, 0x01, 0xf2, 0x77, 0xc3, 0x15, 0xa8, 0x0f, 0xd5, 0xc8, 0xc5,
+    0x11, 0x0d, 0x01, 0x1e, 0xd1, 0x45, 0xd9, 0x2f, 0x41, 0xf2, 0x7d, 0xc4,
+    0x9e, 0x9c, 0x0f, 0x99, 0xf1, 0xc5, 0xdb, 0x9b, 0x0f, 0x99, 0xe8, 0x20,
+    0xc1, 0xf2, 0x87, 0x1f, 0xc1, 0xf2, 0xaa, 0x1e, 0xc1, 0xf2, 0xd8, 0x1d,
+    0x41, 0xf3, 0x06, 0xa6, 0x09, 0x82, 0xc9, 0xa5, 0x09, 0x82, 0xc1, 0xa4,
+    0x09, 0x82, 0xb9, 0xa3, 0x09, 0x82, 0xb1, 0xa2, 0x09, 0x82, 0xa3, 0x01,
+    0xf3, 0x30, 0xa1, 0x09, 0x82, 0x99, 0xa0, 0x09, 0x82, 0x91, 0x9f, 0x09,
+    0x82, 0x89, 0x9e, 0x09, 0x82, 0x80, 0x22, 0xc1, 0xf3, 0x34, 0x21, 0xc1,
+    0xf3, 0x3f, 0x20, 0xc1, 0xf3, 0x67, 0x1f, 0xc1, 0xf3, 0x98, 0x1e, 0xc1,
+    0xf3, 0xcc, 0x1d, 0x41, 0xf3, 0xfa, 0x47, 0x07, 0x9a, 0xc1, 0xf4, 0x27,
+    0x44, 0x00, 0xf1, 0x41, 0xf4, 0x33, 0x1e, 0xc1, 0xf4, 0x3f, 0x1d, 0x41,
+    0xf4, 0x5d, 0xa5, 0x09, 0x8c, 0x39, 0xa4, 0x09, 0x8c, 0x31, 0xa3, 0x09,
+    0x8c, 0x23, 0x01, 0xf4, 0x87, 0xa2, 0x09, 0x8c, 0x19, 0xa1, 0x09, 0x8c,
+    0x11, 0xa0, 0x09, 0x8c, 0x09, 0x9f, 0x09, 0x8c, 0x01, 0x9e, 0x09, 0x8b,
+    0xf8, 0xc2, 0xe6, 0x77, 0x09, 0x9d, 0x6b, 0x01, 0xf4, 0x8b, 0x20, 0xc1,
+    0xf4, 0x8f, 0x1f, 0xc1, 0xf4, 0xc3, 0x1e, 0xc1, 0xf4, 0xf7, 0x1d, 0x41,
+    0xf5, 0x25, 0x20, 0xc1, 0xf5, 0x52, 0x1f, 0xc1, 0xf5, 0x5e, 0x1e, 0xc1,
+    0xf5, 0x86, 0x1d, 0x41, 0xf5, 0xae, 0xc2, 0xe4, 0xef, 0x09, 0x82, 0x79,
+    0x23, 0xc1, 0xf5, 0xd5, 0x22, 0xc1, 0xf5, 0xfd, 0x21, 0xc1, 0xf6, 0x25,
+    0x20, 0xc1, 0xf6, 0x59, 0x1f, 0xc1, 0xf6, 0x84, 0x1e, 0xc1, 0xf6, 0xac,
+    0x1d, 0x41, 0xf6, 0xda, 0xa3, 0x09, 0xa0, 0x23, 0x01, 0xf7, 0x04, 0xa2,
+    0x09, 0x9f, 0xd3, 0x01, 0xf7, 0x24, 0xa1, 0x09, 0x9f, 0xc9, 0xa0, 0x09,
+    0x9f, 0xc1, 0x9f, 0x09, 0x9f, 0xb9, 0x9e, 0x09, 0x9f, 0xb1, 0x9d, 0x09,
+    0x9f, 0xa8, 0xa6, 0x09, 0x9f, 0xa1, 0xa5, 0x09, 0x9f, 0x99, 0xa4, 0x09,
+    0x9f, 0x91, 0xa3, 0x09, 0x9f, 0x89, 0xa2, 0x09, 0x9f, 0x7b, 0x01, 0xf7,
+    0x48, 0xa1, 0x09, 0x9f, 0x6b, 0x01, 0xf7, 0x4c, 0xa0, 0x09, 0x9f, 0x53,
+    0x01, 0xf7, 0x50, 0x9f, 0x09, 0x9f, 0x2b, 0x01, 0xf7, 0x58, 0x9e, 0x09,
+    0x9f, 0x20, 0x83, 0x09, 0x9e, 0xe0, 0x83, 0x09, 0x9e, 0xd0, 0x83, 0x09,
+    0x9e, 0xb8, 0x84, 0x09, 0x9e, 0xa1, 0x83, 0x09, 0x9e, 0x98, 0xa2, 0x09,
+    0x9e, 0x71, 0xa1, 0x09, 0x9e, 0x63, 0x01, 0xf7, 0x68, 0xa0, 0x09, 0x9e,
+    0x59, 0x9f, 0x09, 0x9e, 0x51, 0x9e, 0x09, 0x9e, 0x49, 0x9d, 0x09, 0x9e,
+    0x40, 0xa6, 0x09, 0x9e, 0x39, 0xa5, 0x09, 0x9e, 0x2b, 0x01, 0xf7, 0x6c,
+    0xa4, 0x09, 0x9e, 0x1b, 0x01, 0xf7, 0x70, 0xa3, 0x09, 0x9e, 0x11, 0xa2,
+    0x09, 0x9e, 0x09, 0xa1, 0x09, 0x9d, 0xfb, 0x01, 0xf7, 0x74, 0xa0, 0x09,
+    0x9d, 0xf1, 0x9f, 0x09, 0x9d, 0xe9, 0x9e, 0x09, 0x9d, 0xe1, 0x9d, 0x09,
+    0x9d, 0xd2, 0x01, 0xf7, 0x78, 0xa6, 0x09, 0x9d, 0xc3, 0x01, 0xf7, 0x7c,
+    0xa5, 0x09, 0x9d, 0xb9, 0xa4, 0x09, 0x9d, 0xb1, 0xa3, 0x09, 0x9d, 0xa9,
+    0xa2, 0x09, 0x9d, 0xa1, 0xa1, 0x09, 0x9d, 0x99, 0xa0, 0x09, 0x9d, 0x8b,
+    0x01, 0xf7, 0x80, 0x9f, 0x09, 0x9d, 0x81, 0x9e, 0x09, 0x9d, 0x78, 0x9f,
+    0x09, 0x9b, 0x09, 0x9e, 0x09, 0x9b, 0x01, 0x9d, 0x09, 0x9a, 0xf8, 0xa6,
+    0x09, 0x9a, 0xf1, 0xa5, 0x09, 0x9a, 0xe9, 0xa4, 0x09, 0x9a, 0xe1, 0xa3,
+    0x09, 0x9a, 0xd9, 0xa2, 0x09, 0x9a, 0xd1, 0xa1, 0x09, 0x9a, 0xc9, 0xa0,
+    0x09, 0x9a, 0xc1, 0x9f, 0x09, 0x9a, 0xb3, 0x01, 0xf7, 0x84, 0x9e, 0x09,
+    0x9a, 0xa9, 0x9d, 0x09, 0x9a, 0xa0, 0xa6, 0x09, 0x9a, 0x93, 0x01, 0xf7,
+    0x88, 0xa5, 0x09, 0x9a, 0x89, 0xa4, 0x09, 0x9a, 0x81, 0xa3, 0x09, 0x9a,
+    0x79, 0xa2, 0x09, 0x9a, 0x71, 0xa1, 0x09, 0x9a, 0x69, 0xa0, 0x09, 0x9a,
+    0x5b, 0x01, 0xf7, 0x8c, 0x9f, 0x09, 0x9a, 0x51, 0x9e, 0x09, 0x9a, 0x49,
+    0x9d, 0x09, 0x9a, 0x40, 0xa6, 0x09, 0x9a, 0x39, 0xa5, 0x09, 0x9a, 0x31,
+    0xa4, 0x09, 0x9a, 0x29, 0xa3, 0x09, 0x9a, 0x21, 0xa2, 0x09, 0x9a, 0x19,
+    0xa1, 0x09, 0x9a, 0x11, 0xa0, 0x09, 0x9a, 0x09, 0x9f, 0x09, 0x9a, 0x01,
+    0x9e, 0x09, 0x99, 0xf9, 0x9d, 0x09, 0x99, 0xf0, 0xa6, 0x09, 0x99, 0xe9,
+    0xa5, 0x09, 0x99, 0xe1, 0xa4, 0x09, 0x99, 0xd9, 0xa3, 0x09, 0x99, 0xc3,
+    0x01, 0xf7, 0x90, 0xa2, 0x09, 0x99, 0xb9, 0xa1, 0x09, 0x99, 0xb1, 0xa0,
+    0x09, 0x99, 0xa9, 0x9f, 0x09, 0x99, 0xa1, 0x9e, 0x09, 0x99, 0x98, 0xa3,
+    0x09, 0x99, 0x91, 0xa2, 0x09, 0x99, 0x89, 0xa1, 0x09, 0x99, 0x81, 0xa0,
+    0x09, 0x99, 0x73, 0x01, 0xf7, 0x98, 0x9f, 0x09, 0x99, 0x63, 0x01, 0xf7,
+    0x9c, 0x9e, 0x09, 0x99, 0x59, 0x9d, 0x09, 0x99, 0x50, 0xa6, 0x09, 0x99,
+    0x49, 0xa5, 0x09, 0x99, 0x41, 0xa4, 0x09, 0x99, 0x39, 0xa3, 0x09, 0x99,
+    0x31, 0xa2, 0x09, 0x99, 0x29, 0xa1, 0x09, 0x99, 0x21, 0xa0, 0x09, 0x99,
+    0x19, 0x9f, 0x09, 0x99, 0x11, 0x9e, 0x09, 0x99, 0x09, 0x9d, 0x09, 0x99,
+    0x00, 0xa6, 0x09, 0x98, 0xf9, 0xa5, 0x09, 0x98, 0xf1, 0xa4, 0x09, 0x98,
+    0xe9, 0xa3, 0x09, 0x98, 0xdb, 0x01, 0xf7, 0xa0, 0xa2, 0x09, 0x98, 0xd1,
+    0xa1, 0x09, 0x98, 0xc9, 0xa0, 0x09, 0x98, 0xc1, 0x9f, 0x09, 0x98, 0xb9,
+    0x9e, 0x09, 0x98, 0xab, 0x01, 0xf7, 0xa4, 0x9d, 0x09, 0x98, 0xa0, 0xa6,
+    0x09, 0x98, 0x93, 0x01, 0xf7, 0xa8, 0xa5, 0x09, 0x98, 0x83, 0x01, 0xf7,
+    0xac, 0xa4, 0x09, 0x98, 0x73, 0x01, 0xf7, 0xb0, 0xa3, 0x09, 0x98, 0x69,
+    0xa2, 0x09, 0x98, 0x61, 0xa1, 0x09, 0x98, 0x59, 0xa0, 0x09, 0x98, 0x4b,
+    0x01, 0xf7, 0xb4, 0x9f, 0x09, 0x98, 0x41, 0x9e, 0x09, 0x98, 0x38, 0xa3,
+    0x09, 0x98, 0x31, 0xa2, 0x09, 0x98, 0x29, 0xa1, 0x09, 0x98, 0x21, 0xa0,
+    0x09, 0x98, 0x19, 0x9f, 0x09, 0x98, 0x11, 0x9e, 0x09, 0x98, 0x09, 0x9d,
+    0x09, 0x98, 0x00, 0xa6, 0x09, 0x97, 0xf9, 0xa5, 0x09, 0x97, 0xf1, 0xa4,
+    0x09, 0x97, 0xe9, 0xa3, 0x09, 0x97, 0xe1, 0xa2, 0x09, 0x97, 0xd3, 0x01,
+    0xf7, 0xb8, 0xa1, 0x09, 0x97, 0xc9, 0xa0, 0x09, 0x97, 0xc1, 0x9f, 0x09,
+    0x97, 0xb9, 0x9e, 0x09, 0x97, 0xb1, 0x9d, 0x09, 0x97, 0xa8, 0xa6, 0x09,
+    0x97, 0xa1, 0xa5, 0x09, 0x97, 0x99, 0xa4, 0x09, 0x97, 0x91, 0xa3, 0x09,
+    0x97, 0x7b, 0x01, 0xf7, 0xbc, 0xa2, 0x09, 0x97, 0x71, 0xa1, 0x09, 0x97,
+    0x69, 0xa0, 0x09, 0x97, 0x61, 0x9f, 0x09, 0x97, 0x59, 0x9e, 0x09, 0x97,
+    0x51, 0x9d, 0x09, 0x97, 0x48, 0xa6, 0x09, 0x97, 0x41, 0xa5, 0x09, 0x97,
+    0x39, 0xa4, 0x09, 0x97, 0x2b, 0x01, 0xf7, 0xc4, 0xa3, 0x09, 0x97, 0x21,
+    0xa2, 0x09, 0x97, 0x19, 0xa1, 0x09, 0x97, 0x03, 0x01, 0xf7, 0xc8, 0xa0,
+    0x09, 0x96, 0xf9, 0x9f, 0x09, 0x96, 0xf1, 0x9e, 0x09, 0x96, 0xe9, 0x9d,
+    0x09, 0x96, 0xe0, 0xa6, 0x09, 0x96, 0xd9, 0xa5, 0x09, 0x96, 0xd1, 0xa4,
+    0x09, 0x96, 0xc9, 0xa3, 0x09, 0x96, 0xbb, 0x01, 0xf7, 0xd0, 0xa2, 0x09,
+    0x96, 0xb1, 0xa1, 0x09, 0x96, 0xa9, 0xa0, 0x09, 0x96, 0xa1, 0x9f, 0x09,
+    0x96, 0x93, 0x01, 0xf7, 0xd4, 0x9e, 0x09, 0x96, 0x88, 0xa6, 0x09, 0x96,
+    0x81, 0xa5, 0x09, 0x96, 0x79, 0xa4, 0x09, 0x96, 0x71, 0xa3, 0x09, 0x96,
+    0x69, 0xa2, 0x09, 0x96, 0x61, 0xa1, 0x09, 0x96, 0x59, 0xa0, 0x09, 0x96,
+    0x51, 0x9f, 0x09, 0x96, 0x49, 0x9e, 0x09, 0x96, 0x41, 0x9d, 0x09, 0x96,
+    0x38, 0xa6, 0x09, 0x96, 0x31, 0xa5, 0x09, 0x96, 0x29, 0xa4, 0x09, 0x96,
+    0x21, 0xa3, 0x09, 0x96, 0x13, 0x01, 0xf7, 0xd8, 0xa2, 0x09, 0x96, 0x09,
+    0xa1, 0x09, 0x96, 0x01, 0xa0, 0x09, 0x95, 0xf9, 0x9f, 0x09, 0x95, 0xf1,
+    0x9e, 0x09, 0x95, 0xe9, 0x9d, 0x09, 0x95, 0xda, 0x01, 0xf7, 0xdc, 0xa6,
+    0x09, 0x95, 0xd1, 0xa5, 0x09, 0x95, 0xc9, 0xa4, 0x09, 0x95, 0xc1, 0xa3,
+    0x09, 0x95, 0xb9, 0xa2, 0x09, 0x95, 0xb1, 0xa1, 0x09, 0x95, 0xa9, 0xa0,
+    0x09, 0x95, 0x93, 0x01, 0xf7, 0xe0, 0x9f, 0x09, 0x95, 0x83, 0x01, 0xf7,
+    0xe8, 0x9e, 0x09, 0x95, 0x78, 0x9e, 0x09, 0x95, 0x39, 0x9d, 0x09, 0x95,
+    0x30, 0xa6, 0x09, 0x95, 0x29, 0xa5, 0x09, 0x95, 0x21, 0xa4, 0x09, 0x95,
+    0x19, 0xa3, 0x09, 0x95, 0x11, 0xa2, 0x09, 0x95, 0x09, 0xa1, 0x09, 0x95,
+    0x01, 0xa0, 0x09, 0x94, 0xf3, 0x01, 0xf7, 0xec, 0x9f, 0x09, 0x94, 0xe9,
+    0x9e, 0x09, 0x94, 0xda, 0x01, 0xf7, 0xf0, 0x1f, 0xc1, 0xf7, 0xf4, 0x1e,
+    0xc1, 0xf8, 0x03, 0x1d, 0x41, 0xf8, 0x34, 0xc2, 0xdc, 0x39, 0x09, 0x91,
+    0xa9, 0x1e, 0xc1, 0xf8, 0x58, 0x1d, 0x41, 0xf8, 0x83, 0x21, 0xc1, 0xf8,
+    0xaa, 0x20, 0xc1, 0xf8, 0xb6, 0x1f, 0xc1, 0xf8, 0xea, 0x1e, 0xc1, 0xf9,
+    0x15, 0x1d, 0x41, 0xf9, 0x40, 0xa1, 0x09, 0x8f, 0x71, 0xa0, 0x09, 0x8f,
+    0x69, 0x9f, 0x09, 0x8f, 0x61, 0x9e, 0x09, 0x8f, 0x59, 0x9d, 0x09, 0x8f,
+    0x4a, 0x01, 0xf9, 0x64, 0xa6, 0x09, 0x8f, 0x41, 0xa5, 0x09, 0x8f, 0x39,
+    0xa4, 0x09, 0x8f, 0x31, 0xa3, 0x09, 0x8f, 0x29, 0xa2, 0x09, 0x8f, 0x21,
+    0xa1, 0x09, 0x8f, 0x19, 0xa0, 0x09, 0x8f, 0x03, 0x01, 0xf9, 0x68, 0x9f,
+    0x09, 0x8e, 0xf9, 0x9e, 0x09, 0x8e, 0xeb, 0x01, 0xf9, 0x70, 0x9d, 0x09,
+    0x8e, 0xe0, 0xa6, 0x09, 0x8e, 0xd9, 0xa5, 0x09, 0x8e, 0xcb, 0x01, 0xf9,
+    0x74, 0xa4, 0x09, 0x8e, 0xc1, 0xa3, 0x09, 0x8e, 0xb9, 0xa2, 0x09, 0x8e,
+    0xb1, 0xa1, 0x09, 0x8e, 0xa3, 0x01, 0xf9, 0x78, 0xa0, 0x09, 0x8e, 0x99,
+    0x9f, 0x09, 0x8e, 0x8b, 0x01, 0xf9, 0x7c, 0x9e, 0x09, 0x8e, 0x81, 0x9d,
+    0x09, 0x8e, 0x78, 0xa6, 0x09, 0x8e, 0x71, 0xa5, 0x09, 0x8e, 0x69, 0xa4,
+    0x09, 0x8e, 0x5b, 0x01, 0xf9, 0x80, 0xa3, 0x09, 0x8e, 0x4b, 0x01, 0xf9,
+    0x84, 0xa2, 0x09, 0x8e, 0x3b, 0x01, 0xf9, 0x88, 0xa1, 0x09, 0x8e, 0x31,
+    0xa0, 0x09, 0x8e, 0x29, 0x9f, 0x09, 0x8d, 0xe3, 0x01, 0xf9, 0x8c, 0x9e,
+    0x09, 0x8d, 0xd9, 0x9d, 0x09, 0x8d, 0xca, 0x01, 0xf9, 0xac, 0xa6, 0x09,
+    0x8d, 0xc1, 0xa5, 0x09, 0x8d, 0xb9, 0xa4, 0x09, 0x8d, 0xb1, 0xa3, 0x09,
+    0x8d, 0xa9, 0xa2, 0x09, 0x8d, 0xa1, 0xa1, 0x09, 0x8d, 0x99, 0xa0, 0x09,
+    0x8d, 0x8b, 0x01, 0xf9, 0xb0, 0x9f, 0x09, 0x8d, 0x81, 0x9e, 0x09, 0x8d,
+    0x6a, 0x01, 0xf9, 0xb4, 0x83, 0x09, 0x8d, 0x50, 0x83, 0x09, 0x8d, 0x28,
+    0xa1, 0x09, 0x8b, 0xf1, 0xa0, 0x09, 0x8b, 0xe9, 0x9f, 0x09, 0x8b, 0xe1,
+    0x9e, 0x09, 0x8b, 0xd9, 0x9d, 0x09, 0x8b, 0xd0, 0xa6, 0x09, 0x8b, 0xc9,
+    0xa5, 0x09, 0x8b, 0xc1, 0xa4, 0x09, 0x8b, 0xb9, 0xa3, 0x09, 0x8b, 0xb1,
+    0xa2, 0x09, 0x8b, 0xa3, 0x01, 0xf9, 0xbc, 0xa1, 0x09, 0x8b, 0x99, 0xa0,
+    0x09, 0x8b, 0x8b, 0x01, 0xf9, 0xc0, 0x9f, 0x09, 0x8b, 0x81, 0x9e, 0x09,
+    0x8b, 0x79, 0x9d, 0x09, 0x8b, 0x70, 0xa6, 0x09, 0x8b, 0x69, 0xa5, 0x09,
+    0x8b, 0x61, 0xa4, 0x09, 0x8b, 0x53, 0x01, 0xf9, 0xc4, 0xa3, 0x09, 0x8b,
+    0x43, 0x01, 0xf9, 0xc8, 0xa2, 0x09, 0x8b, 0x39, 0xa1, 0x09, 0x8b, 0x31,
+    0xa0, 0x09, 0x8b, 0x29, 0x9f, 0x09, 0x8b, 0x21, 0x9e, 0x09, 0x8b, 0x19,
+    0x9d, 0x09, 0x8b, 0x10, 0xa6, 0x09, 0x8b, 0x09, 0xa5, 0x09, 0x8b, 0x01,
+    0xa4, 0x09, 0x8a, 0xf9, 0xa3, 0x09, 0x8a, 0xeb, 0x01, 0xf9, 0xcc, 0xa2,
+    0x09, 0x8a, 0xe1, 0xa1, 0x09, 0x8a, 0xd9, 0xa0, 0x09, 0x8a, 0xd1, 0x9f,
+    0x09, 0x8a, 0xc9, 0x9e, 0x09, 0x8a, 0xc1, 0x9d, 0x09, 0x8a, 0xb2, 0x01,
+    0xf9, 0xd0, 0xa6, 0x09, 0x8a, 0xa9, 0xa5, 0x09, 0x8a, 0xa1, 0xa4, 0x09,
+    0x8a, 0x99, 0xa3, 0x09, 0x8a, 0x91, 0xa2, 0x09, 0x8a, 0x89, 0xa1, 0x09,
+    0x8a, 0x81, 0xa0, 0x09, 0x8a, 0x79, 0x9f, 0x09, 0x8a, 0x71, 0x9e, 0x09,
+    0x8a, 0x63, 0x01, 0xf9, 0xd4, 0x9d, 0x09, 0x8a, 0x58, 0xa6, 0x09, 0x8a,
+    0x51, 0xa5, 0x09, 0x8a, 0x49, 0xa4, 0x09, 0x8a, 0x33, 0x01, 0xf9, 0xd8,
+    0xa3, 0x09, 0x8a, 0x23, 0x01, 0xf9, 0xe0, 0xa2, 0x09, 0x8a, 0x19, 0xa1,
+    0x09, 0x8a, 0x11, 0xa0, 0x09, 0x8a, 0x09, 0x9f, 0x09, 0x8a, 0x01, 0x9e,
+    0x09, 0x89, 0xf8, 0xa0, 0x09, 0x89, 0xf1, 0x9f, 0x09, 0x89, 0xe9, 0x9e,
+    0x09, 0x89, 0xcb, 0x01, 0xf9, 0xe4, 0x9d, 0x09, 0x89, 0xc0, 0xa6, 0x09,
+    0x89, 0xb9, 0xa5, 0x09, 0x89, 0xb1, 0xa4, 0x09, 0x89, 0xa3, 0x01, 0xf9,
+    0xf0, 0xa3, 0x09, 0x89, 0x93, 0x01, 0xf9, 0xf4, 0xa2, 0x09, 0x89, 0x83,
+    0x01, 0xf9, 0xf8, 0xa1, 0x09, 0x89, 0x79, 0xa0, 0x09, 0x89, 0x71, 0x9f,
+    0x09, 0x89, 0x69, 0x9e, 0x09, 0x89, 0x61, 0x9d, 0x09, 0x89, 0x58, 0xa6,
+    0x09, 0x89, 0x51, 0xa5, 0x09, 0x89, 0x43, 0x01, 0xf9, 0xfc, 0xa4, 0x09,
+    0x89, 0x33, 0x01, 0xfa, 0x00, 0xa3, 0x09, 0x89, 0x29, 0xa2, 0x09, 0x89,
+    0x21, 0xa1, 0x09, 0x89, 0x19, 0xa0, 0x09, 0x89, 0x11, 0x9f, 0x09, 0x89,
+    0x09, 0x9e, 0x09, 0x88, 0xfb, 0x01, 0xfa, 0x04, 0x9d, 0x09, 0x88, 0xf0,
+    0xa6, 0x09, 0x88, 0xe9, 0xa5, 0x09, 0x88, 0xe1, 0xa4, 0x09, 0x88, 0xd9,
+    0xa3, 0x09, 0x88, 0xd1, 0xa2, 0x09, 0x88, 0xc9, 0xa1, 0x09, 0x88, 0xc1,
+    0xa0, 0x09, 0x88, 0xb9, 0x9f, 0x09, 0x88, 0xb1, 0x9e, 0x09, 0x88, 0xa3,
+    0x01, 0xfa, 0x08, 0x9d, 0x09, 0x88, 0x98, 0xa6, 0x09, 0x88, 0x91, 0xa5,
+    0x09, 0x88, 0x89, 0xa4, 0x09, 0x88, 0x81, 0xa3, 0x09, 0x88, 0x79, 0xa2,
+    0x09, 0x88, 0x71, 0xa1, 0x09, 0x88, 0x69, 0xa0, 0x09, 0x88, 0x5b, 0x01,
+    0xfa, 0x0c, 0x9f, 0x09, 0x88, 0x51, 0x9e, 0x09, 0x88, 0x49, 0x9d, 0x09,
+    0x88, 0x40, 0xa6, 0x09, 0x88, 0x39, 0xa5, 0x09, 0x88, 0x31, 0xa4, 0x09,
+    0x88, 0x29, 0xa3, 0x09, 0x88, 0x21, 0xa2, 0x09, 0x88, 0x19, 0xa1, 0x09,
+    0x88, 0x11, 0xa0, 0x09, 0x88, 0x09, 0x9f, 0x09, 0x88, 0x01, 0x9e, 0x09,
+    0x87, 0xf2, 0x01, 0xfa, 0x10, 0xa4, 0x09, 0x86, 0x4b, 0x01, 0xfa, 0x14,
+    0xa3, 0x09, 0x86, 0x41, 0xa2, 0x09, 0x86, 0x39, 0xa1, 0x09, 0x86, 0x31,
+    0xa0, 0x09, 0x86, 0x29, 0x9f, 0x09, 0x86, 0x21, 0x9e, 0x09, 0x86, 0x19,
+    0x9d, 0x09, 0x86, 0x10, 0xa6, 0x09, 0x86, 0x09, 0xa5, 0x09, 0x86, 0x01,
+    0xa4, 0x09, 0x85, 0xf9, 0xa3, 0x09, 0x85, 0xf1, 0xa2, 0x09, 0x85, 0xe9,
+    0xa1, 0x09, 0x85, 0xdb, 0x01, 0xfa, 0x34, 0xa0, 0x09, 0x85, 0xd1, 0x9f,
+    0x09, 0x85, 0xc3, 0x01, 0xfa, 0x38, 0x9e, 0x09, 0x85, 0xb9, 0x9d, 0x09,
+    0x85, 0x6a, 0x01, 0xfa, 0x3c, 0xa6, 0x09, 0x85, 0x61, 0xa5, 0x09, 0x85,
+    0x53, 0x01, 0xfa, 0x60, 0xa4, 0x09, 0x85, 0x49, 0xa3, 0x09, 0x85, 0x3b,
+    0x01, 0xfa, 0x64, 0xa2, 0x09, 0x85, 0x31, 0xa1, 0x09, 0x85, 0x29, 0xa0,
+    0x09, 0x85, 0x21, 0x9f, 0x09, 0x85, 0x19, 0x9e, 0x09, 0x85, 0x11, 0x9d,
+    0x09, 0x85, 0x08, 0xa6, 0x09, 0x85, 0x01, 0xa5, 0x09, 0x84, 0xf9, 0xa4,
+    0x09, 0x84, 0xf1, 0xa3, 0x09, 0x84, 0xe9, 0xa2, 0x09, 0x84, 0xe1, 0xa1,
+    0x09, 0x84, 0xd3, 0x01, 0xfa, 0x68, 0xa0, 0x09, 0x84, 0xc9, 0x9f, 0x09,
+    0x84, 0xc1, 0x9e, 0x09, 0x84, 0xb3, 0x01, 0xfa, 0x6c, 0x9d, 0x09, 0x84,
+    0xa8, 0xa6, 0x09, 0x84, 0xa1, 0xa5, 0x09, 0x84, 0x99, 0xa4, 0x09, 0x84,
+    0x8b, 0x01, 0xfa, 0x70, 0xa3, 0x09, 0x84, 0x81, 0xa2, 0x09, 0x84, 0x79,
+    0xa1, 0x09, 0x84, 0x71, 0xa0, 0x09, 0x84, 0x69, 0x9f, 0x09, 0x84, 0x61,
+    0x9e, 0x09, 0x84, 0x59, 0x9d, 0x09, 0x84, 0x50, 0xa6, 0x09, 0x84, 0x49,
+    0xa5, 0x09, 0x84, 0x41, 0xa4, 0x09, 0x84, 0x39, 0xa3, 0x09, 0x84, 0x31,
+    0xa2, 0x09, 0x84, 0x29, 0xa1, 0x09, 0x84, 0x21, 0xa0, 0x09, 0x84, 0x19,
+    0x9f, 0x09, 0x84, 0x11, 0x9e, 0x09, 0x84, 0x09, 0x9d, 0x09, 0x84, 0x00,
+    0xa6, 0x09, 0x83, 0xf9, 0xa5, 0x09, 0x83, 0xeb, 0x01, 0xfa, 0x74, 0xa4,
+    0x09, 0x83, 0xe1, 0xa3, 0x09, 0x83, 0xd9, 0xa2, 0x09, 0x83, 0xd1, 0xa1,
+    0x09, 0x83, 0xc9, 0xa0, 0x09, 0x83, 0xc1, 0x9f, 0x09, 0x83, 0xb9, 0x9e,
+    0x09, 0x83, 0xb0, 0xa1, 0x09, 0x83, 0xa9, 0xa0, 0x09, 0x83, 0xa1, 0x9f,
+    0x09, 0x83, 0x99, 0x9e, 0x09, 0x83, 0x91, 0x9d, 0x09, 0x83, 0x88, 0xa6,
+    0x09, 0x83, 0x81, 0xa5, 0x09, 0x83, 0x79, 0xa4, 0x09, 0x83, 0x71, 0xa3,
+    0x09, 0x83, 0x69, 0xa2, 0x09, 0x83, 0x61, 0xa1, 0x09, 0x83, 0x59, 0xa0,
+    0x09, 0x83, 0x51, 0x9f, 0x09, 0x83, 0x49, 0x9e, 0x09, 0x83, 0x41, 0x9d,
+    0x09, 0x83, 0x32, 0x01, 0xfa, 0x78, 0xa6, 0x09, 0x83, 0x29, 0xa5, 0x09,
+    0x83, 0x21, 0xa4, 0x09, 0x83, 0x19, 0xa3, 0x09, 0x83, 0x11, 0xa2, 0x09,
+    0x83, 0x09, 0xa1, 0x09, 0x83, 0x01, 0xa0, 0x09, 0x82, 0xf9, 0x9f, 0x09,
+    0x82, 0xdb, 0x01, 0xfa, 0x7c, 0x9e, 0x09, 0x82, 0xd0, 0xcb, 0x58, 0xc7,
+    0x0f, 0xbd, 0x39, 0x46, 0x01, 0xfc, 0xc1, 0xfa, 0x88, 0x15, 0xc1, 0xfa,
+    0x94, 0xd4, 0x3c, 0xb4, 0x0f, 0xbd, 0xa0, 0xc4, 0x18, 0x10, 0x00, 0x37,
+    0xb9, 0xc2, 0x22, 0xcc, 0x00, 0x37, 0xb0, 0xc3, 0x0d, 0x14, 0x00, 0x37,
+    0xa9, 0xc3, 0x09, 0x9e, 0x00, 0x37, 0xa0, 0xc4, 0x02, 0xde, 0x00, 0x37,
+    0x99, 0xc2, 0x02, 0xa0, 0x00, 0x37, 0x90, 0x97, 0x00, 0x98, 0x4b, 0x01,
+    0xfa, 0xa0, 0x47, 0x23, 0x34, 0xc1, 0xfa, 0xa6, 0x83, 0x00, 0x98, 0x43,
+    0x01, 0xfa, 0xc9, 0x8b, 0x00, 0x98, 0x51, 0x87, 0x00, 0x98, 0x6b, 0x01,
+    0xfa, 0xcd, 0x91, 0x00, 0x98, 0x73, 0x01, 0xfa, 0xd1, 0x19, 0xc1, 0xfa,
+    0xd5, 0x09, 0xc1, 0xfa, 0xe7, 0x1b, 0x41, 0xfb, 0x05, 0x0a, 0xc1, 0xfb,
+    0x1f, 0x83, 0x00, 0x90, 0x03, 0x01, 0xfb, 0x41, 0x97, 0x00, 0x90, 0x09,
+    0x8b, 0x00, 0x90, 0x11, 0x87, 0x00, 0x90, 0x2b, 0x01, 0xfb, 0x45, 0x91,
+    0x00, 0x90, 0x32, 0x01, 0xfb, 0x49, 0x04, 0xc1, 0xfb, 0x4d, 0x83, 0x00,
+    0x93, 0x03, 0x01, 0xfb, 0x67, 0x97, 0x00, 0x93, 0x09, 0x8b, 0x00, 0x93,
+    0x11, 0x87, 0x00, 0x93, 0x2b, 0x01, 0xfb, 0x6b, 0x91, 0x00, 0x93, 0x33,
+    0x01, 0xfb, 0x6f, 0x19, 0x41, 0xfb, 0x73, 0x05, 0xc1, 0xfb, 0x82, 0x83,
+    0x00, 0x93, 0xc3, 0x01, 0xfb, 0xa0, 0x97, 0x00, 0x93, 0xc9, 0x8b, 0x00,
+    0x93, 0xd1, 0x87, 0x00, 0x93, 0xeb, 0x01, 0xfb, 0xa4, 0x91, 0x00, 0x93,
+    0xf3, 0x01, 0xfb, 0xa8, 0xc2, 0x01, 0x4a, 0x00, 0x93, 0xf9, 0x0a, 0x41,
+    0xfb, 0xac, 0x1c, 0xc1, 0xfb, 0xcf, 0x06, 0xc1, 0xfb, 0xe8, 0x83, 0x00,
+    0x97, 0x83, 0x01, 0xfc, 0x0f, 0x97, 0x00, 0x97, 0x89, 0x8b, 0x00, 0x97,
+    0x91, 0x87, 0x00, 0x97, 0xab, 0x01, 0xfc, 0x13, 0x91, 0x00, 0x97, 0xb3,
+    0x01, 0xfc, 0x17, 0xc2, 0x01, 0x4a, 0x00, 0x97, 0xb8, 0x42, 0x00, 0x8e,
+    0xc1, 0xfc, 0x1b, 0x83, 0x00, 0x93, 0x83, 0x01, 0xfc, 0x34, 0x97, 0x00,
+    0x93, 0x89, 0x8b, 0x00, 0x93, 0x91, 0x87, 0x00, 0x93, 0xab, 0x01, 0xfc,
+    0x38, 0x91, 0x00, 0x93, 0xb3, 0x01, 0xfc, 0x3c, 0xc2, 0x01, 0x4a, 0x00,
+    0x93, 0xb9, 0x0a, 0xc1, 0xfc, 0x40, 0x15, 0xc1, 0xfc, 0x63, 0x1c, 0x41,
+    0xfc, 0x83, 0x83, 0x00, 0x90, 0x43, 0x01, 0xfc, 0xa0, 0x97, 0x00, 0x90,
+    0x49, 0x8b, 0x00, 0x90, 0x51, 0x87, 0x00, 0x90, 0x6b, 0x01, 0xfc, 0xa4,
+    0x91, 0x00, 0x90, 0x73, 0x01, 0xfc, 0xa8, 0xc2, 0x01, 0x4a, 0x00, 0x90,
+    0x78, 0x83, 0x00, 0x90, 0xc3, 0x01, 0xfc, 0xac, 0x97, 0x00, 0x90, 0xc9,
+    0x8b, 0x00, 0x90, 0xd1, 0x87, 0x00, 0x90, 0xeb, 0x01, 0xfc, 0xb0, 0x91,
+    0x00, 0x90, 0xf3, 0x01, 0xfc, 0xb4, 0x19, 0xc1, 0xfc, 0xb8, 0xc2, 0x19,
+    0x2c, 0x00, 0x9a, 0xc8, 0x1c, 0xc1, 0xfc, 0xc7, 0x83, 0x00, 0x91, 0x83,
+    0x01, 0xfc, 0xe7, 0x97, 0x00, 0x91, 0x89, 0x8b, 0x00, 0x91, 0x91, 0x87,
+    0x00, 0x91, 0xab, 0x01, 0xfc, 0xeb, 0x91, 0x00, 0x91, 0xb3, 0x01, 0xfc,
+    0xf5, 0xc2, 0x01, 0x4a, 0x00, 0x91, 0xb9, 0x0a, 0xc1, 0xfc, 0xf9, 0x15,
+    0x41, 0xfd, 0x1c, 0x83, 0x00, 0x91, 0x43, 0x01, 0xfd, 0x36, 0x97, 0x00,
+    0x91, 0x49, 0x8b, 0x00, 0x91, 0x51, 0x87, 0x00, 0x91, 0x6b, 0x01, 0xfd,
+    0x3a, 0x91, 0x00, 0x91, 0x73, 0x01, 0xfd, 0x3e, 0xc2, 0x01, 0x4a, 0x00,
+    0x91, 0x79, 0xc2, 0x19, 0x2c, 0x00, 0x9a, 0xc0, 0x83, 0x00, 0x92, 0x03,
+    0x01, 0xfd, 0x42, 0x97, 0x00, 0x92, 0x09, 0x8b, 0x00, 0x92, 0x11, 0x87,
+    0x00, 0x92, 0x2b, 0x01, 0xfd, 0x46, 0x91, 0x00, 0x92, 0x33, 0x01, 0xfd,
+    0x4a, 0x19, 0xc1, 0xfd, 0x4e, 0x0a, 0xc1, 0xfd, 0x60, 0x1b, 0x41, 0xfd,
+    0x7e, 0x83, 0x00, 0x93, 0x43, 0x01, 0xfd, 0x98, 0x97, 0x00, 0x93, 0x49,
+    0x8b, 0x00, 0x93, 0x51, 0x87, 0x00, 0x93, 0x6b, 0x01, 0xfd, 0x9c, 0x91,
+    0x00, 0x93, 0x71, 0xc2, 0x01, 0x4a, 0x00, 0x93, 0x78, 0x83, 0x00, 0x94,
+    0x03, 0x01, 0xfd, 0xa0, 0x97, 0x00, 0x94, 0x09, 0x8b, 0x00, 0x94, 0x11,
+    0x87, 0x00, 0x94, 0x2b, 0x01, 0xfd, 0xa4, 0x91, 0x00, 0x94, 0x33, 0x01,
+    0xfd, 0xa8, 0x19, 0xc1, 0xfd, 0xac, 0x1b, 0x41, 0xfd, 0xbe, 0x83, 0x00,
+    0x94, 0x83, 0x01, 0xfd, 0xd8, 0x97, 0x00, 0x94, 0x89, 0x8b, 0x00, 0x94,
+    0x91, 0x87, 0x00, 0x94, 0xab, 0x01, 0xfd, 0xdc, 0x91, 0x00, 0x94, 0xb3,
+    0x01, 0xfd, 0xe0, 0xc2, 0x01, 0x4a, 0x00, 0x94, 0xb9, 0x1b, 0x41, 0xfd,
+    0xe4, 0x83, 0x00, 0x95, 0x43, 0x01, 0xfe, 0x07, 0x97, 0x00, 0x95, 0x49,
+    0x8b, 0x00, 0x95, 0x51, 0x87, 0x00, 0x95, 0x6b, 0x01, 0xfe, 0x0b, 0x91,
+    0x00, 0x95, 0x73, 0x01, 0xfe, 0x0f, 0x19, 0xc1, 0xfe, 0x13, 0x1a, 0xc1,
+    0xfe, 0x25, 0x1b, 0x41, 0xfe, 0x43, 0x83, 0x00, 0x96, 0x43, 0x01, 0xfe,
+    0x5d, 0x97, 0x00, 0x96, 0x49, 0x8b, 0x00, 0x96, 0x51, 0x87, 0x00, 0x96,
+    0x6b, 0x01, 0xfe, 0x61, 0x91, 0x00, 0x96, 0x72, 0x01, 0xfe, 0x65, 0x0a,
+    0xc1, 0xfe, 0x69, 0x83, 0x00, 0x9a, 0x83, 0x01, 0xfe, 0x8c, 0x97, 0x00,
+    0x9a, 0x89, 0x8b, 0x00, 0x9a, 0x91, 0x87, 0x00, 0x9a, 0xab, 0x01, 0xfe,
+    0x90, 0x91, 0x00, 0x9a, 0xb3, 0x01, 0xfe, 0x94, 0x19, 0x41, 0xfe, 0x98,
+    0x83, 0x00, 0x96, 0xc3, 0x01, 0xfe, 0xa7, 0x97, 0x00, 0x96, 0xc9, 0x8b,
+    0x00, 0x96, 0xd1, 0x87, 0x00, 0x96, 0xeb, 0x01, 0xfe, 0xab, 0x91, 0x00,
+    0x96, 0xf3, 0x01, 0xfe, 0xaf, 0xc2, 0x01, 0x4a, 0x00, 0x96, 0xf9, 0x0a,
+    0xc1, 0xfe, 0xb3, 0x1c, 0x41, 0xfe, 0xd3, 0x83, 0x00, 0x97, 0x43, 0x01,
+    0xfe, 0xed, 0x97, 0x00, 0x97, 0x49, 0x8b, 0x00, 0x97, 0x51, 0x87, 0x00,
+    0x97, 0x6b, 0x01, 0xfe, 0xf1, 0x91, 0x00, 0x97, 0x72, 0x01, 0xfe, 0xf5,
+    0x83, 0x00, 0x98, 0x03, 0x01, 0xfe, 0xf9, 0x97, 0x00, 0x98, 0x09, 0x8b,
+    0x00, 0x98, 0x11, 0x87, 0x00, 0x98, 0x2b, 0x01, 0xfe, 0xfd, 0x91, 0x00,
+    0x98, 0x33, 0x01, 0xff, 0x01, 0xc2, 0x01, 0x4a, 0x00, 0x98, 0x38, 0x83,
+    0x00, 0x9a, 0x43, 0x01, 0xff, 0x05, 0x97, 0x00, 0x9a, 0x49, 0x8b, 0x00,
+    0x9a, 0x51, 0x87, 0x00, 0x9a, 0x6b, 0x01, 0xff, 0x09, 0x91, 0x00, 0x9a,
+    0x71, 0x19, 0xc1, 0xff, 0x0d, 0xc2, 0x19, 0x2c, 0x00, 0x9a, 0xd0, 0x4b,
+    0x63, 0xff, 0xc1, 0xff, 0x1c, 0xd1, 0x36, 0x4b, 0x00, 0x9a, 0xf0, 0xc9,
+    0x57, 0x20, 0x00, 0x9b, 0xe0, 0xc6, 0xce, 0xc9, 0x00, 0x9c, 0xc0, 0x48,
+    0x6e, 0x42, 0xc1, 0xff, 0x28, 0x45, 0x00, 0x8c, 0x41, 0xff, 0x34, 0xc5,
+    0x01, 0xa2, 0x01, 0x18, 0x09, 0xc5, 0xd8, 0x53, 0x0f, 0xa9, 0x31, 0xc4,
+    0xe3, 0xdb, 0x0f, 0xa8, 0x61, 0xca, 0xa5, 0x94, 0x0f, 0xa5, 0x08, 0xc2,
+    0x39, 0x8b, 0x08, 0x7f, 0xa9, 0xc3, 0x1e, 0x1b, 0x08, 0x7f, 0x40, 0xc3,
+    0x11, 0xef, 0x08, 0x7f, 0xa1, 0x03, 0x41, 0xff, 0x58, 0xc2, 0x00, 0x8e,
+    0x08, 0x7f, 0x38, 0xc4, 0x36, 0xb5, 0x08, 0x7f, 0x01, 0xc3, 0x16, 0x5a,
+    0x08, 0x7f, 0x78, 0x87, 0x08, 0x29, 0x29, 0xc4, 0x38, 0x2c, 0x08, 0x29,
+    0x30, 0xd6, 0x2e, 0x6a, 0x01, 0x39, 0xb9, 0xcd, 0x0e, 0x61, 0x01, 0x39,
+    0xa9, 0xca, 0x22, 0x51, 0x01, 0x39, 0xa0, 0xc2, 0x00, 0x55, 0x01, 0x10,
+    0x71, 0xcb, 0x6d, 0x97, 0x00, 0x04, 0xb8, 0xcb, 0x98, 0xd1, 0x00, 0x00,
+    0x23, 0x01, 0xff, 0x64, 0xc3, 0x09, 0x3f, 0x00, 0x00, 0x18, 0x43, 0x05,
+    0xb2, 0xc1, 0xff, 0x6a, 0xcd, 0x76, 0x76, 0x01, 0x12, 0xe8, 0x00, 0x41,
+    0xff, 0x82, 0xc4, 0x18, 0x10, 0x08, 0xed, 0x39, 0xc2, 0x22, 0xcc, 0x08,
+    0xed, 0x30, 0xc3, 0x0d, 0x14, 0x08, 0xed, 0x29, 0xc3, 0x09, 0x9e, 0x08,
+    0xed, 0x20, 0xc4, 0x02, 0xde, 0x08, 0xed, 0x19, 0xc2, 0x02, 0xa0, 0x08,
+    0xed, 0x10, 0x03, 0xc1, 0xff, 0x8c, 0xc2, 0x01, 0x24, 0x08, 0xec, 0x99,
+    0xc2, 0x02, 0xe0, 0x08, 0xec, 0x81, 0x97, 0x08, 0xec, 0x6b, 0x01, 0xff,
+    0x98, 0x8b, 0x08, 0xec, 0x5a, 0x01, 0xff, 0x9c, 0xc2, 0x00, 0xd0, 0x08,
+    0xec, 0x31, 0x83, 0x08, 0xec, 0x28, 0xc2, 0x01, 0x30, 0x08, 0xec, 0x21,
+    0x83, 0x08, 0xeb, 0xd0, 0x06, 0xc1, 0xff, 0xa0, 0xc2, 0x00, 0xd0, 0x08,
+    0xeb, 0xc9, 0x83, 0x08, 0xeb, 0xc0, 0xc2, 0x00, 0xd0, 0x08, 0xec, 0x09,
+    0x83, 0x08, 0xec, 0x00, 0xc2, 0x00, 0xdb, 0x08, 0xeb, 0xf9, 0x83, 0x08,
+    0xeb, 0xa8, 0x16, 0xc1, 0xff, 0xaa, 0xc2, 0x00, 0xd0, 0x08, 0xeb, 0xa1,
+    0x83, 0x08, 0xeb, 0x98, 0xc2, 0x00, 0xd0, 0x08, 0xeb, 0xe1, 0x83, 0x08,
+    0xeb, 0xd8, 0xc2, 0x00, 0xd0, 0x08, 0xeb, 0xb9, 0x83, 0x08, 0xeb, 0xb0,
+    0xc2, 0x00, 0xd0, 0x08, 0xeb, 0x91, 0x83, 0x08, 0xeb, 0x88, 0xc2, 0x00,
+    0xd0, 0x08, 0xeb, 0x79, 0x83, 0x08, 0xeb, 0x70, 0x97, 0x08, 0xeb, 0x59,
+    0x8b, 0x08, 0xeb, 0x41, 0x83, 0x08, 0xeb, 0x08, 0x97, 0x08, 0xeb, 0x28,
+    0x8b, 0x08, 0xeb, 0x18, 0xc5, 0x40, 0xe7, 0x00, 0x50, 0x19, 0xc4, 0x1e,
+    0x97, 0x00, 0x52, 0x68, 0x83, 0x00, 0x50, 0x31, 0x8b, 0x00, 0x50, 0x81,
+    0x97, 0x00, 0x50, 0xa0, 0x8b, 0x00, 0x50, 0x40, 0x97, 0x00, 0x50, 0x50,
+    0x83, 0x00, 0x50, 0xa9, 0x0a, 0x41, 0xff, 0xb4, 0x83, 0x00, 0x50, 0xb9,
+    0x0a, 0x41, 0xff, 0xbe, 0xc2, 0x01, 0x30, 0x00, 0x50, 0xc9, 0xc2, 0x19,
+    0x2c, 0x00, 0x50, 0xf1, 0xc2, 0x00, 0xc1, 0x00, 0x51, 0x19, 0x83, 0x00,
+    0x51, 0x40, 0x83, 0x00, 0x50, 0xd1, 0xc2, 0x00, 0xd0, 0x00, 0x50, 0xd8,
+    0x83, 0x00, 0x50, 0xe1, 0xc2, 0x00, 0xd0, 0x00, 0x50, 0xe8, 0x16, 0xc1,
+    0xff, 0xc8, 0x83, 0x00, 0x51, 0x21, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0x28,
+    0x06, 0xc1, 0xff, 0xd2, 0x83, 0x00, 0x51, 0x31, 0xc2, 0x00, 0xd0, 0x00,
+    0x51, 0x38, 0x83, 0x00, 0x51, 0x51, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0x58,
+    0x83, 0x00, 0x51, 0x61, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0x68, 0x83, 0x00,
+    0x51, 0x81, 0xc2, 0x00, 0x39, 0x00, 0x52, 0xe0, 0x83, 0x00, 0x51, 0x91,
+    0xc2, 0x00, 0xdb, 0x00, 0x51, 0x98, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0xb1,
+    0x83, 0x00, 0x51, 0xc0, 0x83, 0x00, 0x51, 0xf1, 0x8b, 0x00, 0x52, 0x41,
+    0x97, 0x00, 0x52, 0x60, 0x8b, 0x00, 0x52, 0x00, 0x97, 0x00, 0x52, 0x10,
+    0xc2, 0x02, 0xa0, 0x00, 0x53, 0x41, 0xc4, 0x02, 0xde, 0x00, 0x53, 0x48,
+    0xc3, 0x09, 0x9e, 0x00, 0x53, 0x51, 0xc3, 0x0d, 0x14, 0x00, 0x53, 0x58,
+    0xc2, 0x22, 0xcc, 0x00, 0x53, 0x61, 0xc4, 0x18, 0x10, 0x00, 0x53, 0x68,
+    0xca, 0x1e, 0x8a, 0x00, 0x54, 0x09, 0xd1, 0x33, 0x57, 0x00, 0x57, 0xf0,
+    0xc7, 0x14, 0x39, 0x00, 0x54, 0x11, 0xc7, 0x7a, 0x7f, 0x00, 0x55, 0xe8,
+    0xc5, 0x40, 0xe7, 0x00, 0x54, 0x19, 0xc4, 0x1e, 0x97, 0x00, 0x56, 0x68,
+    0xc4, 0xdb, 0xfb, 0x00, 0x57, 0xd1, 0xc5, 0xd7, 0x18, 0x00, 0x57, 0xd8,
+    0xd4, 0x3a, 0x84, 0x00, 0x57, 0xe9, 0xd5, 0x33, 0x53, 0x00, 0x57, 0xf8,
+    0x83, 0x00, 0x54, 0x31, 0x8b, 0x00, 0x54, 0x81, 0x97, 0x00, 0x54, 0xa0,
+    0x8b, 0x00, 0x54, 0x40, 0x97, 0x00, 0x54, 0x50, 0x47, 0xb2, 0x2e, 0xc1,
+    0xff, 0xdc, 0x83, 0x00, 0x55, 0xa8, 0x83, 0x00, 0x54, 0xa9, 0xc2, 0x00,
+    0xd0, 0x00, 0x54, 0xb0, 0x83, 0x00, 0x54, 0xb9, 0xc2, 0x00, 0xd0, 0x00,
+    0x54, 0xc0, 0xc2, 0x01, 0x30, 0x00, 0x54, 0xc9, 0xc2, 0x19, 0x2c, 0x00,
+    0x54, 0xf1, 0xc2, 0x00, 0xc1, 0x00, 0x55, 0x19, 0x83, 0x00, 0x55, 0x40,
+    0x83, 0x00, 0x54, 0xd1, 0xc2, 0x00, 0xd0, 0x00, 0x54, 0xd8, 0x83, 0x00,
+    0x54, 0xe1, 0xc2, 0x00, 0xd0, 0x00, 0x54, 0xe8, 0x16, 0xc1, 0xff, 0xea,
+    0x83, 0x00, 0x55, 0x21, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0x28, 0x06, 0xc1,
+    0xff, 0xf4, 0x83, 0x00, 0x55, 0x31, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0x38,
+    0x83, 0x00, 0x55, 0x51, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0x58, 0x83, 0x00,
+    0x55, 0x61, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0x68, 0x83, 0x00, 0x55, 0x91,
+    0xc2, 0x00, 0xdb, 0x00, 0x55, 0x98, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0xb1,
+    0xc2, 0x0d, 0xf6, 0x00, 0x55, 0xb9, 0x83, 0x00, 0x55, 0xc0, 0x87, 0x00,
+    0x54, 0x69, 0x91, 0x00, 0x54, 0x88, 0x03, 0xc1, 0xff, 0xfe, 0x8b, 0x00,
+    0x55, 0xfb, 0x02, 0x00, 0x0a, 0x97, 0x00, 0x56, 0x0b, 0x02, 0x00, 0x0e,
+    0x48, 0xb2, 0x2d, 0xc2, 0x00, 0x12, 0x47, 0xc7, 0x7b, 0xc2, 0x00, 0x20,
+    0x87, 0x00, 0x56, 0x39, 0x91, 0x00, 0x56, 0x58, 0xc2, 0x02, 0xa0, 0x00,
+    0x57, 0x41, 0xc4, 0x02, 0xde, 0x00, 0x57, 0x48, 0xc3, 0x09, 0x9e, 0x00,
+    0x57, 0x51, 0xc3, 0x0d, 0x14, 0x00, 0x57, 0x58, 0xc2, 0x22, 0xcc, 0x00,
+    0x57, 0x61, 0xc4, 0x18, 0x10, 0x00, 0x57, 0x68, 0xc2, 0x0d, 0x10, 0x08,
+    0x1a, 0x09, 0xc8, 0x0d, 0x03, 0x08, 0x1a, 0x50, 0x0f, 0xc2, 0x00, 0x28,
+    0x42, 0x00, 0x74, 0xc2, 0x00, 0x34, 0x18, 0xc2, 0x00, 0x40, 0x06, 0xc2,
+    0x00, 0x4c, 0x11, 0xc2, 0x00, 0x61, 0x48, 0x0b, 0x17, 0xc2, 0x00, 0x79,
+    0x15, 0xc2, 0x00, 0x95, 0x12, 0xc2, 0x00, 0xad, 0x0d, 0xc2, 0x00, 0xce,
+    0x0e, 0xc2, 0x00, 0xde, 0xcc, 0x56, 0x9a, 0x00, 0x1b, 0xa1, 0x1b, 0xc2,
+    0x00, 0xf6, 0xcd, 0x2c, 0xb2, 0x00, 0x1b, 0xf1, 0x16, 0xc2, 0x01, 0x02,
+    0x03, 0xc2, 0x01, 0x1e, 0xcb, 0x93, 0xa9, 0x00, 0x1e, 0x81, 0x14, 0xc2,
+    0x01, 0x2e, 0x08, 0xc2, 0x01, 0x3a, 0xcb, 0x92, 0x3e, 0x08, 0x0c, 0x29,
+    0xcb, 0x8c, 0xb3, 0x08, 0x0c, 0x41, 0xc9, 0xab, 0x7f, 0x08, 0x0c, 0x51,
+    0x4d, 0x78, 0x4a, 0x42, 0x01, 0x46, 0xc4, 0xe3, 0x33, 0x0f, 0xa6, 0xb9,
+    0xc5, 0x1c, 0xae, 0x0f, 0xa4, 0xd1, 0xc5, 0xd7, 0x1d, 0x0f, 0x9a, 0x79,
+    0xc5, 0xd9, 0xfc, 0x0f, 0xca, 0xb8, 0x4a, 0x37, 0x44, 0xc2, 0x01, 0x58,
+    0xcf, 0x65, 0xc1, 0x01, 0x55, 0x28, 0xc3, 0x02, 0xa3, 0x01, 0x16, 0xb9,
+    0xcd, 0x78, 0x30, 0x01, 0x53, 0xd1, 0xd3, 0x43, 0x39, 0x01, 0x53, 0xe0,
+    0x42, 0x00, 0x2a, 0xc2, 0x01, 0x64, 0x43, 0x00, 0x5f, 0x42, 0x01, 0x7f,
+    0x45, 0x00, 0xd5, 0xc2, 0x01, 0x8b, 0x43, 0x02, 0x9c, 0x42, 0x01, 0x9d,
+    0xd4, 0x00, 0xd3, 0x01, 0x55, 0x48, 0x48, 0xb2, 0x2d, 0xc2, 0x01, 0xa9,
+    0x03, 0xc2, 0x01, 0xb7, 0xc2, 0x01, 0x24, 0x08, 0x9a, 0x59, 0xc2, 0x02,
+    0xe0, 0x08, 0x9a, 0x39, 0x97, 0x08, 0x9a, 0x0b, 0x02, 0x01, 0xc3, 0x8b,
+    0x08, 0x99, 0xfa, 0x02, 0x01, 0xc7, 0x18, 0xc2, 0x01, 0xcb, 0xc2, 0x00,
+    0xd0, 0x08, 0x99, 0xc9, 0x15, 0xc2, 0x01, 0xdb, 0x0e, 0xc2, 0x01, 0xeb,
+    0xc2, 0x00, 0x39, 0x08, 0x99, 0x81, 0xc2, 0x19, 0x2c, 0x08, 0x99, 0x79,
+    0xc2, 0x01, 0xc3, 0x08, 0x99, 0x71, 0x04, 0xc2, 0x01, 0xf5, 0x12, 0xc2,
+    0x01, 0xff, 0x06, 0xc2, 0x02, 0x09, 0x16, 0xc2, 0x02, 0x17, 0x10, 0xc2,
+    0x02, 0x25, 0x0c, 0xc2, 0x02, 0x3b, 0x05, 0xc2, 0x02, 0x45, 0x09, 0xc2,
+    0x02, 0x4f, 0x0d, 0xc2, 0x02, 0x59, 0x83, 0x08, 0x98, 0x2b, 0x02, 0x02,
+    0x63, 0xc2, 0x01, 0x24, 0x08, 0x98, 0x99, 0x97, 0x08, 0x98, 0x4b, 0x02,
+    0x02, 0x6f, 0x8b, 0x08, 0x98, 0x3b, 0x02, 0x02, 0x73, 0xc2, 0x02, 0xe0,
+    0x08, 0x98, 0x78, 0xc5, 0xd7, 0x3b, 0x08, 0x9a, 0xe9, 0x42, 0x07, 0xb2,
+    0xc2, 0x02, 0x77, 0x03, 0xc2, 0x02, 0x83, 0xc5, 0x33, 0x5d, 0x08, 0x99,
+    0xe1, 0x05, 0x42, 0x02, 0x8f, 0x46, 0x00, 0x8b, 0x42, 0x02, 0x9b, 0xc5,
+    0x07, 0x62, 0x01, 0x12, 0x89, 0xca, 0x37, 0x4e, 0x01, 0x12, 0x70, 0x42,
+    0x00, 0xdb, 0xc2, 0x02, 0xa5, 0x0a, 0xc2, 0x02, 0xaf, 0x03, 0xc2, 0x02,
+    0xc3, 0x16, 0xc2, 0x02, 0xd3, 0x07, 0xc2, 0x02, 0xdd, 0xc2, 0x17, 0xb6,
+    0x00, 0xe5, 0xb9, 0xc2, 0x02, 0x09, 0x00, 0xe5, 0xb1, 0xc2, 0x00, 0x28,
+    0x00, 0xe5, 0x99, 0x0c, 0xc2, 0x02, 0xe7, 0xc3, 0xe6, 0x47, 0x00, 0xe5,
+    0x71, 0x05, 0xc2, 0x02, 0xf3, 0x15, 0xc2, 0x03, 0x03, 0xc3, 0xe5, 0x69,
+    0x00, 0xe5, 0x39, 0x09, 0xc2, 0x03, 0x0f, 0x0d, 0xc2, 0x03, 0x1b, 0x12,
+    0xc2, 0x03, 0x27, 0xc2, 0x05, 0x1d, 0x00, 0xe5, 0x19, 0xc3, 0x82, 0x78,
+    0x00, 0xe5, 0x01, 0x1c, 0xc2, 0x03, 0x33, 0xc2, 0x00, 0x45, 0x00, 0xe4,
+    0xe9, 0xc3, 0x09, 0xe6, 0x00, 0xe4, 0xe1, 0xc3, 0x12, 0xb8, 0x00, 0xe4,
+    0xd9, 0xc2, 0x00, 0x74, 0x00, 0xe4, 0xc1, 0xc3, 0x21, 0x7e, 0x00, 0xe4,
+    0xa9, 0xc3, 0x62, 0xe1, 0x00, 0xe4, 0x99, 0xc3, 0x10, 0xd0, 0x00, 0xe4,
+    0x88, 0x03, 0xc2, 0x03, 0x3f, 0xc3, 0x10, 0xd0, 0x00, 0x85, 0x09, 0x09,
+    0xc2, 0x03, 0x49, 0xc3, 0x62, 0xe1, 0x00, 0x85, 0x19, 0xc2, 0x00, 0xc4,
+    0x00, 0x85, 0x21, 0xc3, 0x21, 0x7e, 0x00, 0x85, 0x29, 0x1c, 0xc2, 0x03,
+    0x55, 0x42, 0x01, 0x6f, 0xc2, 0x03, 0x61, 0xc2, 0x00, 0x74, 0x00, 0x85,
+    0x41, 0x0d, 0xc2, 0x03, 0x69, 0xc3, 0x03, 0x03, 0x00, 0x85, 0x51, 0xc3,
+    0x12, 0xb8, 0x00, 0x85, 0x59, 0xc3, 0x09, 0xe6, 0x00, 0x85, 0x61, 0xc2,
+    0x00, 0x45, 0x00, 0x85, 0x69, 0x12, 0xc2, 0x03, 0x75, 0xc3, 0x82, 0x78,
+    0x00, 0x85, 0x81, 0x15, 0xc2, 0x03, 0x81, 0xc2, 0x05, 0x1d, 0x00, 0x85,
+    0x99, 0xc3, 0xe5, 0x69, 0x00, 0x85, 0xb9, 0x05, 0xc2, 0x03, 0x8d, 0x0c,
+    0xc2, 0x03, 0x9d, 0xc3, 0xe6, 0x47, 0x00, 0x85, 0xf1, 0x0a, 0xc2, 0x03,
+    0xa9, 0xc2, 0x00, 0x28, 0x00, 0x86, 0x19, 0xc2, 0x17, 0xb6, 0x00, 0x86,
+    0x38, 0x03, 0xc2, 0x03, 0xbd, 0xc3, 0x10, 0xd0, 0x00, 0x86, 0x89, 0x09,
+    0xc2, 0x03, 0xcd, 0xc3, 0x62, 0xe1, 0x00, 0x86, 0x99, 0x07, 0xc2, 0x03,
+    0xd9, 0xc3, 0x21, 0x7e, 0x00, 0x86, 0xa9, 0x1c, 0xc2, 0x03, 0xe3, 0x16,
+    0xc2, 0x03, 0xef, 0xc2, 0x00, 0x74, 0x00, 0x86, 0xc1, 0x0d, 0xc2, 0x03,
+    0xf9, 0x42, 0x00, 0xdb, 0xc2, 0x04, 0x05, 0xc3, 0x12, 0xb8, 0x00, 0x86,
+    0xd9, 0xc3, 0x09, 0xe6, 0x00, 0x86, 0xe1, 0xc2, 0x00, 0x45, 0x00, 0x86,
+    0xe9, 0x12, 0xc2, 0x04, 0x0f, 0xc3, 0x82, 0x78, 0x00, 0x87, 0x01, 0x15,
+    0xc2, 0x04, 0x1b, 0xc2, 0x05, 0x1d, 0x00, 0x87, 0x19, 0xc3, 0xe5, 0x69,
+    0x00, 0x87, 0x39, 0x05, 0xc2, 0x04, 0x27, 0x0c, 0xc2, 0x04, 0x37, 0xc3,
+    0xe6, 0x47, 0x00, 0x87, 0x71, 0x0a, 0xc2, 0x04, 0x43, 0xc2, 0x00, 0x28,
+    0x00, 0x87, 0x99, 0xc2, 0x02, 0x09, 0x00, 0x87, 0xb1, 0xc2, 0x17, 0xb6,
+    0x00, 0x87, 0xb8, 0x03, 0xc2, 0x04, 0x57, 0xc3, 0x10, 0xd0, 0x01, 0x68,
+    0x09, 0x09, 0xc2, 0x04, 0x61, 0xc3, 0x62, 0xe1, 0x01, 0x68, 0x19, 0xc2,
+    0x00, 0xc4, 0x01, 0x68, 0x21, 0xc3, 0x21, 0x7e, 0x01, 0x68, 0x29, 0x1c,
+    0xc2, 0x04, 0x6d, 0x42, 0x01, 0x6f, 0xc2, 0x04, 0x79, 0xc2, 0x00, 0x74,
+    0x01, 0x68, 0x41, 0x0d, 0xc2, 0x04, 0x81, 0xc3, 0x03, 0x03, 0x01, 0x68,
+    0x51, 0xc3, 0x12, 0xb8, 0x01, 0x68, 0x59, 0xc3, 0x09, 0xe6, 0x01, 0x68,
+    0x61, 0xc2, 0x00, 0x45, 0x01, 0x68, 0x69, 0x12, 0xc2, 0x04, 0x8d, 0xc3,
+    0x82, 0x78, 0x01, 0x68, 0x81, 0x15, 0xc2, 0x04, 0x99, 0xc2, 0x05, 0x1d,
+    0x01, 0x68, 0x99, 0xc3, 0xe5, 0x69, 0x01, 0x68, 0xb9, 0x05, 0xc2, 0x04,
+    0xa5, 0x0c, 0xc2, 0x04, 0xb5, 0xc3, 0xe6, 0x47, 0x01, 0x68, 0xf1, 0x0a,
+    0xc2, 0x04, 0xc1, 0xc2, 0x00, 0x28, 0x01, 0x69, 0x19, 0xc2, 0x17, 0xb6,
+    0x01, 0x69, 0x38, 0xc3, 0xe5, 0x4b, 0x01, 0x60, 0x01, 0x04, 0xc2, 0x04,
+    0xd5, 0xc4, 0xdf, 0x83, 0x01, 0x60, 0x11, 0xc7, 0xc1, 0xf5, 0x01, 0x60,
+    0x19, 0x06, 0xc2, 0x04, 0xe1, 0x1b, 0xc2, 0x04, 0xf3, 0x1c, 0xc2, 0x05,
+    0x05, 0x8b, 0x01, 0x60, 0x5b, 0x02, 0x05, 0x11, 0xc4, 0xe1, 0x6b, 0x01,
+    0x60, 0x69, 0x0e, 0xc2, 0x05, 0x23, 0xc7, 0x60, 0xdd, 0x01, 0x60, 0x79,
+    0xc5, 0xdb, 0x78, 0x01, 0x60, 0x81, 0x11, 0xc2, 0x05, 0x2f, 0x12, 0xc2,
+    0x05, 0x3b, 0xc5, 0xd7, 0xb3, 0x01, 0x60, 0x99, 0x15, 0xc2, 0x05, 0x45,
+    0x16, 0xc2, 0x05, 0x5e, 0xc3, 0xc5, 0x6f, 0x01, 0x60, 0xb1, 0x08, 0xc2,
+    0x05, 0x70, 0xc4, 0xdf, 0x9f, 0x01, 0x60, 0xc1, 0x05, 0x42, 0x05, 0x7c,
+    0xc3, 0xe5, 0x4b, 0x01, 0x61, 0x81, 0x04, 0xc2, 0x05, 0x88, 0xc4, 0xdf,
+    0x83, 0x01, 0x61, 0x91, 0xc7, 0xc1, 0xf5, 0x01, 0x61, 0x99, 0x06, 0xc2,
+    0x05, 0x94, 0x1b, 0xc2, 0x05, 0xa6, 0x1c, 0xc2, 0x05, 0xb8, 0x8b, 0x01,
+    0x61, 0xdb, 0x02, 0x05, 0xc4, 0xc4, 0xe1, 0x6b, 0x01, 0x61, 0xe9, 0x0e,
+    0xc2, 0x05, 0xd6, 0xc7, 0x60, 0xdd, 0x01, 0x61, 0xf9, 0xc5, 0xdb, 0x78,
+    0x01, 0x62, 0x01, 0x11, 0xc2, 0x05, 0xe2, 0x12, 0xc2, 0x05, 0xee, 0xc5,
+    0xd7, 0xb3, 0x01, 0x62, 0x19, 0x15, 0xc2, 0x05, 0xf8, 0x16, 0xc2, 0x06,
+    0x11, 0xc3, 0xc5, 0x6f, 0x01, 0x62, 0x31, 0x08, 0xc2, 0x06, 0x23, 0xc4,
+    0xdf, 0x9f, 0x01, 0x62, 0x41, 0x05, 0x42, 0x06, 0x2f, 0xcb, 0x1e, 0x89,
+    0x00, 0x58, 0x09, 0x03, 0xc2, 0x06, 0x3b, 0x42, 0x07, 0xb2, 0xc2, 0x06,
+    0x47, 0xc5, 0x33, 0x5d, 0x00, 0x59, 0xe1, 0xc8, 0x7d, 0xa4, 0x00, 0x5a,
+    0xa8, 0x83, 0x00, 0x58, 0x2b, 0x02, 0x06, 0x53, 0x8b, 0x00, 0x58, 0x3b,
+    0x02, 0x06, 0x5f, 0x97, 0x00, 0x58, 0x4b, 0x02, 0x06, 0x63, 0x18, 0xc2,
+    0x06, 0x67, 0x87, 0x00, 0x58, 0x79, 0x91, 0x00, 0x58, 0x99, 0x0d, 0xc2,
+    0x06, 0x71, 0x09, 0xc2, 0x06, 0x7b, 0x10, 0xc2, 0x06, 0x85, 0x05, 0xc2,
+    0x06, 0x9b, 0x0c, 0xc2, 0x06, 0xa5, 0x16, 0xc2, 0x06, 0xaf, 0x06, 0xc2,
+    0x06, 0xbd, 0x12, 0xc2, 0x06, 0xcb, 0x04, 0xc2, 0x06, 0xd5, 0xc2, 0x01,
+    0xc3, 0x00, 0x59, 0x71, 0x1b, 0xc2, 0x06, 0xdf, 0x14, 0xc2, 0x06, 0xe9,
+    0x0e, 0xc2, 0x06, 0xf9, 0x15, 0xc2, 0x07, 0x03, 0xc2, 0x00, 0xd0, 0x00,
+    0x59, 0xc9, 0xc2, 0x01, 0x4a, 0x00, 0x5b, 0x88, 0x03, 0xc2, 0x07, 0x13,
+    0x8b, 0x00, 0x59, 0xfb, 0x02, 0x07, 0x1f, 0x97, 0x00, 0x5a, 0x0b, 0x02,
+    0x07, 0x23, 0x48, 0xb2, 0x2d, 0xc2, 0x07, 0x27, 0x87, 0x00, 0x5a, 0x39,
+    0x91, 0x00, 0x5a, 0x58, 0xcd, 0x74, 0xcd, 0x00, 0x5a, 0xb1, 0xcd, 0x73,
+    0x0d, 0x00, 0x5a, 0xb8, 0xc4, 0x15, 0xe7, 0x00, 0x5b, 0x31, 0xc3, 0x05,
+    0x14, 0x00, 0x5b, 0x39, 0x16, 0xc2, 0x07, 0x35, 0x08, 0xc2, 0x07, 0x41,
+    0x15, 0xc2, 0x07, 0x4d, 0xc5, 0x06, 0xdb, 0x00, 0x5b, 0x71, 0xc4, 0x26,
+    0x78, 0x00, 0x5b, 0x78, 0x44, 0x05, 0x14, 0xc2, 0x07, 0x59, 0x46, 0x02,
+    0xdd, 0x42, 0x07, 0x71, 0x0a, 0xc2, 0x07, 0x7d, 0x19, 0xc2, 0x07, 0x8f,
+    0xc2, 0x00, 0xc4, 0x0f, 0x68, 0x52, 0x02, 0x07, 0x9f, 0x11, 0xc2, 0x07,
+    0xa5, 0x0b, 0x42, 0x07, 0xb7, 0x00, 0x42, 0x07, 0xc9, 0xc2, 0x22, 0xcc,
+    0x0f, 0x68, 0x33, 0x02, 0x07, 0xd5, 0xc4, 0x18, 0x10, 0x0f, 0x68, 0x3a,
+    0x02, 0x07, 0xe2, 0x9b, 0x0f, 0x68, 0x8b, 0x02, 0x07, 0xef, 0x00, 0x42,
+    0x07, 0xf5, 0xc2, 0x0d, 0x10, 0x0f, 0x68, 0x93, 0x02, 0x08, 0x01, 0x00,
+    0x42, 0x08, 0x07, 0xc2, 0x02, 0xa0, 0x0f, 0x69, 0x7b, 0x02, 0x08, 0x13,
+    0xc4, 0x02, 0xde, 0x0f, 0x69, 0x81, 0xc2, 0x00, 0xc4, 0x0f, 0x69, 0xba,
+    0x02, 0x08, 0x19, 0xc3, 0x09, 0x9e, 0x0f, 0x69, 0x8b, 0x02, 0x08, 0x1f,
+    0xc3, 0x0d, 0x14, 0x0f, 0x69, 0x90, 0xc2, 0x22, 0xcc, 0x0f, 0x69, 0x9b,
+    0x02, 0x08, 0x25, 0xc4, 0x18, 0x10, 0x0f, 0x69, 0xa0, 0xc6, 0x72, 0x26,
+    0x01, 0x01, 0x21, 0xd9, 0x11, 0xc9, 0x01, 0x71, 0x58, 0x42, 0x06, 0x62,
+    0xc2, 0x08, 0x2b, 0x47, 0x0f, 0x81, 0xc2, 0x08, 0x37, 0x42, 0x00, 0x6b,
+    0xc2, 0x08, 0x4f, 0x08, 0xc2, 0x08, 0x59, 0xc4, 0x04, 0x1f, 0x0f, 0xa8,
+    0x99, 0x4d, 0x7f, 0x32, 0xc2, 0x08, 0x65, 0xca, 0x6c, 0x80, 0x0f, 0xa2,
+    0x80, 0xd9, 0x1d, 0x56, 0x01, 0x3d, 0xf1, 0x4f, 0x66, 0x75, 0x42, 0x08,
+    0x71, 0xce, 0x1c, 0x92, 0x0b, 0x7f, 0x19, 0xc9, 0xa9, 0xea, 0x0b, 0x7f,
+    0x10, 0x4c, 0x11, 0xe2, 0xc2, 0x08, 0x7d, 0x4a, 0x51, 0x89, 0xc2, 0x08,
+    0x8f, 0x47, 0x02, 0x0e, 0x42, 0x08, 0x9b, 0x46, 0xc9, 0x58, 0xc2, 0x08,
+    0xf1, 0x4c, 0x86, 0x0d, 0x42, 0x09, 0x01, 0x47, 0x34, 0x2f, 0xc2, 0x09,
+    0x0d, 0x4d, 0x29, 0xb9, 0xc2, 0x09, 0x22, 0x4f, 0x0b, 0x17, 0x42, 0x09,
+    0x5d, 0x47, 0xc8, 0x07, 0xc2, 0x09, 0x98, 0x48, 0xb6, 0x6a, 0x42, 0x09,
+    0xb7, 0x47, 0x34, 0x2f, 0xc2, 0x09, 0xd0, 0x47, 0x02, 0x0e, 0x42, 0x09,
+    0xda, 0x15, 0xc2, 0x0a, 0x3c, 0x4b, 0x52, 0x39, 0x42, 0x0a, 0x48, 0x47,
+    0x02, 0x0e, 0xc2, 0x0a, 0xbb, 0x48, 0x56, 0x9a, 0x42, 0x0b, 0x18, 0xcd,
+    0x77, 0x6d, 0x00, 0xe3, 0xf9, 0xc6, 0x77, 0x74, 0x00, 0xe3, 0xf0, 0x8a,
+    0x00, 0xe3, 0xb9, 0x98, 0x00, 0xe3, 0xb1, 0x84, 0x00, 0xe3, 0xa9, 0xc2,
+    0x02, 0x10, 0x00, 0xe3, 0xa0, 0x91, 0x00, 0xe3, 0x99, 0x87, 0x00, 0xe3,
+    0x71, 0x97, 0x00, 0xe3, 0x49, 0x8b, 0x00, 0xe3, 0x21, 0x83, 0x00, 0xe2,
+    0xd2, 0x02, 0x0b, 0x2a, 0xc2, 0x01, 0xa3, 0x00, 0xe3, 0x91, 0x90, 0x00,
+    0xe3, 0x89, 0xc2, 0x04, 0xcd, 0x00, 0xe3, 0x81, 0x92, 0x00, 0xe3, 0x78,
+    0x9b, 0x00, 0xe3, 0x69, 0xc2, 0x1b, 0x88, 0x00, 0xe3, 0x61, 0x86, 0x00,
+    0xe3, 0x59, 0x85, 0x00, 0xe3, 0x50, 0x94, 0x00, 0xe3, 0x41, 0xc2, 0x16,
+    0x59, 0x00, 0xe3, 0x39, 0x8a, 0x00, 0xe3, 0x31, 0x95, 0x00, 0xe3, 0x28,
+    0x03, 0xc2, 0x0b, 0x2e, 0x8e, 0x00, 0xe2, 0xf1, 0xc2, 0x00, 0x75, 0x00,
+    0xe2, 0xe9, 0x89, 0x00, 0xe2, 0xe1, 0x96, 0x00, 0xe2, 0xd8, 0xc4, 0x18,
+    0x10, 0x00, 0xe2, 0xb9, 0xc2, 0x22, 0xcc, 0x00, 0xe2, 0xb0, 0xc3, 0x0d,
+    0x14, 0x00, 0xe2, 0xa9, 0xc3, 0x09, 0x9e, 0x00, 0xe2, 0xa0, 0xc4, 0x02,
+    0xde, 0x00, 0xe2, 0x99, 0xc2, 0x02, 0xa0, 0x00, 0xe2, 0x90, 0x46, 0x01,
+    0xfc, 0xc2, 0x0b, 0x3e, 0xcd, 0x56, 0x88, 0x01, 0x5d, 0xe0, 0xc9, 0xaa,
+    0x56, 0x00, 0xb4, 0xc9, 0xc5, 0xd7, 0xa9, 0x00, 0xb4, 0xa9, 0xc5, 0xcc,
+    0x96, 0x00, 0xb4, 0x98, 0xc3, 0x09, 0x38, 0x00, 0xb4, 0xc1, 0xc6, 0xcc,
+    0x95, 0x00, 0xb4, 0xa0, 0xc7, 0xc7, 0x82, 0x00, 0xb4, 0xb9, 0x94, 0x00,
+    0xb4, 0x91, 0xc3, 0x04, 0xa7, 0x00, 0xb4, 0x30, 0x94, 0x00, 0xb4, 0xb1,
+    0xc2, 0x1b, 0x88, 0x00, 0xb4, 0x88, 0xc5, 0xd8, 0xad, 0x00, 0xb4, 0x71,
+    0xc3, 0x14, 0xa7, 0x00, 0xb4, 0x20, 0xc6, 0xd1, 0x15, 0x00, 0xb4, 0x69,
+    0xc3, 0x00, 0x44, 0x00, 0xb4, 0x28, 0xc4, 0xe2, 0xef, 0x00, 0xb4, 0x51,
+    0xc3, 0x1f, 0x48, 0x00, 0xb4, 0x48, 0xc3, 0x00, 0x49, 0x08, 0x24, 0x01,
+    0x83, 0x08, 0x24, 0xd8, 0xc2, 0x00, 0xd0, 0x08, 0x24, 0x29, 0xc3, 0xb8,
+    0xac, 0x08, 0x24, 0x78, 0xc3, 0x0e, 0x66, 0x08, 0x24, 0x31, 0xc2, 0x00,
+    0xd0, 0x08, 0x24, 0x50, 0x83, 0x08, 0x24, 0x41, 0xc4, 0xdf, 0xb7, 0x08,
+    0x24, 0x48, 0x87, 0x08, 0x24, 0xe0, 0x91, 0x08, 0x24, 0xe8, 0xc2, 0x02,
+    0xa0, 0x08, 0x25, 0x11, 0xc4, 0x02, 0xde, 0x08, 0x25, 0x18, 0xc3, 0x09,
+    0x9e, 0x08, 0x25, 0x21, 0xc3, 0x0d, 0x14, 0x08, 0x25, 0x28, 0xc2, 0x22,
+    0xcc, 0x08, 0x25, 0x31, 0xc4, 0x18, 0x10, 0x08, 0x25, 0x38, 0x8b, 0x08,
+    0x25, 0x8b, 0x02, 0x0b, 0x4a, 0x8a, 0x08, 0x25, 0x98, 0x0a, 0xc2, 0x0b,
+    0x4e, 0xc2, 0x00, 0x74, 0x08, 0x25, 0xc0, 0x83, 0x08, 0x25, 0xc9, 0xc2,
+    0x19, 0x2c, 0x08, 0x25, 0xd0, 0x83, 0x08, 0x25, 0xe1, 0xc2, 0x19, 0x2c,
+    0x08, 0x25, 0xf1, 0xc2, 0x00, 0xd0, 0x08, 0x26, 0x80, 0xc2, 0x00, 0x74,
+    0x08, 0x26, 0x18, 0x83, 0x08, 0x26, 0x31, 0xc2, 0x00, 0xd0, 0x08, 0x26,
+    0x38, 0x83, 0x08, 0x26, 0x41, 0x15, 0x42, 0x0b, 0x64, 0x83, 0x08, 0x26,
+    0x91, 0xc2, 0x00, 0xd0, 0x08, 0x26, 0x98, 0x8b, 0x08, 0x26, 0xcb, 0x02,
+    0x0b, 0x6e, 0x8a, 0x08, 0x26, 0xd8, 0x0a, 0xc2, 0x0b, 0x72, 0xc2, 0x00,
+    0x74, 0x08, 0x27, 0x00, 0x83, 0x08, 0x27, 0x09, 0xc2, 0x19, 0x2c, 0x08,
+    0x27, 0x10, 0x83, 0x08, 0x27, 0x21, 0xc2, 0x19, 0x2c, 0x08, 0x27, 0x31,
+    0xc2, 0x00, 0xd0, 0x08, 0x27, 0xc0, 0xc2, 0x00, 0x74, 0x08, 0x27, 0x58,
+    0x83, 0x08, 0x27, 0x71, 0xc2, 0x00, 0xd0, 0x08, 0x27, 0x78, 0x83, 0x08,
+    0x27, 0x81, 0x15, 0x42, 0x0b, 0x88, 0x83, 0x08, 0x27, 0xd1, 0xc2, 0x00,
+    0xd0, 0x08, 0x27, 0xd8, 0xc2, 0x14, 0x49, 0x0e, 0x7e, 0x19, 0xc3, 0x9c,
+    0x8d, 0x0e, 0x7a, 0xe1, 0xc6, 0xcd, 0x49, 0x0e, 0x7a, 0x90, 0xc8, 0xbb,
+    0x92, 0x0e, 0x7c, 0x81, 0xc8, 0x93, 0xed, 0x0e, 0x7b, 0x80, 0xcf, 0x69,
+    0x9f, 0x0e, 0x7a, 0xc8, 0xd0, 0x5f, 0x82, 0x0e, 0x7b, 0xa9, 0xc6, 0xcd,
+    0x85, 0x0e, 0x7b, 0x68, 0x00, 0x42, 0x0b, 0x92, 0xc2, 0x25, 0xa1, 0x0e,
+    0x7c, 0x09, 0xc2, 0x14, 0x49, 0x0e, 0x7a, 0x82, 0x02, 0x0b, 0xa2, 0x45,
+    0xd6, 0xfa, 0xc2, 0x0b, 0xa8, 0xc4, 0xe1, 0xc7, 0x0e, 0x7c, 0x33, 0x02,
+    0x0b, 0xcc, 0xc6, 0xce, 0x03, 0x0e, 0x7a, 0xb2, 0x02, 0x0b, 0xd0, 0x00,
+    0x42, 0x0b, 0xd4, 0x4d, 0x75, 0xe7, 0xc2, 0x0b, 0xe0, 0x47, 0x87, 0x3a,
+    0xc2, 0x0b, 0xf8, 0x16, 0xc2, 0x0c, 0x04, 0xc8, 0x4e, 0x4b, 0x0e, 0x7b,
+    0x91, 0xc9, 0xa9, 0x48, 0x0e, 0x7b, 0x88, 0x47, 0x87, 0x3a, 0xc2, 0x0c,
+    0x10, 0xc7, 0xc8, 0x69, 0x0e, 0x7d, 0x40, 0xc7, 0x2d, 0x19, 0x0e, 0x7a,
+    0xe9, 0xc6, 0xcb, 0xdb, 0x0e, 0x7a, 0xa8, 0xcb, 0x93, 0x7d, 0x0e, 0x7b,
+    0x51, 0xc8, 0x4e, 0x4b, 0x0e, 0x7b, 0x49, 0xc9, 0xa9, 0x48, 0x0e, 0x7b,
+    0x41, 0xc8, 0xbf, 0x6a, 0x0e, 0x7b, 0x38, 0xc8, 0xbf, 0x8a, 0x0e, 0x7b,
+    0x11, 0xc4, 0xca, 0xab, 0x0e, 0x7a, 0xf8, 0xc4, 0x78, 0xdc, 0x0e, 0x7a,
+    0x03, 0x02, 0x0c, 0x22, 0xc5, 0xdb, 0xb4, 0x0e, 0x79, 0x49, 0xc6, 0xcd,
+    0xeb, 0x0e, 0x79, 0x40, 0xca, 0x9b, 0x26, 0x0e, 0x79, 0xf9, 0xc6, 0xd2,
+    0xad, 0x0e, 0x79, 0xc2, 0x02, 0x0c, 0x28, 0xc9, 0xb3, 0x56, 0x0e, 0x79,
+    0xe9, 0xd4, 0x3e, 0xf8, 0x0e, 0x79, 0xa0, 0xc5, 0xbe, 0xad, 0x0e, 0x79,
+    0xe1, 0xc6, 0x6d, 0xaa, 0x0e, 0x79, 0x19, 0x45, 0xda, 0x15, 0x42, 0x0c,
+    0x2e, 0xce, 0x38, 0x5a, 0x0e, 0x79, 0xd9, 0xc4, 0xe0, 0xab, 0x0e, 0x79,
+    0x59, 0xd3, 0x42, 0x68, 0x0e, 0x78, 0xd1, 0x49, 0xa9, 0xd8, 0x42, 0x0c,
+    0x3a, 0xc7, 0xc5, 0xde, 0x0e, 0x79, 0xd1, 0xc7, 0xca, 0x5a, 0x0e, 0x79,
+    0xa9, 0x90, 0x0e, 0x79, 0x08, 0x06, 0xc2, 0x0c, 0x46, 0x46, 0x75, 0x93,
+    0x42, 0x0c, 0x55, 0xc8, 0x3f, 0x04, 0x0e, 0x79, 0x99, 0x07, 0x42, 0x0c,
+    0x5f, 0xc5, 0xd6, 0x50, 0x0e, 0x79, 0x61, 0xc3, 0xe5, 0x72, 0x0e, 0x79,
+    0x10, 0xc6, 0xc2, 0x7a, 0x0e, 0x78, 0xf9, 0x46, 0xcd, 0xdf, 0x42, 0x0c,
+    0x6b, 0x15, 0xc2, 0x0c, 0x77, 0x43, 0x01, 0x55, 0x42, 0x0c, 0x83, 0x43,
+    0x3d, 0xd0, 0xc2, 0x0c, 0x8f, 0x43, 0x01, 0x55, 0x42, 0x0c, 0x9b, 0x43,
+    0x01, 0x55, 0xc2, 0x0c, 0xa7, 0x4d, 0x78, 0xd9, 0x42, 0x0c, 0xb3, 0xc5,
+    0x40, 0xe7, 0x08, 0xd1, 0xc9, 0xc4, 0x1e, 0x97, 0x08, 0xd1, 0xa0, 0xce,
+    0x1e, 0x74, 0x08, 0xd1, 0xb9, 0xc5, 0x1e, 0x8f, 0x08, 0xd1, 0xaa, 0x02,
+    0x0c, 0xbf, 0xc2, 0x02, 0x41, 0x08, 0xd1, 0xf1, 0xc2, 0x00, 0xdb, 0x08,
+    0xd1, 0xe9, 0xc2, 0x00, 0x39, 0x08, 0xd1, 0xe1, 0xc2, 0x19, 0x2c, 0x08,
+    0xd1, 0xd8, 0xc2, 0x00, 0xd0, 0x08, 0xd1, 0x31, 0x83, 0x08, 0xd1, 0x28,
+    0xc2, 0x00, 0xd0, 0x08, 0xd0, 0xb9, 0x83, 0x08, 0xd0, 0xb0, 0xc2, 0x00,
+    0xd0, 0x08, 0xd1, 0x21, 0x83, 0x08, 0xd1, 0x18, 0xc2, 0x00, 0xd0, 0x08,
+    0xd0, 0xa9, 0x83, 0x08, 0xd0, 0xa0, 0x97, 0x08, 0xd0, 0x41, 0x8b, 0x08,
+    0xd0, 0x38, 0x87, 0x08, 0xd0, 0x28, 0x87, 0x08, 0xd0, 0x10, 0xc9, 0xaf,
+    0x1e, 0x01, 0x51, 0x09, 0xc5, 0xd5, 0x6a, 0x01, 0x51, 0x00, 0x03, 0xc2,
+    0x0c, 0xc5, 0x12, 0xc2, 0x0c, 0xd4, 0xc5, 0xd5, 0x56, 0x05, 0x4e, 0x31,
+    0x0e, 0xc2, 0x0c, 0xe0, 0xc5, 0xdb, 0x91, 0x05, 0x4e, 0x21, 0xcd, 0x79,
+    0x9c, 0x05, 0x4e, 0xf1, 0xc9, 0xaa, 0xe6, 0x05, 0x4e, 0xf8, 0xc7, 0xc5,
+    0x13, 0x05, 0x4e, 0x79, 0xc3, 0x1f, 0x62, 0x05, 0x4e, 0x00, 0xc2, 0x01,
+    0x30, 0x05, 0x4c, 0x93, 0x02, 0x0c, 0xea, 0xc2, 0x00, 0xd0, 0x05, 0x4d,
+    0x91, 0xc2, 0x0d, 0xf6, 0x05, 0x4d, 0x8b, 0x02, 0x0c, 0xf0, 0xc2, 0x01,
+    0x4a, 0x05, 0x4d, 0x71, 0xc2, 0x00, 0xdb, 0x05, 0x4d, 0x69, 0xc2, 0x00,
+    0x39, 0x05, 0x4d, 0x5b, 0x02, 0x0c, 0xf6, 0xc2, 0x19, 0x2c, 0x05, 0x4d,
+    0x51, 0xc2, 0x01, 0xc3, 0x05, 0x4d, 0x49, 0xc2, 0x01, 0x5d, 0x05, 0x4d,
+    0x3b, 0x02, 0x0c, 0xfc, 0xc2, 0x00, 0xb0, 0x05, 0x4d, 0x2b, 0x02, 0x0d,
+    0x02, 0x10, 0xc2, 0x0d, 0x06, 0x06, 0xc2, 0x0d, 0x1f, 0x16, 0xc2, 0x0d,
+    0x2f, 0xc2, 0x25, 0x3b, 0x05, 0x4c, 0xbb, 0x02, 0x0d, 0x3f, 0xc2, 0x00,
+    0x64, 0x05, 0x4c, 0xab, 0x02, 0x0d, 0x45, 0xc2, 0x02, 0x2b, 0x05, 0x4c,
+    0x7b, 0x02, 0x0d, 0x4b, 0x91, 0x05, 0x4c, 0x71, 0x83, 0x05, 0x4c, 0x23,
+    0x02, 0x0d, 0x4f, 0x87, 0x05, 0x4c, 0x61, 0x97, 0x05, 0x4c, 0x41, 0x8b,
+    0x05, 0x4c, 0x32, 0x02, 0x0d, 0x53, 0xc4, 0x02, 0xde, 0x05, 0x4e, 0x99,
+    0xc2, 0x02, 0xa0, 0x05, 0x4e, 0x90, 0xc3, 0x09, 0x9e, 0x05, 0x4e, 0xa1,
+    0xc3, 0x0d, 0x14, 0x05, 0x4e, 0xa8, 0xc2, 0x22, 0xcc, 0x05, 0x4e, 0xb1,
+    0xc4, 0x18, 0x10, 0x05, 0x4e, 0xb8, 0x03, 0xc2, 0x0d, 0x5d, 0xc5, 0x0d,
+    0xe4, 0x05, 0x4d, 0xa8, 0xc7, 0xc5, 0x91, 0x05, 0x4d, 0xc8, 0xc6, 0xcb,
+    0xb1, 0x05, 0x4d, 0xb8, 0xc5, 0xda, 0x8d, 0x05, 0x4d, 0x98, 0xc5, 0x00,
+    0x2c, 0x01, 0x2c, 0xeb, 0x02, 0x0d, 0x69, 0xc4, 0x00, 0x49, 0x01, 0x2c,
+    0xc2, 0x02, 0x0d, 0x72, 0xc5, 0x00, 0x2c, 0x01, 0x2c, 0xb9, 0xc4, 0x00,
+    0x49, 0x01, 0x2c, 0xb0, 0x1b, 0xc2, 0x0d, 0x78, 0x0c, 0xc2, 0x0d, 0x8d,
+    0x14, 0xc2, 0x0d, 0xa9, 0x09, 0xc2, 0x0d, 0xcc, 0x1c, 0xc2, 0x0d, 0xf3,
+    0x04, 0xc2, 0x0e, 0x1a, 0x06, 0xc2, 0x0e, 0x3d, 0x8b, 0x05, 0x0b, 0xfb,
+    0x02, 0x0e, 0x60, 0x83, 0x05, 0x0c, 0x2b, 0x02, 0x0e, 0x73, 0x97, 0x05,
+    0x0c, 0x9b, 0x02, 0x0e, 0x7b, 0x91, 0x05, 0x0c, 0x63, 0x02, 0x0e, 0x95,
+    0x87, 0x05, 0x0c, 0x7a, 0x02, 0x0e, 0xa1, 0x0c, 0xc2, 0x0e, 0xa9, 0x9b,
+    0x05, 0x1f, 0xc3, 0x02, 0x0e, 0xc5, 0x97, 0x05, 0x1f, 0x93, 0x02, 0x0e,
+    0xd8, 0x91, 0x05, 0x1f, 0x73, 0x02, 0x0e, 0xf2, 0x8b, 0x05, 0x1f, 0x12,
+    0x02, 0x0e, 0xfe, 0x9b, 0x05, 0x20, 0xa3, 0x02, 0x0f, 0x11, 0x97, 0x05,
+    0x20, 0x73, 0x02, 0x0f, 0x24, 0x91, 0x05, 0x20, 0x53, 0x02, 0x0f, 0x3e,
+    0x8b, 0x05, 0x1f, 0xf2, 0x02, 0x0f, 0x4a, 0x9b, 0x05, 0x1e, 0xe3, 0x02,
+    0x0f, 0x5d, 0x97, 0x05, 0x1e, 0xb3, 0x02, 0x0f, 0x70, 0x87, 0x05, 0x1e,
+    0x93, 0x02, 0x0f, 0x8a, 0x91, 0x05, 0x1e, 0x7b, 0x02, 0x0f, 0x92, 0x83,
+    0x05, 0x1e, 0x43, 0x02, 0x0f, 0x9e, 0x14, 0x42, 0x0f, 0xaa, 0x0a, 0xc2,
+    0x0f, 0xcd, 0x15, 0xc2, 0x0f, 0xf0, 0x8b, 0x05, 0x18, 0x5b, 0x02, 0x10,
+    0x1a, 0x83, 0x05, 0x18, 0x93, 0x02, 0x10, 0x2d, 0x97, 0x05, 0x19, 0x03,
+    0x02, 0x10, 0x39, 0x91, 0x05, 0x18, 0xcb, 0x02, 0x10, 0x53, 0x87, 0x05,
+    0x18, 0xe3, 0x02, 0x10, 0x5f, 0x9b, 0x05, 0x19, 0x32, 0x02, 0x10, 0x67,
+    0x0a, 0xc2, 0x10, 0x7a, 0x9b, 0x05, 0x16, 0x63, 0x02, 0x10, 0x9d, 0x87,
+    0x05, 0x16, 0x13, 0x02, 0x10, 0xb0, 0x97, 0x05, 0x16, 0x33, 0x02, 0x10,
+    0xb8, 0x8b, 0x05, 0x15, 0x83, 0x02, 0x10, 0xd2, 0x83, 0x05, 0x15, 0xc3,
+    0x02, 0x10, 0xe5, 0x91, 0x05, 0x15, 0xfa, 0x02, 0x10, 0xf1, 0x87, 0x05,
+    0x15, 0x03, 0x02, 0x10, 0xfd, 0x91, 0x05, 0x14, 0xeb, 0x02, 0x11, 0x05,
+    0x97, 0x05, 0x15, 0x23, 0x02, 0x11, 0x11, 0x83, 0x05, 0x14, 0xb3, 0x02,
+    0x11, 0x2b, 0x8b, 0x05, 0x14, 0x7b, 0x02, 0x11, 0x37, 0x1c, 0xc2, 0x11,
+    0x4a, 0x0a, 0xc2, 0x11, 0x74, 0x9b, 0x05, 0x15, 0x52, 0x02, 0x11, 0x97,
+    0x87, 0x05, 0x14, 0x5b, 0x02, 0x11, 0xaa, 0x91, 0x05, 0x14, 0x43, 0x02,
+    0x11, 0xb2, 0x97, 0x05, 0x00, 0xab, 0x02, 0x11, 0xba, 0x83, 0x05, 0x14,
+    0x12, 0x02, 0x11, 0xc1, 0x87, 0x05, 0x13, 0xf3, 0x02, 0x11, 0xcd, 0x1a,
+    0xc2, 0x11, 0xd5, 0x0b, 0xc2, 0x11, 0xfa, 0x83, 0x05, 0x13, 0x9b, 0x02,
+    0x12, 0x05, 0xc2, 0x01, 0xba, 0x05, 0x13, 0xbb, 0x02, 0x12, 0x11, 0x91,
+    0x05, 0x13, 0xdb, 0x02, 0x12, 0x1d, 0x0f, 0xc2, 0x12, 0x29, 0x10, 0xc2,
+    0x12, 0x4c, 0x0e, 0x42, 0x12, 0x69, 0x8b, 0x05, 0x23, 0x9b, 0x02, 0x12,
+    0x93, 0x97, 0x05, 0x24, 0x1b, 0x02, 0x12, 0xa6, 0x91, 0x05, 0x23, 0xfb,
+    0x02, 0x12, 0xc0, 0x9b, 0x05, 0x24, 0x4a, 0x02, 0x12, 0xcc, 0x9b, 0x05,
+    0x23, 0x6b, 0x02, 0x12, 0xdf, 0x8b, 0x05, 0x22, 0xfb, 0x02, 0x12, 0xf2,
+    0x91, 0x05, 0x23, 0x4b, 0x02, 0x13, 0x05, 0xc2, 0x01, 0xba, 0x05, 0x23,
+    0x32, 0x02, 0x13, 0x11, 0x09, 0xc2, 0x13, 0x15, 0x8b, 0x05, 0x05, 0x83,
+    0x02, 0x13, 0x3a, 0x83, 0x05, 0x05, 0xbb, 0x02, 0x13, 0x4d, 0x97, 0x05,
+    0x06, 0x2b, 0x02, 0x13, 0x59, 0x91, 0x05, 0x05, 0xfb, 0x02, 0x13, 0x73,
+    0x87, 0x05, 0x06, 0x13, 0x02, 0x13, 0x7f, 0x9b, 0x05, 0x06, 0x5a, 0x02,
+    0x13, 0x83, 0x96, 0x05, 0x00, 0x03, 0x02, 0x13, 0x8f, 0x9a, 0x05, 0x00,
+    0x09, 0x92, 0x05, 0x00, 0x19, 0x87, 0x05, 0x00, 0x32, 0x02, 0x13, 0x95,
+    0x96, 0x05, 0x00, 0x41, 0x9a, 0x05, 0x00, 0x49, 0x92, 0x05, 0x00, 0x58,
+    0x9a, 0x05, 0x00, 0x61, 0x92, 0x05, 0x00, 0x70, 0x96, 0x05, 0x00, 0x79,
+    0x9a, 0x05, 0x00, 0x81, 0x92, 0x05, 0x00, 0x90, 0x9a, 0x05, 0x00, 0x98,
+    0x8b, 0x05, 0x00, 0xc3, 0x02, 0x13, 0xa1, 0x83, 0x05, 0x01, 0x03, 0x02,
+    0x13, 0xb4, 0x97, 0x05, 0x01, 0x73, 0x02, 0x13, 0xc0, 0x91, 0x05, 0x01,
+    0x3b, 0x02, 0x13, 0xda, 0x87, 0x05, 0x01, 0x53, 0x02, 0x13, 0xe6, 0x9b,
+    0x05, 0x01, 0xa3, 0x02, 0x13, 0xee, 0x04, 0x42, 0x14, 0x01, 0x8b, 0x05,
+    0x01, 0xd3, 0x02, 0x14, 0x2b, 0x83, 0x05, 0x02, 0x0b, 0x02, 0x14, 0x3e,
+    0x97, 0x05, 0x02, 0x63, 0x02, 0x14, 0x4a, 0x91, 0x05, 0x02, 0x43, 0x02,
+    0x14, 0x64, 0x9b, 0x05, 0x02, 0x92, 0x02, 0x14, 0x70, 0x8b, 0x05, 0x06,
+    0x7b, 0x02, 0x14, 0x83, 0x83, 0x05, 0x06, 0x9b, 0x02, 0x14, 0x8f, 0x91,
+    0x05, 0x06, 0xb3, 0x02, 0x14, 0x9b, 0x97, 0x05, 0x06, 0xd3, 0x02, 0x14,
+    0xa3, 0x9b, 0x05, 0x07, 0x02, 0x02, 0x14, 0xb6, 0x8b, 0x05, 0x07, 0x23,
+    0x02, 0x14, 0xc2, 0x83, 0x05, 0x07, 0x63, 0x02, 0x14, 0xd5, 0x91, 0x05,
+    0x07, 0x83, 0x02, 0x14, 0xe1, 0x07, 0xc2, 0x14, 0xed, 0x97, 0x05, 0x07,
+    0xb3, 0x02, 0x14, 0xf5, 0x9b, 0x05, 0x07, 0xe2, 0x02, 0x15, 0x08, 0x8b,
+    0x05, 0x08, 0x13, 0x02, 0x15, 0x1b, 0x83, 0x05, 0x08, 0x4b, 0x02, 0x15,
+    0x2e, 0x97, 0x05, 0x08, 0xb3, 0x02, 0x15, 0x3a, 0x91, 0x05, 0x08, 0x7b,
+    0x02, 0x15, 0x54, 0x87, 0x05, 0x08, 0x93, 0x02, 0x15, 0x60, 0x06, 0x42,
+    0x15, 0x68, 0x8b, 0x05, 0x08, 0xe3, 0x02, 0x15, 0x8b, 0x83, 0x05, 0x09,
+    0x1b, 0x02, 0x15, 0x9e, 0x97, 0x05, 0x09, 0x93, 0x02, 0x15, 0xaa, 0x91,
+    0x05, 0x09, 0x5b, 0x02, 0x15, 0xc4, 0x87, 0x05, 0x09, 0x72, 0x02, 0x15,
+    0xd0, 0x8b, 0x05, 0x0d, 0xcb, 0x02, 0x15, 0xd8, 0x83, 0x05, 0x0e, 0x0b,
+    0x02, 0x15, 0xeb, 0x97, 0x05, 0x0e, 0x83, 0x02, 0x15, 0xf7, 0x91, 0x05,
+    0x0e, 0x4b, 0x02, 0x16, 0x11, 0x87, 0x05, 0x0e, 0x63, 0x02, 0x16, 0x1d,
+    0x9b, 0x05, 0x0e, 0xb2, 0x02, 0x16, 0x25, 0x8b, 0x05, 0x0e, 0xe3, 0x02,
+    0x16, 0x38, 0x83, 0x05, 0x0f, 0x23, 0x02, 0x16, 0x4b, 0x97, 0x05, 0x0f,
+    0xa3, 0x02, 0x16, 0x57, 0x91, 0x05, 0x0f, 0x63, 0x02, 0x16, 0x71, 0x87,
+    0x05, 0x0f, 0x83, 0x02, 0x16, 0x7d, 0x09, 0x42, 0x16, 0x89, 0x8b, 0x05,
+    0x0f, 0xd3, 0x02, 0x16, 0xac, 0x83, 0x05, 0x10, 0x0b, 0x02, 0x16, 0xbf,
+    0x97, 0x05, 0x10, 0x83, 0x02, 0x16, 0xcb, 0x91, 0x05, 0x10, 0x43, 0x02,
+    0x16, 0xe5, 0x87, 0x05, 0x10, 0x62, 0x02, 0x16, 0xf1, 0x8b, 0x05, 0x24,
+    0x8b, 0x02, 0x16, 0xfd, 0xc2, 0x1d, 0xc1, 0x05, 0x24, 0xd0, 0xc2, 0x00,
+    0x8d, 0x05, 0x24, 0x91, 0x87, 0x05, 0x26, 0x30, 0x1b, 0xc2, 0x17, 0x01,
+    0xc3, 0xe4, 0xe8, 0x05, 0x25, 0xa1, 0xc3, 0xa9, 0x68, 0x05, 0x26, 0x28,
+    0x9b, 0x05, 0x25, 0xe3, 0x02, 0x17, 0x0d, 0xc3, 0xe4, 0xe5, 0x05, 0x25,
+    0xe9, 0xc2, 0x00, 0x7e, 0x05, 0x25, 0xf1, 0xc2, 0x01, 0x7f, 0x05, 0x26,
+    0x18, 0xc2, 0x00, 0xba, 0x05, 0x24, 0xa9, 0x0a, 0x42, 0x17, 0x15, 0x09,
+    0xc2, 0x17, 0x2b, 0xc2, 0x02, 0x37, 0x05, 0x24, 0xb9, 0x83, 0x05, 0x25,
+    0x09, 0xc2, 0x01, 0xbb, 0x05, 0x25, 0xb0, 0x8b, 0x05, 0x24, 0xc1, 0xc2,
+    0x00, 0x11, 0x05, 0x24, 0xe0, 0x1a, 0xc2, 0x17, 0x37, 0xc2, 0x00, 0xa2,
+    0x05, 0x25, 0x68, 0xc3, 0x02, 0xaa, 0x05, 0x24, 0xd9, 0xc2, 0x00, 0x33,
+    0x05, 0x25, 0x28, 0x91, 0x05, 0x24, 0xe9, 0xc2, 0x00, 0x8d, 0x05, 0x25,
+    0x70, 0xc2, 0x00, 0xa4, 0x05, 0x24, 0xf1, 0xc2, 0x63, 0xd6, 0x05, 0x25,
+    0x60, 0xc2, 0x00, 0xfe, 0x05, 0x25, 0x01, 0x97, 0x05, 0x25, 0x40, 0x17,
+    0xc2, 0x17, 0x49, 0xc2, 0x01, 0xbb, 0x05, 0x25, 0x59, 0x83, 0x05, 0x25,
+    0x91, 0xc4, 0xdf, 0x23, 0x05, 0x26, 0x20, 0xc3, 0x66, 0x20, 0x05, 0x25,
+    0x21, 0x97, 0x05, 0x25, 0xc8, 0x0c, 0xc2, 0x17, 0x51, 0x91, 0x05, 0x25,
+    0x98, 0xc2, 0x00, 0x33, 0x05, 0x25, 0x79, 0xc2, 0x02, 0x37, 0x05, 0x25,
+    0x88, 0xd6, 0x30, 0x64, 0x08, 0x75, 0x88, 0xcf, 0x33, 0xad, 0x08, 0x75,
+    0x80, 0x96, 0x08, 0x75, 0x49, 0x99, 0x08, 0x75, 0x31, 0xc2, 0x17, 0xb6,
+    0x08, 0x74, 0xb9, 0xc3, 0x6b, 0x53, 0x08, 0x74, 0x00, 0xc2, 0x0c, 0x42,
+    0x08, 0x75, 0x39, 0xc2, 0x00, 0xd0, 0x08, 0x74, 0x48, 0xc3, 0x48, 0x60,
+    0x08, 0x74, 0xf1, 0xc2, 0x0f, 0x9b, 0x08, 0x74, 0xe8, 0xcf, 0x6b, 0x25,
+    0x08, 0x74, 0xd8, 0xc4, 0xdf, 0xa3, 0x08, 0x74, 0xc1, 0x83, 0x08, 0x74,
+    0x50, 0x87, 0x08, 0x74, 0xb1, 0x83, 0x08, 0x74, 0x7a, 0x02, 0x17, 0x61,
+    0x83, 0x08, 0x74, 0xa9, 0xc2, 0x01, 0x7f, 0x08, 0x74, 0x20, 0x86, 0x08,
+    0x74, 0xa1, 0x8e, 0x08, 0x74, 0x58, 0xc2, 0x01, 0x9d, 0x08, 0x74, 0x99,
+    0xc3, 0x11, 0xef, 0x08, 0x74, 0x91, 0xc2, 0x00, 0x74, 0x08, 0x74, 0x89,
+    0x87, 0x08, 0x74, 0x28, 0xc2, 0x00, 0xd0, 0x08, 0x74, 0x71, 0x83, 0x08,
+    0x74, 0x68, 0x0a, 0xc2, 0x17, 0x65, 0xc2, 0x03, 0x4e, 0x08, 0x74, 0x30,
+    0xc2, 0x01, 0x7f, 0x08, 0x74, 0x19, 0x87, 0x08, 0x74, 0x10, 0xc9, 0x1c,
+    0x63, 0x00, 0x04, 0xa1, 0xc3, 0x16, 0x32, 0x70, 0x03, 0xf8, 0x83, 0x08,
+    0xd5, 0xf9, 0x91, 0x08, 0xd5, 0xf1, 0x8b, 0x08, 0xd5, 0xe9, 0x87, 0x08,
+    0xd5, 0xe0, 0x9b, 0x00, 0xc5, 0xfb, 0x02, 0x17, 0x71, 0x83, 0x00, 0xa7,
+    0xaa, 0x02, 0x17, 0x77, 0x19, 0xc2, 0x17, 0x7b, 0x83, 0x00, 0xa8, 0xab,
+    0x02, 0x17, 0x94, 0x91, 0x00, 0xa8, 0x9b, 0x02, 0x17, 0x9c, 0x8b, 0x00,
+    0xa8, 0x8b, 0x02, 0x17, 0xa4, 0x87, 0x00, 0xa8, 0x80, 0x9b, 0x00, 0xc5,
+    0xf1, 0x4c, 0x86, 0x01, 0xc2, 0x17, 0xa8, 0x91, 0x00, 0xa7, 0x90, 0x83,
+    0x00, 0xa8, 0x03, 0x02, 0x17, 0xc0, 0x87, 0x00, 0xa7, 0xb1, 0x8b, 0x00,
+    0xa7, 0xc3, 0x02, 0x17, 0xc4, 0x91, 0x00, 0xa7, 0xe2, 0x02, 0x17, 0xc8,
+    0x8b, 0x00, 0xa7, 0x80, 0x47, 0xc6, 0x8d, 0xc2, 0x17, 0xcc, 0x9b, 0x00,
+    0xc5, 0xe1, 0x46, 0xd3, 0x4f, 0xc2, 0x17, 0xd6, 0x83, 0x00, 0xa6, 0x42,
+    0x02, 0x18, 0x02, 0x91, 0x00, 0xc6, 0x53, 0x02, 0x18, 0x06, 0x8b, 0x00,
+    0xc6, 0x33, 0x02, 0x18, 0x0a, 0x87, 0x00, 0xa6, 0x49, 0x83, 0x00, 0xa6,
+    0x5a, 0x02, 0x18, 0x0e, 0x9b, 0x00, 0xc5, 0xd9, 0x91, 0x00, 0xa6, 0x28,
+    0x83, 0x00, 0xb3, 0xab, 0x02, 0x18, 0x12, 0x91, 0x00, 0xb3, 0x9b, 0x02,
+    0x18, 0x16, 0x8b, 0x00, 0xb3, 0x8a, 0x02, 0x18, 0x1a, 0x83, 0x00, 0xac,
+    0x9b, 0x02, 0x18, 0x1e, 0x91, 0x00, 0xac, 0x8b, 0x02, 0x18, 0x29, 0x8b,
+    0x00, 0xac, 0x7a, 0x02, 0x18, 0x2d, 0xc4, 0x4b, 0x20, 0x00, 0xab, 0xe1,
+    0xc4, 0xe1, 0x1f, 0x00, 0xab, 0xda, 0x02, 0x18, 0x31, 0x8b, 0x00, 0xab,
+    0x0b, 0x02, 0x18, 0x4a, 0x87, 0x00, 0xaa, 0xf8, 0x8b, 0x00, 0xa6, 0x18,
+    0x46, 0x69, 0x75, 0xc2, 0x18, 0x4e, 0x83, 0x00, 0xa4, 0x8a, 0x02, 0x18,
+    0xa6, 0x91, 0x00, 0xa4, 0xc3, 0x02, 0x18, 0xaa, 0x8b, 0x00, 0xa4, 0xa3,
+    0x02, 0x18, 0xae, 0x87, 0x00, 0xa4, 0x91, 0x83, 0x00, 0xa4, 0xe2, 0x02,
+    0x18, 0xb2, 0x91, 0x00, 0xa4, 0x70, 0x8b, 0x00, 0xa4, 0x60, 0x94, 0x00,
+    0xc7, 0xa1, 0x8e, 0x00, 0xc7, 0x98, 0x99, 0x00, 0xb3, 0xfb, 0x02, 0x18,
+    0xb6, 0x0d, 0xc2, 0x18, 0xc6, 0x10, 0xc2, 0x18, 0xd6, 0x83, 0x00, 0xad,
+    0x99, 0x91, 0x00, 0xad, 0x91, 0x8b, 0x00, 0xad, 0x89, 0x87, 0x00, 0xad,
+    0x81, 0x95, 0x00, 0xa8, 0x40, 0x91, 0x00, 0xac, 0x43, 0x02, 0x18, 0xe6,
+    0xc2, 0x00, 0x28, 0x00, 0xc7, 0x41, 0x83, 0x00, 0xac, 0x49, 0x8b, 0x00,
+    0xac, 0x39, 0x87, 0x00, 0xac, 0x30, 0x8a, 0x00, 0xab, 0x7b, 0x02, 0x18,
+    0xea, 0x87, 0x00, 0xa3, 0x39, 0x8b, 0x00, 0xa3, 0x41, 0x91, 0x00, 0xa3,
+    0x49, 0x83, 0x00, 0xa3, 0x50, 0x19, 0xc2, 0x19, 0x06, 0xc8, 0xbc, 0x52,
+    0x00, 0xad, 0x73, 0x02, 0x19, 0x11, 0x83, 0x00, 0xab, 0x33, 0x02, 0x19,
+    0x2a, 0x91, 0x00, 0xab, 0x23, 0x02, 0x19, 0x2e, 0x8b, 0x00, 0xab, 0x03,
+    0x02, 0x19, 0x32, 0x87, 0x00, 0xaa, 0xf0, 0x9b, 0x00, 0xc5, 0xb9, 0x83,
+    0x00, 0xa2, 0xb2, 0x02, 0x19, 0x36, 0x83, 0x00, 0xab, 0x99, 0x91, 0x00,
+    0xab, 0x91, 0x8b, 0x00, 0xab, 0x89, 0x87, 0x00, 0xab, 0x80, 0x91, 0x00,
+    0xa2, 0xeb, 0x02, 0x19, 0x3a, 0x8b, 0x00, 0xa2, 0xcb, 0x02, 0x19, 0x3e,
+    0x87, 0x00, 0xa2, 0xb9, 0x83, 0x00, 0xa3, 0x0a, 0x02, 0x19, 0x42, 0x91,
+    0x00, 0xa2, 0x88, 0x8b, 0x00, 0xa2, 0x78, 0x42, 0x00, 0x15, 0x42, 0x19,
+    0x46, 0x9b, 0x00, 0xc5, 0x99, 0x83, 0x00, 0xa0, 0xc8, 0x91, 0x00, 0xa0,
+    0xa2, 0x02, 0x19, 0x52, 0x8b, 0x00, 0xa0, 0x80, 0xc2, 0x00, 0x28, 0x00,
+    0xc7, 0x01, 0x87, 0x00, 0xaa, 0x18, 0x83, 0x00, 0xc6, 0x9b, 0x02, 0x19,
+    0x58, 0x91, 0x00, 0xc6, 0x8b, 0x02, 0x19, 0x5c, 0x8b, 0x00, 0xc6, 0x7b,
+    0x02, 0x19, 0x60, 0xc2, 0x02, 0xe0, 0x00, 0xc6, 0x70, 0x9b, 0x00, 0xc6,
+    0x29, 0x83, 0x00, 0xaa, 0x62, 0x02, 0x19, 0x64, 0x91, 0x00, 0xaa, 0x48,
+    0x8b, 0x00, 0xaa, 0x38, 0x44, 0x10, 0x6a, 0xc2, 0x19, 0x68, 0x8b, 0x00,
+    0xaa, 0xb0, 0x83, 0x00, 0xaa, 0xd2, 0x02, 0x19, 0x9a, 0x91, 0x00, 0xaa,
+    0xc0, 0x95, 0x00, 0xc6, 0xd3, 0x02, 0x19, 0x9e, 0x90, 0x00, 0xc6, 0xcb,
+    0x02, 0x19, 0xa2, 0x8f, 0x00, 0xc6, 0xc1, 0x85, 0x00, 0xc6, 0xb9, 0x8d,
+    0x00, 0xc6, 0xb1, 0x96, 0x00, 0xc6, 0xa9, 0x92, 0x00, 0xc6, 0xa0, 0x9b,
+    0x00, 0xc6, 0x21, 0x83, 0x00, 0xa9, 0x72, 0x02, 0x19, 0xa6, 0x9b, 0x00,
+    0xc6, 0x19, 0x91, 0x00, 0xa9, 0x58, 0x83, 0x00, 0xa9, 0xcb, 0x02, 0x19,
+    0xaa, 0x91, 0x00, 0xa9, 0xab, 0x02, 0x19, 0xae, 0x8b, 0x00, 0xa9, 0x8b,
+    0x02, 0x19, 0xb2, 0x87, 0x00, 0xa9, 0x78, 0xc3, 0x4d, 0xc4, 0x00, 0xa9,
+    0x61, 0xc3, 0x2b, 0xd4, 0x00, 0xa2, 0x91, 0x12, 0xc2, 0x19, 0xb6, 0xc3,
+    0x90, 0xd8, 0x00, 0xa4, 0x79, 0xc2, 0x01, 0x24, 0x00, 0xa0, 0x39, 0x99,
+    0x00, 0xa0, 0xe9, 0xc3, 0x15, 0xdb, 0x00, 0xa5, 0x49, 0xc3, 0x11, 0xf1,
+    0x00, 0xa6, 0x31, 0xc3, 0x15, 0x31, 0x00, 0xa6, 0xc9, 0xc3, 0x19, 0xe1,
+    0x00, 0xa7, 0x99, 0xc3, 0xd5, 0x5e, 0x00, 0xa3, 0x88, 0x8b, 0x00, 0xa9,
+    0x48, 0x9b, 0x00, 0xc5, 0xe9, 0x83, 0x00, 0xa6, 0xda, 0x02, 0x19, 0xc2,
+    0x83, 0x00, 0xad, 0x23, 0x02, 0x19, 0xc6, 0x91, 0x00, 0xad, 0x13, 0x02,
+    0x19, 0xca, 0x8b, 0x00, 0xad, 0x02, 0x02, 0x19, 0xce, 0x8b, 0x00, 0xa6,
+    0xb0, 0x91, 0x00, 0xa6, 0xc0, 0x87, 0x00, 0xa6, 0xe1, 0x8b, 0x00, 0xa6,
+    0xf3, 0x02, 0x19, 0xd2, 0x91, 0x00, 0xa7, 0x13, 0x02, 0x19, 0xd6, 0x83,
+    0x00, 0xa7, 0x32, 0x02, 0x19, 0xda, 0x9b, 0x00, 0xc5, 0xd1, 0x83, 0x00,
+    0xa5, 0x5a, 0x02, 0x19, 0xde, 0x45, 0x30, 0xa1, 0x42, 0x19, 0xe2, 0x91,
+    0x00, 0xa5, 0x42, 0x02, 0x19, 0xea, 0x8b, 0x00, 0xa5, 0x30, 0x87, 0x00,
+    0xa5, 0x61, 0x8b, 0x00, 0xa5, 0x73, 0x02, 0x19, 0xf0, 0x91, 0x00, 0xa5,
+    0x93, 0x02, 0x19, 0xf4, 0x83, 0x00, 0xa5, 0xb2, 0x02, 0x19, 0xf8, 0x83,
+    0x00, 0xa3, 0xf3, 0x02, 0x19, 0xfc, 0x87, 0x00, 0xa3, 0xa1, 0x8b, 0x00,
+    0xa3, 0xb3, 0x02, 0x1a, 0x04, 0x91, 0x00, 0xa3, 0xd2, 0x02, 0x1a, 0x08,
+    0x9b, 0x00, 0xc5, 0xc1, 0x83, 0x00, 0xa3, 0x9a, 0x02, 0x1a, 0x0c, 0x8b,
+    0x00, 0xa3, 0x70, 0x91, 0x00, 0xa3, 0x80, 0x91, 0x00, 0xa2, 0x03, 0x02,
+    0x1a, 0x10, 0x83, 0x00, 0xa2, 0x23, 0x02, 0x1a, 0x18, 0x8b, 0x00, 0xa1,
+    0xe3, 0x02, 0x1a, 0x1c, 0x87, 0x00, 0xa1, 0xd0, 0x9b, 0x00, 0xc5, 0xa9,
+    0x83, 0x00, 0xa1, 0xca, 0x02, 0x1a, 0x20, 0x9b, 0x00, 0xc5, 0xa1, 0x91,
+    0x00, 0xa1, 0xa0, 0x8b, 0x00, 0xa1, 0x90, 0x9b, 0x00, 0xc5, 0x91, 0x8b,
+    0x00, 0xa0, 0x10, 0xc7, 0xc6, 0x4e, 0x00, 0xad, 0x78, 0x95, 0x00, 0xa8,
+    0x31, 0x8f, 0x00, 0xa5, 0xf0, 0x8b, 0x00, 0xb3, 0x79, 0x83, 0x00, 0xac,
+    0x22, 0x02, 0x1a, 0x24, 0x91, 0x00, 0xac, 0x10, 0x8b, 0x00, 0xac, 0x00,
+    0x97, 0x08, 0x15, 0x22, 0x02, 0x1a, 0x28, 0x9f, 0x08, 0x16, 0x70, 0xa0,
+    0x08, 0x16, 0x61, 0xa1, 0x08, 0x16, 0x69, 0x9f, 0x08, 0x16, 0x58, 0x9f,
+    0x08, 0x15, 0xb0, 0x9f, 0x08, 0x15, 0x78, 0x9f, 0x08, 0x16, 0x18, 0xc2,
+    0x00, 0x72, 0x08, 0x29, 0x81, 0xc2, 0x00, 0xbf, 0x08, 0x2a, 0x40, 0xc2,
+    0x03, 0x4e, 0x08, 0x29, 0x91, 0xc4, 0xdf, 0x8f, 0x08, 0x2a, 0xc0, 0xc2,
+    0x00, 0xfe, 0x08, 0x29, 0x99, 0xc3, 0x2e, 0x0f, 0x08, 0x2a, 0x09, 0x1c,
+    0x42, 0x1a, 0x34, 0x84, 0x08, 0x29, 0xa1, 0xc2, 0x17, 0xb6, 0x08, 0x29,
+    0xb0, 0xc3, 0x1a, 0xfe, 0x08, 0x29, 0xa9, 0x0a, 0x42, 0x1a, 0x40, 0xc2,
+    0x02, 0x2c, 0x08, 0x29, 0xc1, 0xc3, 0x4b, 0x13, 0x08, 0x2a, 0x99, 0xc3,
+    0xe5, 0xc0, 0x08, 0x2a, 0xe0, 0x0a, 0xc2, 0x1a, 0x4a, 0x03, 0xc2, 0x1a,
+    0x5b, 0x42, 0x19, 0x2c, 0x42, 0x1a, 0x65, 0xc3, 0x02, 0x05, 0x08, 0x29,
+    0xd1, 0xc3, 0xe5, 0x51, 0x08, 0x2b, 0x08, 0xc2, 0x01, 0x5f, 0x08, 0x29,
+    0xe1, 0xc3, 0x2d, 0xfd, 0x08, 0x29, 0xf9, 0xc2, 0x01, 0x48, 0x08, 0x2a,
+    0xf0, 0x0a, 0xc2, 0x1a, 0x6d, 0xc3, 0xe6, 0x44, 0x08, 0x2a, 0xd0, 0xc2,
+    0x00, 0xd1, 0x08, 0x29, 0xf1, 0xc3, 0xb7, 0xb1, 0x08, 0x2a, 0x28, 0xc3,
+    0xe5, 0xcf, 0x08, 0x2a, 0x19, 0xc3, 0x53, 0x85, 0x08, 0x2a, 0x88, 0xc2,
+    0x00, 0xb1, 0x08, 0x2a, 0x21, 0xc2, 0x33, 0x52, 0x08, 0x2b, 0x18, 0x9b,
+    0x08, 0x2a, 0x39, 0x94, 0x08, 0x2a, 0x68, 0xc2, 0x00, 0xc4, 0x08, 0x2a,
+    0xb9, 0xc3, 0xe5, 0xc0, 0x08, 0x2b, 0x10, 0x9d, 0x17, 0xcf, 0x01, 0x88,
+    0x17, 0xcf, 0x79, 0x87, 0x17, 0xcf, 0x71, 0x86, 0x17, 0xcf, 0x69, 0x85,
+    0x17, 0xcf, 0x61, 0x84, 0x17, 0xcf, 0x59, 0x83, 0x17, 0xcf, 0x51, 0xa6,
+    0x17, 0xcf, 0x49, 0xa5, 0x17, 0xcf, 0x41, 0xa4, 0x17, 0xcf, 0x39, 0xa3,
+    0x17, 0xcf, 0x31, 0xa2, 0x17, 0xcf, 0x29, 0xa1, 0x17, 0xcf, 0x21, 0xa0,
+    0x17, 0xcf, 0x19, 0x9f, 0x17, 0xcf, 0x11, 0x9e, 0x17, 0xcf, 0x08, 0x88,
+    0x17, 0xce, 0xf9, 0x87, 0x17, 0xce, 0xf1, 0xa6, 0x17, 0xce, 0xc9, 0x86,
+    0x17, 0xce, 0xe9, 0x85, 0x17, 0xce, 0xe1, 0x84, 0x17, 0xce, 0xd9, 0x83,
+    0x17, 0xce, 0xd1, 0xa5, 0x17, 0xce, 0xc1, 0xa4, 0x17, 0xce, 0xb9, 0xa3,
+    0x17, 0xce, 0xb1, 0xa2, 0x17, 0xce, 0xa9, 0xa1, 0x17, 0xce, 0xa1, 0xa0,
+    0x17, 0xce, 0x99, 0x9f, 0x17, 0xce, 0x91, 0x9e, 0x17, 0xce, 0x89, 0x9d,
+    0x17, 0xce, 0x80, 0x83, 0x17, 0xcd, 0x51, 0xa6, 0x17, 0xcd, 0x49, 0xa5,
+    0x17, 0xcd, 0x41, 0xa4, 0x17, 0xcd, 0x39, 0xa3, 0x17, 0xcd, 0x31, 0xa2,
+    0x17, 0xcd, 0x29, 0xa1, 0x17, 0xcd, 0x21, 0x86, 0x17, 0xcd, 0x69, 0x85,
+    0x17, 0xcd, 0x61, 0x84, 0x17, 0xcd, 0x59, 0xa0, 0x17, 0xcd, 0x19, 0x9f,
+    0x17, 0xcd, 0x11, 0x9e, 0x17, 0xcd, 0x09, 0x9d, 0x17, 0xcd, 0x01, 0x87,
+    0x17, 0xcd, 0x71, 0x88, 0x17, 0xcd, 0x78, 0x88, 0x17, 0xcf, 0xf9, 0x87,
+    0x17, 0xcf, 0xf1, 0x86, 0x17, 0xcf, 0xe9, 0x85, 0x17, 0xcf, 0xe1, 0x84,
+    0x17, 0xcf, 0xd9, 0x83, 0x17, 0xcf, 0xd1, 0xa6, 0x17, 0xcf, 0xc9, 0xa5,
+    0x17, 0xcf, 0xc1, 0xa4, 0x17, 0xcf, 0xb9, 0xa3, 0x17, 0xcf, 0xb1, 0xa2,
+    0x17, 0xcf, 0xa9, 0xa1, 0x17, 0xcf, 0xa1, 0xa0, 0x17, 0xcf, 0x99, 0x9f,
+    0x17, 0xcf, 0x91, 0x9e, 0x17, 0xcf, 0x89, 0x9d, 0x17, 0xcf, 0x80, 0x9d,
+    0x17, 0xcb, 0x81, 0x88, 0x17, 0xcb, 0xf9, 0x87, 0x17, 0xcb, 0xf1, 0x86,
+    0x17, 0xcb, 0xe9, 0x85, 0x17, 0xcb, 0xe1, 0x84, 0x17, 0xcb, 0xd9, 0x83,
+    0x17, 0xcb, 0xd1, 0xa6, 0x17, 0xcb, 0xc9, 0xa5, 0x17, 0xcb, 0xc1, 0xa4,
+    0x17, 0xcb, 0xb9, 0xa3, 0x17, 0xcb, 0xb1, 0xa2, 0x17, 0xcb, 0xa9, 0xa1,
+    0x17, 0xcb, 0xa1, 0xa0, 0x17, 0xcb, 0x99, 0x9f, 0x17, 0xcb, 0x91, 0x9e,
+    0x17, 0xcb, 0x88, 0x88, 0x17, 0xcb, 0x79, 0x87, 0x17, 0xcb, 0x71, 0x86,
+    0x17, 0xcb, 0x69, 0x85, 0x17, 0xcb, 0x61, 0x84, 0x17, 0xcb, 0x59, 0x83,
+    0x17, 0xcb, 0x51, 0xa6, 0x17, 0xcb, 0x49, 0xa5, 0x17, 0xcb, 0x41, 0xa4,
+    0x17, 0xcb, 0x39, 0xa3, 0x17, 0xcb, 0x31, 0xa2, 0x17, 0xcb, 0x29, 0xa1,
+    0x17, 0xcb, 0x21, 0x9d, 0x17, 0xcb, 0x01, 0x9e, 0x17, 0xcb, 0x09, 0x9f,
+    0x17, 0xcb, 0x11, 0xa0, 0x17, 0xcb, 0x18, 0x9d, 0x17, 0xc9, 0x81, 0x88,
+    0x17, 0xc9, 0xf9, 0x87, 0x17, 0xc9, 0xf1, 0x86, 0x17, 0xc9, 0xe9, 0x85,
+    0x17, 0xc9, 0xe1, 0x84, 0x17, 0xc9, 0xd9, 0x83, 0x17, 0xc9, 0xd1, 0xa6,
+    0x17, 0xc9, 0xc9, 0xa5, 0x17, 0xc9, 0xc1, 0xa4, 0x17, 0xc9, 0xb9, 0xa3,
+    0x17, 0xc9, 0xb1, 0xa2, 0x17, 0xc9, 0xa9, 0xa1, 0x17, 0xc9, 0xa1, 0xa0,
+    0x17, 0xc9, 0x99, 0x9f, 0x17, 0xc9, 0x91, 0x9e, 0x17, 0xc9, 0x88, 0x88,
+    0x17, 0xc9, 0x79, 0x87, 0x17, 0xc9, 0x71, 0x86, 0x17, 0xc9, 0x69, 0x85,
+    0x17, 0xc9, 0x61, 0x84, 0x17, 0xc9, 0x59, 0x83, 0x17, 0xc9, 0x51, 0xa6,
+    0x17, 0xc9, 0x49, 0xa5, 0x17, 0xc9, 0x41, 0xa4, 0x17, 0xc9, 0x39, 0xa3,
+    0x17, 0xc9, 0x31, 0xa2, 0x17, 0xc9, 0x29, 0xa1, 0x17, 0xc9, 0x21, 0xa0,
+    0x17, 0xc9, 0x19, 0x9f, 0x17, 0xc9, 0x11, 0x9e, 0x17, 0xc9, 0x09, 0x9d,
+    0x17, 0xc9, 0x00, 0x88, 0x17, 0xc8, 0xf9, 0x87, 0x17, 0xc8, 0xf1, 0x86,
+    0x17, 0xc8, 0xe9, 0x85, 0x17, 0xc8, 0xe1, 0x84, 0x17, 0xc8, 0xd9, 0x83,
+    0x17, 0xc8, 0xd1, 0xa6, 0x17, 0xc8, 0xc9, 0xa5, 0x17, 0xc8, 0xc1, 0xa4,
+    0x17, 0xc8, 0xb9, 0xa3, 0x17, 0xc8, 0xb1, 0xa2, 0x17, 0xc8, 0xa9, 0xa1,
+    0x17, 0xc8, 0xa1, 0xa0, 0x17, 0xc8, 0x99, 0x9f, 0x17, 0xc8, 0x91, 0x9e,
+    0x17, 0xc8, 0x89, 0x9d, 0x17, 0xc8, 0x80, 0x88, 0x17, 0xc8, 0x79, 0x87,
+    0x17, 0xc8, 0x71, 0x86, 0x17, 0xc8, 0x69, 0x85, 0x17, 0xc8, 0x61, 0x84,
+    0x17, 0xc8, 0x59, 0x83, 0x17, 0xc8, 0x51, 0xa6, 0x17, 0xc8, 0x49, 0xa5,
+    0x17, 0xc8, 0x41, 0xa4, 0x17, 0xc8, 0x39, 0xa3, 0x17, 0xc8, 0x31, 0xa2,
+    0x17, 0xc8, 0x29, 0xa1, 0x17, 0xc8, 0x21, 0xa0, 0x17, 0xc8, 0x19, 0x9f,
+    0x17, 0xc8, 0x11, 0x9e, 0x17, 0xc8, 0x09, 0x9d, 0x17, 0xc8, 0x00, 0x88,
+    0x17, 0xce, 0x79, 0x87, 0x17, 0xce, 0x71, 0x86, 0x17, 0xce, 0x69, 0x85,
+    0x17, 0xce, 0x61, 0x84, 0x17, 0xce, 0x59, 0x83, 0x17, 0xce, 0x51, 0xa6,
+    0x17, 0xce, 0x49, 0xa5, 0x17, 0xce, 0x41, 0xa4, 0x17, 0xce, 0x39, 0xa3,
+    0x17, 0xce, 0x31, 0xa2, 0x17, 0xce, 0x29, 0xa1, 0x17, 0xce, 0x21, 0xa0,
+    0x17, 0xce, 0x19, 0x9f, 0x17, 0xce, 0x11, 0x9d, 0x17, 0xce, 0x01, 0x9e,
+    0x17, 0xce, 0x08, 0x87, 0x17, 0xcd, 0xf1, 0x86, 0x17, 0xcd, 0xe9, 0x85,
+    0x17, 0xcd, 0xe1, 0x84, 0x17, 0xcd, 0xd9, 0x83, 0x17, 0xcd, 0xd1, 0xa6,
+    0x17, 0xcd, 0xc9, 0xa5, 0x17, 0xcd, 0xc1, 0xa4, 0x17, 0xcd, 0xb9, 0xa3,
+    0x17, 0xcd, 0xb1, 0xa2, 0x17, 0xcd, 0xa9, 0xa1, 0x17, 0xcd, 0xa1, 0x9d,
+    0x17, 0xcd, 0x81, 0x9e, 0x17, 0xcd, 0x89, 0x9f, 0x17, 0xcd, 0x91, 0xa0,
+    0x17, 0xcd, 0x99, 0x88, 0x17, 0xcd, 0xf8, 0x88, 0x17, 0xcc, 0xf9, 0x87,
+    0x17, 0xcc, 0xf1, 0x86, 0x17, 0xcc, 0xe9, 0x85, 0x17, 0xcc, 0xe1, 0x84,
+    0x17, 0xcc, 0xd9, 0x83, 0x17, 0xcc, 0xd1, 0xa6, 0x17, 0xcc, 0xc9, 0xa5,
+    0x17, 0xcc, 0xc1, 0xa4, 0x17, 0xcc, 0xb9, 0xa3, 0x17, 0xcc, 0xb1, 0xa2,
+    0x17, 0xcc, 0xa9, 0xa1, 0x17, 0xcc, 0xa1, 0x9d, 0x17, 0xcc, 0x81, 0x9e,
+    0x17, 0xcc, 0x89, 0x9f, 0x17, 0xcc, 0x91, 0xa0, 0x17, 0xcc, 0x98, 0x88,
+    0x17, 0xcc, 0x79, 0x87, 0x17, 0xcc, 0x71, 0x86, 0x17, 0xcc, 0x69, 0x85,
+    0x17, 0xcc, 0x61, 0x84, 0x17, 0xcc, 0x59, 0x83, 0x17, 0xcc, 0x51, 0xa6,
+    0x17, 0xcc, 0x49, 0xa5, 0x17, 0xcc, 0x41, 0xa4, 0x17, 0xcc, 0x39, 0xa3,
+    0x17, 0xcc, 0x31, 0xa2, 0x17, 0xcc, 0x29, 0xa1, 0x17, 0xcc, 0x21, 0xa0,
+    0x17, 0xcc, 0x19, 0x9f, 0x17, 0xcc, 0x11, 0x9e, 0x17, 0xcc, 0x09, 0x9d,
+    0x17, 0xcc, 0x00, 0xa5, 0x17, 0xca, 0xc1, 0xa4, 0x17, 0xca, 0xb9, 0xa3,
+    0x17, 0xca, 0xb1, 0xa2, 0x17, 0xca, 0xa9, 0xa1, 0x17, 0xca, 0xa1, 0x9e,
+    0x17, 0xca, 0x89, 0x9d, 0x17, 0xca, 0x81, 0x9f, 0x17, 0xca, 0x91, 0xa0,
+    0x17, 0xca, 0x99, 0xa6, 0x17, 0xca, 0xc9, 0x83, 0x17, 0xca, 0xd1, 0x84,
+    0x17, 0xca, 0xd9, 0x85, 0x17, 0xca, 0xe1, 0x86, 0x17, 0xca, 0xe9, 0x87,
+    0x17, 0xca, 0xf1, 0x88, 0x17, 0xca, 0xf8, 0x88, 0x17, 0xca, 0x79, 0x87,
+    0x17, 0xca, 0x71, 0x86, 0x17, 0xca, 0x69, 0x85, 0x17, 0xca, 0x61, 0x84,
+    0x17, 0xca, 0x59, 0x83, 0x17, 0xca, 0x51, 0xa6, 0x17, 0xca, 0x49, 0xa5,
+    0x17, 0xca, 0x41, 0xa4, 0x17, 0xca, 0x39, 0xa3, 0x17, 0xca, 0x31, 0xa2,
+    0x17, 0xca, 0x29, 0xa1, 0x17, 0xca, 0x21, 0xa0, 0x17, 0xca, 0x19, 0x9f,
+    0x17, 0xca, 0x11, 0x9e, 0x17, 0xca, 0x09, 0x9d, 0x17, 0xca, 0x00, 0xa2,
+    0x17, 0xc3, 0xa9, 0x9f, 0x17, 0xc3, 0x91, 0x88, 0x17, 0xc3, 0xf9, 0x87,
+    0x17, 0xc3, 0xf1, 0x86, 0x17, 0xc3, 0xe9, 0x85, 0x17, 0xc3, 0xe1, 0x84,
+    0x17, 0xc3, 0xd9, 0x83, 0x17, 0xc3, 0xd1, 0xa6, 0x17, 0xc3, 0xc9, 0xa5,
+    0x17, 0xc3, 0xc1, 0xa4, 0x17, 0xc3, 0xb9, 0xa3, 0x17, 0xc3, 0xb1, 0xa1,
+    0x17, 0xc3, 0xa1, 0xa0, 0x17, 0xc3, 0x99, 0x9e, 0x17, 0xc3, 0x89, 0x9d,
+    0x17, 0xc3, 0x80, 0x83, 0x17, 0xc3, 0x51, 0xa2, 0x17, 0xc3, 0x29, 0xa1,
+    0x17, 0xc3, 0x21, 0xa0, 0x17, 0xc3, 0x19, 0x9f, 0x17, 0xc3, 0x11, 0x9e,
+    0x17, 0xc3, 0x09, 0x88, 0x17, 0xc3, 0x79, 0x87, 0x17, 0xc3, 0x71, 0x86,
+    0x17, 0xc3, 0x69, 0x85, 0x17, 0xc3, 0x61, 0x84, 0x17, 0xc3, 0x59, 0xa6,
+    0x17, 0xc3, 0x49, 0xa5, 0x17, 0xc3, 0x41, 0xa4, 0x17, 0xc3, 0x39, 0xa3,
+    0x17, 0xc3, 0x31, 0x9d, 0x17, 0xc3, 0x00, 0xa6, 0x17, 0xc2, 0xc9, 0xa5,
+    0x17, 0xc2, 0xc1, 0xa4, 0x17, 0xc2, 0xb9, 0xa3, 0x17, 0xc2, 0xb1, 0xa2,
+    0x17, 0xc2, 0xa9, 0xa1, 0x17, 0xc2, 0xa1, 0xa0, 0x17, 0xc2, 0x99, 0x9f,
+    0x17, 0xc2, 0x91, 0x9e, 0x17, 0xc2, 0x89, 0x9d, 0x17, 0xc2, 0x81, 0x85,
+    0x17, 0xc2, 0xe1, 0x84, 0x17, 0xc2, 0xd9, 0x83, 0x17, 0xc2, 0xd1, 0x86,
+    0x17, 0xc2, 0xe9, 0x87, 0x17, 0xc2, 0xf1, 0x88, 0x17, 0xc2, 0xf8, 0x88,
+    0x17, 0xc2, 0x79, 0x87, 0x17, 0xc2, 0x71, 0xa6, 0x17, 0xc2, 0x49, 0xa5,
+    0x17, 0xc2, 0x41, 0xa4, 0x17, 0xc2, 0x39, 0xa3, 0x17, 0xc2, 0x31, 0xa2,
+    0x17, 0xc2, 0x29, 0xa1, 0x17, 0xc2, 0x21, 0xa0, 0x17, 0xc2, 0x19, 0x86,
+    0x17, 0xc2, 0x69, 0x85, 0x17, 0xc2, 0x61, 0x84, 0x17, 0xc2, 0x59, 0x83,
+    0x17, 0xc2, 0x51, 0x9f, 0x17, 0xc2, 0x11, 0x9e, 0x17, 0xc2, 0x09, 0x9d,
+    0x17, 0xc2, 0x00, 0xa5, 0x17, 0xc1, 0x41, 0xa4, 0x17, 0xc1, 0x39, 0xa3,
+    0x17, 0xc1, 0x31, 0xa2, 0x17, 0xc1, 0x29, 0xa1, 0x17, 0xc1, 0x21, 0x88,
+    0x17, 0xc1, 0x79, 0x87, 0x17, 0xc1, 0x71, 0x86, 0x17, 0xc1, 0x69, 0x85,
+    0x17, 0xc1, 0x61, 0x84, 0x17, 0xc1, 0x59, 0x83, 0x17, 0xc1, 0x51, 0xa6,
+    0x17, 0xc1, 0x49, 0xa0, 0x17, 0xc1, 0x19, 0x9f, 0x17, 0xc1, 0x11, 0x9e,
+    0x17, 0xc1, 0x09, 0x9d, 0x17, 0xc1, 0x00, 0xa5, 0x17, 0xc0, 0x41, 0xa4,
+    0x17, 0xc0, 0x39, 0x88, 0x17, 0xc0, 0x79, 0x87, 0x17, 0xc0, 0x71, 0x86,
+    0x17, 0xc0, 0x69, 0x85, 0x17, 0xc0, 0x61, 0x84, 0x17, 0xc0, 0x59, 0x83,
+    0x17, 0xc0, 0x51, 0xa6, 0x17, 0xc0, 0x49, 0xa3, 0x17, 0xc0, 0x31, 0xa2,
+    0x17, 0xc0, 0x29, 0xa1, 0x17, 0xc0, 0x21, 0x9d, 0x17, 0xc0, 0x01, 0x9e,
+    0x17, 0xc0, 0x09, 0x9f, 0x17, 0xc0, 0x11, 0xa0, 0x17, 0xc0, 0x18, 0x88,
+    0x17, 0xc7, 0xf9, 0x87, 0x17, 0xc7, 0xf1, 0x86, 0x17, 0xc7, 0xe9, 0x85,
+    0x17, 0xc7, 0xe1, 0x84, 0x17, 0xc7, 0xd9, 0x83, 0x17, 0xc7, 0xd1, 0xa6,
+    0x17, 0xc7, 0xc9, 0xa5, 0x17, 0xc7, 0xc1, 0xa4, 0x17, 0xc7, 0xb9, 0xa3,
+    0x17, 0xc7, 0xb1, 0xa2, 0x17, 0xc7, 0xa9, 0xa1, 0x17, 0xc7, 0xa1, 0xa0,
+    0x17, 0xc7, 0x99, 0x9f, 0x17, 0xc7, 0x91, 0x9e, 0x17, 0xc7, 0x89, 0x9d,
+    0x17, 0xc7, 0x80, 0x9d, 0x17, 0xc5, 0x81, 0x88, 0x17, 0xc5, 0xf9, 0x87,
+    0x17, 0xc5, 0xf1, 0x86, 0x17, 0xc5, 0xe9, 0x85, 0x17, 0xc5, 0xe1, 0x84,
+    0x17, 0xc5, 0xd9, 0x83, 0x17, 0xc5, 0xd1, 0xa6, 0x17, 0xc5, 0xc9, 0xa5,
+    0x17, 0xc5, 0xc1, 0xa4, 0x17, 0xc5, 0xb9, 0xa3, 0x17, 0xc5, 0xb1, 0xa2,
+    0x17, 0xc5, 0xa9, 0xa1, 0x17, 0xc5, 0xa1, 0xa0, 0x17, 0xc5, 0x99, 0x9f,
+    0x17, 0xc5, 0x91, 0x9e, 0x17, 0xc5, 0x88, 0x88, 0x17, 0xc5, 0x79, 0x87,
+    0x17, 0xc5, 0x71, 0x86, 0x17, 0xc5, 0x69, 0x85, 0x17, 0xc5, 0x61, 0x84,
+    0x17, 0xc5, 0x59, 0x83, 0x17, 0xc5, 0x51, 0xa6, 0x17, 0xc5, 0x49, 0xa5,
+    0x17, 0xc5, 0x41, 0xa4, 0x17, 0xc5, 0x39, 0xa3, 0x17, 0xc5, 0x31, 0xa2,
+    0x17, 0xc5, 0x29, 0xa1, 0x17, 0xc5, 0x21, 0xa0, 0x17, 0xc5, 0x19, 0x9f,
+    0x17, 0xc5, 0x11, 0x9e, 0x17, 0xc5, 0x09, 0x9d, 0x17, 0xc5, 0x00, 0x88,
+    0x17, 0xc4, 0xf9, 0x87, 0x17, 0xc4, 0xf1, 0x86, 0x17, 0xc4, 0xe9, 0x85,
+    0x17, 0xc4, 0xe1, 0x84, 0x17, 0xc4, 0xd9, 0x83, 0x17, 0xc4, 0xd1, 0xa6,
+    0x17, 0xc4, 0xc9, 0xa5, 0x17, 0xc4, 0xc1, 0xa4, 0x17, 0xc4, 0xb9, 0xa3,
+    0x17, 0xc4, 0xb1, 0xa2, 0x17, 0xc4, 0xa9, 0xa1, 0x17, 0xc4, 0xa1, 0xa0,
+    0x17, 0xc4, 0x99, 0x9f, 0x17, 0xc4, 0x91, 0x9e, 0x17, 0xc4, 0x89, 0x9d,
+    0x17, 0xc4, 0x80, 0x88, 0x17, 0xc4, 0x79, 0x87, 0x17, 0xc4, 0x71, 0x86,
+    0x17, 0xc4, 0x69, 0x85, 0x17, 0xc4, 0x61, 0x84, 0x17, 0xc4, 0x59, 0x83,
+    0x17, 0xc4, 0x51, 0xa6, 0x17, 0xc4, 0x49, 0xa5, 0x17, 0xc4, 0x41, 0xa4,
+    0x17, 0xc4, 0x39, 0xa3, 0x17, 0xc4, 0x31, 0xa2, 0x17, 0xc4, 0x29, 0xa1,
+    0x17, 0xc4, 0x21, 0xa0, 0x17, 0xc4, 0x19, 0x9f, 0x17, 0xc4, 0x11, 0x9e,
+    0x17, 0xc4, 0x09, 0x9d, 0x17, 0xc4, 0x00, 0x88, 0x17, 0xc7, 0x79, 0x87,
+    0x17, 0xc7, 0x71, 0x86, 0x17, 0xc7, 0x69, 0x85, 0x17, 0xc7, 0x61, 0x84,
+    0x17, 0xc7, 0x59, 0x83, 0x17, 0xc7, 0x51, 0xa6, 0x17, 0xc7, 0x49, 0xa5,
+    0x17, 0xc7, 0x41, 0xa4, 0x17, 0xc7, 0x39, 0xa3, 0x17, 0xc7, 0x31, 0xa2,
+    0x17, 0xc7, 0x29, 0xa1, 0x17, 0xc7, 0x21, 0x9d, 0x17, 0xc7, 0x01, 0x9e,
+    0x17, 0xc7, 0x09, 0x9f, 0x17, 0xc7, 0x11, 0xa0, 0x17, 0xc7, 0x18, 0xa6,
+    0x17, 0xc6, 0xc9, 0xa5, 0x17, 0xc6, 0xc1, 0xa4, 0x17, 0xc6, 0xb9, 0xa3,
+    0x17, 0xc6, 0xb1, 0xa2, 0x17, 0xc6, 0xa9, 0xa1, 0x17, 0xc6, 0xa1, 0xa0,
+    0x17, 0xc6, 0x99, 0x9f, 0x17, 0xc6, 0x91, 0x9e, 0x17, 0xc6, 0x89, 0x9d,
+    0x17, 0xc6, 0x81, 0x83, 0x17, 0xc6, 0xd1, 0x84, 0x17, 0xc6, 0xd9, 0x85,
+    0x17, 0xc6, 0xe1, 0x86, 0x17, 0xc6, 0xe9, 0x87, 0x17, 0xc6, 0xf1, 0x88,
+    0x17, 0xc6, 0xf8, 0x88, 0x17, 0xc6, 0x79, 0x87, 0x17, 0xc6, 0x71, 0x86,
+    0x17, 0xc6, 0x69, 0x85, 0x17, 0xc6, 0x61, 0x84, 0x17, 0xc6, 0x59, 0x83,
+    0x17, 0xc6, 0x51, 0xa6, 0x17, 0xc6, 0x49, 0xa5, 0x17, 0xc6, 0x41, 0xa4,
+    0x17, 0xc6, 0x39, 0xa3, 0x17, 0xc6, 0x31, 0xa2, 0x17, 0xc6, 0x29, 0xa1,
+    0x17, 0xc6, 0x21, 0xa0, 0x17, 0xc6, 0x19, 0x9f, 0x17, 0xc6, 0x11, 0x9e,
+    0x17, 0xc6, 0x09, 0x9d, 0x17, 0xc6, 0x00, 0x88, 0x17, 0xc1, 0xf9, 0x87,
+    0x17, 0xc1, 0xf1, 0x86, 0x17, 0xc1, 0xe9, 0x85, 0x17, 0xc1, 0xe1, 0x84,
+    0x17, 0xc1, 0xd9, 0x83, 0x17, 0xc1, 0xd1, 0xa6, 0x17, 0xc1, 0xc9, 0xa5,
+    0x17, 0xc1, 0xc1, 0xa4, 0x17, 0xc1, 0xb9, 0xa3, 0x17, 0xc1, 0xb1, 0xa2,
+    0x17, 0xc1, 0xa9, 0xa1, 0x17, 0xc1, 0xa1, 0xa0, 0x17, 0xc1, 0x99, 0x9f,
+    0x17, 0xc1, 0x91, 0x9e, 0x17, 0xc1, 0x89, 0x9d, 0x17, 0xc1, 0x80, 0x88,
+    0x17, 0xc0, 0xf9, 0x87, 0x17, 0xc0, 0xf1, 0x86, 0x17, 0xc0, 0xe9, 0x85,
+    0x17, 0xc0, 0xe1, 0x84, 0x17, 0xc0, 0xd9, 0x83, 0x17, 0xc0, 0xd1, 0xa6,
+    0x17, 0xc0, 0xc9, 0xa5, 0x17, 0xc0, 0xc1, 0xa4, 0x17, 0xc0, 0xb9, 0xa3,
+    0x17, 0xc0, 0xb1, 0xa2, 0x17, 0xc0, 0xa9, 0xa1, 0x17, 0xc0, 0xa1, 0xa0,
+    0x17, 0xc0, 0x99, 0x9f, 0x17, 0xc0, 0x91, 0x9e, 0x17, 0xc0, 0x89, 0x9d,
+    0x17, 0xc0, 0x80, 0x86, 0x17, 0xd0, 0xe9, 0x85, 0x17, 0xd0, 0xe1, 0x84,
+    0x17, 0xd0, 0xd9, 0x83, 0x17, 0xd0, 0xd1, 0xa6, 0x17, 0xd0, 0xc9, 0xa5,
+    0x17, 0xd0, 0xc1, 0xa4, 0x17, 0xd0, 0xb9, 0xa3, 0x17, 0xd0, 0xb1, 0xa2,
+    0x17, 0xd0, 0xa9, 0xa1, 0x17, 0xd0, 0xa1, 0xa0, 0x17, 0xd0, 0x99, 0x9f,
+    0x17, 0xd0, 0x91, 0x9e, 0x17, 0xd0, 0x89, 0x9d, 0x17, 0xd0, 0x80, 0x88,
+    0x17, 0xd0, 0x79, 0x87, 0x17, 0xd0, 0x71, 0x86, 0x17, 0xd0, 0x69, 0x85,
+    0x17, 0xd0, 0x61, 0x84, 0x17, 0xd0, 0x59, 0x83, 0x17, 0xd0, 0x51, 0xa6,
+    0x17, 0xd0, 0x49, 0xa5, 0x17, 0xd0, 0x41, 0xa4, 0x17, 0xd0, 0x39, 0xa3,
+    0x17, 0xd0, 0x31, 0xa2, 0x17, 0xd0, 0x29, 0xa1, 0x17, 0xd0, 0x21, 0xa0,
+    0x17, 0xd0, 0x19, 0x9f, 0x17, 0xd0, 0x11, 0x9e, 0x17, 0xd0, 0x09, 0x9d,
+    0x17, 0xd0, 0x00, 0xa6, 0x07, 0xd6, 0xc9, 0xa5, 0x07, 0xd6, 0xc1, 0xa4,
+    0x07, 0xd6, 0xb9, 0xa3, 0x07, 0xd6, 0xb1, 0xa2, 0x07, 0xd6, 0xa9, 0xa1,
+    0x07, 0xd6, 0xa1, 0xa0, 0x07, 0xd6, 0x99, 0x9f, 0x07, 0xd6, 0x91, 0x9e,
+    0x07, 0xd6, 0x89, 0x9d, 0x07, 0xd6, 0x80, 0x88, 0x07, 0xd6, 0x79, 0x87,
+    0x07, 0xd6, 0x71, 0x86, 0x07, 0xd6, 0x69, 0x85, 0x07, 0xd6, 0x61, 0x84,
+    0x07, 0xd6, 0x59, 0x83, 0x07, 0xd6, 0x51, 0xa6, 0x07, 0xd6, 0x49, 0xa5,
+    0x07, 0xd6, 0x41, 0xa4, 0x07, 0xd6, 0x39, 0xa3, 0x07, 0xd6, 0x31, 0xa2,
+    0x07, 0xd6, 0x29, 0xa1, 0x07, 0xd6, 0x21, 0xa0, 0x07, 0xd6, 0x19, 0x9f,
+    0x07, 0xd6, 0x11, 0x9e, 0x07, 0xd6, 0x09, 0x9d, 0x07, 0xd6, 0x00, 0x88,
+    0x07, 0xd5, 0xf9, 0x87, 0x07, 0xd5, 0xf1, 0x86, 0x07, 0xd5, 0xe9, 0x85,
+    0x07, 0xd5, 0xe1, 0x84, 0x07, 0xd5, 0xd9, 0x83, 0x07, 0xd5, 0xd1, 0xa6,
+    0x07, 0xd5, 0xc9, 0xa5, 0x07, 0xd5, 0xc1, 0xa4, 0x07, 0xd5, 0xb9, 0xa3,
+    0x07, 0xd5, 0xb1, 0xa2, 0x07, 0xd5, 0xa9, 0xa1, 0x07, 0xd5, 0xa1, 0xa0,
+    0x07, 0xd5, 0x99, 0x9f, 0x07, 0xd5, 0x91, 0x9e, 0x07, 0xd5, 0x89, 0x9d,
+    0x07, 0xd5, 0x80, 0x88, 0x07, 0xd5, 0x79, 0x87, 0x07, 0xd5, 0x71, 0x86,
+    0x07, 0xd5, 0x69, 0x85, 0x07, 0xd5, 0x61, 0x84, 0x07, 0xd5, 0x59, 0x83,
+    0x07, 0xd5, 0x51, 0xa6, 0x07, 0xd5, 0x49, 0xa5, 0x07, 0xd5, 0x41, 0xa4,
+    0x07, 0xd5, 0x39, 0xa3, 0x07, 0xd5, 0x31, 0xa2, 0x07, 0xd5, 0x29, 0xa1,
+    0x07, 0xd5, 0x21, 0xa0, 0x07, 0xd5, 0x19, 0x9f, 0x07, 0xd5, 0x11, 0x9e,
+    0x07, 0xd5, 0x09, 0x9d, 0x07, 0xd5, 0x00, 0x88, 0x07, 0xd4, 0xf9, 0x87,
+    0x07, 0xd4, 0xf1, 0x86, 0x07, 0xd4, 0xe9, 0x85, 0x07, 0xd4, 0xe1, 0x84,
+    0x07, 0xd4, 0xd9, 0x83, 0x07, 0xd4, 0xd1, 0xa6, 0x07, 0xd4, 0xc9, 0xa5,
+    0x07, 0xd4, 0xc1, 0xa4, 0x07, 0xd4, 0xb9, 0xa3, 0x07, 0xd4, 0xb1, 0xa2,
+    0x07, 0xd4, 0xa9, 0xa1, 0x07, 0xd4, 0xa1, 0xa0, 0x07, 0xd4, 0x99, 0x9f,
+    0x07, 0xd4, 0x91, 0x9e, 0x07, 0xd4, 0x89, 0x9d, 0x07, 0xd4, 0x80, 0x88,
+    0x07, 0xd4, 0x79, 0x87, 0x07, 0xd4, 0x71, 0x86, 0x07, 0xd4, 0x69, 0x85,
+    0x07, 0xd4, 0x61, 0x84, 0x07, 0xd4, 0x59, 0x83, 0x07, 0xd4, 0x51, 0xa6,
+    0x07, 0xd4, 0x49, 0xa5, 0x07, 0xd4, 0x41, 0xa4, 0x07, 0xd4, 0x39, 0xa3,
+    0x07, 0xd4, 0x31, 0xa2, 0x07, 0xd4, 0x29, 0xa1, 0x07, 0xd4, 0x21, 0xa0,
+    0x07, 0xd4, 0x19, 0x9f, 0x07, 0xd4, 0x11, 0x9e, 0x07, 0xd4, 0x09, 0x9d,
+    0x07, 0xd4, 0x00, 0x86, 0x07, 0xd3, 0xe9, 0x85, 0x07, 0xd3, 0xe1, 0x84,
+    0x07, 0xd3, 0xd9, 0x83, 0x07, 0xd3, 0xd1, 0xa6, 0x07, 0xd3, 0xc9, 0xa5,
+    0x07, 0xd3, 0xc1, 0xa4, 0x07, 0xd3, 0xb9, 0xa3, 0x07, 0xd3, 0xb1, 0xa2,
+    0x07, 0xd3, 0xa9, 0xa1, 0x07, 0xd3, 0xa1, 0xa0, 0x07, 0xd3, 0x99, 0x9f,
+    0x07, 0xd3, 0x91, 0x9e, 0x07, 0xd3, 0x89, 0x9d, 0x07, 0xd3, 0x81, 0x87,
+    0x07, 0xd3, 0xf1, 0x88, 0x07, 0xd3, 0xf8, 0x86, 0x07, 0xd3, 0x69, 0x85,
+    0x07, 0xd3, 0x61, 0x84, 0x07, 0xd3, 0x59, 0x83, 0x07, 0xd3, 0x51, 0xa6,
+    0x07, 0xd3, 0x49, 0xa5, 0x07, 0xd3, 0x41, 0xa4, 0x07, 0xd3, 0x39, 0xa3,
+    0x07, 0xd3, 0x31, 0xa2, 0x07, 0xd3, 0x29, 0xa1, 0x07, 0xd3, 0x21, 0xa0,
+    0x07, 0xd3, 0x19, 0x9f, 0x07, 0xd3, 0x11, 0x9e, 0x07, 0xd3, 0x09, 0x9d,
+    0x07, 0xd3, 0x00, 0x88, 0x07, 0xd2, 0xf9, 0x87, 0x07, 0xd2, 0xf1, 0x86,
+    0x07, 0xd2, 0xe9, 0x85, 0x07, 0xd2, 0xe1, 0x84, 0x07, 0xd2, 0xd9, 0x83,
+    0x07, 0xd2, 0xd1, 0xa6, 0x07, 0xd2, 0xc9, 0xa5, 0x07, 0xd2, 0xc1, 0xa4,
+    0x07, 0xd2, 0xb9, 0xa3, 0x07, 0xd2, 0xb1, 0xa2, 0x07, 0xd2, 0xa9, 0xa1,
+    0x07, 0xd2, 0xa1, 0xa0, 0x07, 0xd2, 0x99, 0x9f, 0x07, 0xd2, 0x91, 0x9e,
+    0x07, 0xd2, 0x89, 0x9d, 0x07, 0xd2, 0x80, 0x88, 0x07, 0xd2, 0x79, 0x87,
+    0x07, 0xd2, 0x71, 0x86, 0x07, 0xd2, 0x69, 0x85, 0x07, 0xd2, 0x61, 0x84,
+    0x07, 0xd2, 0x59, 0x83, 0x07, 0xd2, 0x51, 0xa6, 0x07, 0xd2, 0x49, 0xa5,
+    0x07, 0xd2, 0x41, 0xa4, 0x07, 0xd2, 0x39, 0xa3, 0x07, 0xd2, 0x31, 0xa2,
+    0x07, 0xd2, 0x29, 0xa1, 0x07, 0xd2, 0x21, 0xa0, 0x07, 0xd2, 0x19, 0x9f,
+    0x07, 0xd2, 0x11, 0x9d, 0x07, 0xd2, 0x01, 0x9e, 0x07, 0xd2, 0x08, 0x88,
+    0x07, 0xd1, 0xf9, 0x87, 0x07, 0xd1, 0xf1, 0x86, 0x07, 0xd1, 0xe9, 0x85,
+    0x07, 0xd1, 0xe1, 0x84, 0x07, 0xd1, 0xd9, 0x83, 0x07, 0xd1, 0xd1, 0xa6,
+    0x07, 0xd1, 0xc9, 0xa5, 0x07, 0xd1, 0xc1, 0xa4, 0x07, 0xd1, 0xb9, 0xa3,
+    0x07, 0xd1, 0xb1, 0xa2, 0x07, 0xd1, 0xa9, 0xa1, 0x07, 0xd1, 0xa1, 0xa0,
+    0x07, 0xd1, 0x99, 0x9f, 0x07, 0xd1, 0x91, 0x9e, 0x07, 0xd1, 0x89, 0x9d,
+    0x07, 0xd1, 0x80, 0x88, 0x07, 0xd1, 0x79, 0x87, 0x07, 0xd1, 0x71, 0x86,
+    0x07, 0xd1, 0x69, 0x85, 0x07, 0xd1, 0x61, 0x84, 0x07, 0xd1, 0x59, 0x83,
+    0x07, 0xd1, 0x51, 0xa6, 0x07, 0xd1, 0x49, 0xa5, 0x07, 0xd1, 0x41, 0xa4,
+    0x07, 0xd1, 0x39, 0xa3, 0x07, 0xd1, 0x31, 0xa2, 0x07, 0xd1, 0x29, 0xa1,
+    0x07, 0xd1, 0x21, 0xa0, 0x07, 0xd1, 0x19, 0x9f, 0x07, 0xd1, 0x11, 0x9e,
+    0x07, 0xd1, 0x09, 0x9d, 0x07, 0xd1, 0x00, 0x88, 0x07, 0xd0, 0xf9, 0x87,
+    0x07, 0xd0, 0xf1, 0x86, 0x07, 0xd0, 0xe9, 0x85, 0x07, 0xd0, 0xe1, 0x84,
+    0x07, 0xd0, 0xd9, 0x83, 0x07, 0xd0, 0xd1, 0xa6, 0x07, 0xd0, 0xc9, 0xa5,
+    0x07, 0xd0, 0xc1, 0xa4, 0x07, 0xd0, 0xb9, 0xa3, 0x07, 0xd0, 0xb1, 0xa2,
+    0x07, 0xd0, 0xa9, 0xa1, 0x07, 0xd0, 0xa1, 0xa0, 0x07, 0xd0, 0x99, 0x9f,
+    0x07, 0xd0, 0x91, 0x9e, 0x07, 0xd0, 0x89, 0x9d, 0x07, 0xd0, 0x80, 0x88,
+    0x07, 0xd0, 0x79, 0x87, 0x07, 0xd0, 0x71, 0x86, 0x07, 0xd0, 0x69, 0x85,
+    0x07, 0xd0, 0x61, 0x84, 0x07, 0xd0, 0x59, 0x83, 0x07, 0xd0, 0x51, 0xa6,
+    0x07, 0xd0, 0x49, 0xa5, 0x07, 0xd0, 0x41, 0xa4, 0x07, 0xd0, 0x39, 0xa3,
+    0x07, 0xd0, 0x31, 0xa2, 0x07, 0xd0, 0x29, 0xa1, 0x07, 0xd0, 0x21, 0xa0,
+    0x07, 0xd0, 0x19, 0x9f, 0x07, 0xd0, 0x11, 0x9e, 0x07, 0xd0, 0x09, 0x9d,
+    0x07, 0xd0, 0x00, 0x88, 0x07, 0xcf, 0xf9, 0x87, 0x07, 0xcf, 0xf1, 0x86,
+    0x07, 0xcf, 0xe9, 0x85, 0x07, 0xcf, 0xe1, 0x84, 0x07, 0xcf, 0xd9, 0x83,
+    0x07, 0xcf, 0xd1, 0xa6, 0x07, 0xcf, 0xc9, 0xa5, 0x07, 0xcf, 0xc1, 0xa4,
+    0x07, 0xcf, 0xb9, 0xa3, 0x07, 0xcf, 0xb1, 0xa2, 0x07, 0xcf, 0xa9, 0xa1,
+    0x07, 0xcf, 0xa1, 0xa0, 0x07, 0xcf, 0x99, 0x9f, 0x07, 0xcf, 0x91, 0x9e,
+    0x07, 0xcf, 0x89, 0x9d, 0x07, 0xcf, 0x80, 0x88, 0x07, 0xcf, 0x79, 0x87,
+    0x07, 0xcf, 0x71, 0x86, 0x07, 0xcf, 0x69, 0x85, 0x07, 0xcf, 0x61, 0x84,
+    0x07, 0xcf, 0x59, 0x83, 0x07, 0xcf, 0x51, 0xa6, 0x07, 0xcf, 0x49, 0xa5,
+    0x07, 0xcf, 0x41, 0xa4, 0x07, 0xcf, 0x39, 0xa3, 0x07, 0xcf, 0x31, 0xa2,
+    0x07, 0xcf, 0x29, 0xa1, 0x07, 0xcf, 0x21, 0xa0, 0x07, 0xcf, 0x19, 0x9f,
+    0x07, 0xcf, 0x11, 0x9e, 0x07, 0xcf, 0x09, 0x9d, 0x07, 0xcf, 0x00, 0x88,
+    0x07, 0xce, 0xf9, 0x87, 0x07, 0xce, 0xf1, 0x86, 0x07, 0xce, 0xe9, 0x85,
+    0x07, 0xce, 0xe1, 0x84, 0x07, 0xce, 0xd9, 0x83, 0x07, 0xce, 0xd1, 0xa6,
+    0x07, 0xce, 0xc9, 0xa5, 0x07, 0xce, 0xc1, 0xa4, 0x07, 0xce, 0xb9, 0xa3,
+    0x07, 0xce, 0xb1, 0xa2, 0x07, 0xce, 0xa9, 0xa1, 0x07, 0xce, 0xa1, 0xa0,
+    0x07, 0xce, 0x99, 0x9f, 0x07, 0xce, 0x91, 0x9e, 0x07, 0xce, 0x89, 0x9d,
+    0x07, 0xce, 0x80, 0x88, 0x07, 0xce, 0x79, 0x87, 0x07, 0xce, 0x71, 0x86,
+    0x07, 0xce, 0x69, 0x85, 0x07, 0xce, 0x61, 0x84, 0x07, 0xce, 0x59, 0x83,
+    0x07, 0xce, 0x51, 0xa6, 0x07, 0xce, 0x49, 0xa5, 0x07, 0xce, 0x41, 0xa4,
+    0x07, 0xce, 0x39, 0xa3, 0x07, 0xce, 0x31, 0xa2, 0x07, 0xce, 0x29, 0xa1,
+    0x07, 0xce, 0x21, 0xa0, 0x07, 0xce, 0x19, 0x9f, 0x07, 0xce, 0x11, 0x9e,
+    0x07, 0xce, 0x09, 0x9d, 0x07, 0xce, 0x00, 0x88, 0x07, 0xcd, 0xf9, 0x87,
+    0x07, 0xcd, 0xf1, 0x86, 0x07, 0xcd, 0xe9, 0x85, 0x07, 0xcd, 0xe1, 0x84,
+    0x07, 0xcd, 0xd9, 0x83, 0x07, 0xcd, 0xd1, 0xa6, 0x07, 0xcd, 0xc9, 0xa5,
+    0x07, 0xcd, 0xc1, 0xa4, 0x07, 0xcd, 0xb9, 0xa3, 0x07, 0xcd, 0xb1, 0xa2,
+    0x07, 0xcd, 0xa9, 0xa1, 0x07, 0xcd, 0xa1, 0xa0, 0x07, 0xcd, 0x99, 0x9f,
+    0x07, 0xcd, 0x91, 0x9e, 0x07, 0xcd, 0x89, 0x9d, 0x07, 0xcd, 0x80, 0x88,
+    0x07, 0xcd, 0x79, 0x87, 0x07, 0xcd, 0x71, 0x86, 0x07, 0xcd, 0x69, 0x85,
+    0x07, 0xcd, 0x61, 0x84, 0x07, 0xcd, 0x59, 0x83, 0x07, 0xcd, 0x51, 0xa6,
+    0x07, 0xcd, 0x49, 0xa5, 0x07, 0xcd, 0x41, 0xa4, 0x07, 0xcd, 0x39, 0xa3,
+    0x07, 0xcd, 0x31, 0xa2, 0x07, 0xcd, 0x29, 0xa1, 0x07, 0xcd, 0x21, 0xa0,
+    0x07, 0xcd, 0x19, 0x9f, 0x07, 0xcd, 0x11, 0x9e, 0x07, 0xcd, 0x09, 0x9d,
+    0x07, 0xcd, 0x00, 0x88, 0x07, 0xcc, 0xf9, 0x87, 0x07, 0xcc, 0xf1, 0x86,
+    0x07, 0xcc, 0xe9, 0x85, 0x07, 0xcc, 0xe1, 0x84, 0x07, 0xcc, 0xd9, 0x83,
+    0x07, 0xcc, 0xd1, 0xa6, 0x07, 0xcc, 0xc9, 0xa5, 0x07, 0xcc, 0xc1, 0xa4,
+    0x07, 0xcc, 0xb9, 0xa3, 0x07, 0xcc, 0xb1, 0xa2, 0x07, 0xcc, 0xa9, 0xa1,
+    0x07, 0xcc, 0xa1, 0xa0, 0x07, 0xcc, 0x99, 0x9f, 0x07, 0xcc, 0x91, 0x9e,
+    0x07, 0xcc, 0x89, 0x9d, 0x07, 0xcc, 0x80, 0x88, 0x07, 0xcc, 0x79, 0x87,
+    0x07, 0xcc, 0x71, 0x86, 0x07, 0xcc, 0x69, 0x85, 0x07, 0xcc, 0x61, 0x84,
+    0x07, 0xcc, 0x59, 0x83, 0x07, 0xcc, 0x51, 0xa6, 0x07, 0xcc, 0x49, 0xa5,
+    0x07, 0xcc, 0x41, 0xa4, 0x07, 0xcc, 0x39, 0xa3, 0x07, 0xcc, 0x31, 0xa2,
+    0x07, 0xcc, 0x29, 0xa1, 0x07, 0xcc, 0x21, 0xa0, 0x07, 0xcc, 0x19, 0x9f,
+    0x07, 0xcc, 0x11, 0x9e, 0x07, 0xcc, 0x09, 0x9d, 0x07, 0xcc, 0x00, 0x88,
+    0x07, 0xcb, 0xf9, 0x87, 0x07, 0xcb, 0xf1, 0x86, 0x07, 0xcb, 0xe9, 0x85,
+    0x07, 0xcb, 0xe1, 0x84, 0x07, 0xcb, 0xd9, 0x83, 0x07, 0xcb, 0xd1, 0xa6,
+    0x07, 0xcb, 0xc9, 0xa5, 0x07, 0xcb, 0xc1, 0xa4, 0x07, 0xcb, 0xb9, 0xa3,
+    0x07, 0xcb, 0xb1, 0xa2, 0x07, 0xcb, 0xa9, 0xa1, 0x07, 0xcb, 0xa1, 0xa0,
+    0x07, 0xcb, 0x99, 0x9f, 0x07, 0xcb, 0x91, 0x9e, 0x07, 0xcb, 0x89, 0x9d,
+    0x07, 0xcb, 0x80, 0x88, 0x07, 0xcb, 0x79, 0x87, 0x07, 0xcb, 0x71, 0x86,
+    0x07, 0xcb, 0x69, 0x85, 0x07, 0xcb, 0x61, 0x84, 0x07, 0xcb, 0x59, 0x83,
+    0x07, 0xcb, 0x51, 0xa6, 0x07, 0xcb, 0x49, 0xa5, 0x07, 0xcb, 0x41, 0xa4,
+    0x07, 0xcb, 0x39, 0xa3, 0x07, 0xcb, 0x31, 0xa2, 0x07, 0xcb, 0x29, 0xa1,
+    0x07, 0xcb, 0x21, 0xa0, 0x07, 0xcb, 0x19, 0x9f, 0x07, 0xcb, 0x11, 0x9e,
+    0x07, 0xcb, 0x09, 0x9d, 0x07, 0xcb, 0x00, 0x88, 0x07, 0xca, 0xf9, 0x87,
+    0x07, 0xca, 0xf1, 0x86, 0x07, 0xca, 0xe9, 0x85, 0x07, 0xca, 0xe1, 0x84,
+    0x07, 0xca, 0xd9, 0x83, 0x07, 0xca, 0xd1, 0xa6, 0x07, 0xca, 0xc9, 0xa5,
+    0x07, 0xca, 0xc1, 0xa4, 0x07, 0xca, 0xb9, 0xa3, 0x07, 0xca, 0xb1, 0xa2,
+    0x07, 0xca, 0xa9, 0xa1, 0x07, 0xca, 0xa1, 0xa0, 0x07, 0xca, 0x99, 0x9f,
+    0x07, 0xca, 0x91, 0x9e, 0x07, 0xca, 0x89, 0x9d, 0x07, 0xca, 0x80, 0x88,
+    0x07, 0xca, 0x79, 0x87, 0x07, 0xca, 0x71, 0x86, 0x07, 0xca, 0x69, 0x85,
+    0x07, 0xca, 0x61, 0x84, 0x07, 0xca, 0x59, 0x83, 0x07, 0xca, 0x51, 0xa6,
+    0x07, 0xca, 0x49, 0xa5, 0x07, 0xca, 0x41, 0xa4, 0x07, 0xca, 0x39, 0xa3,
+    0x07, 0xca, 0x31, 0xa2, 0x07, 0xca, 0x29, 0xa1, 0x07, 0xca, 0x21, 0xa0,
+    0x07, 0xca, 0x19, 0x9f, 0x07, 0xca, 0x11, 0x9e, 0x07, 0xca, 0x09, 0x9d,
+    0x07, 0xca, 0x00, 0x88, 0x07, 0xc9, 0xf9, 0x87, 0x07, 0xc9, 0xf1, 0x86,
+    0x07, 0xc9, 0xe9, 0x85, 0x07, 0xc9, 0xe1, 0x84, 0x07, 0xc9, 0xd9, 0x83,
+    0x07, 0xc9, 0xd1, 0xa6, 0x07, 0xc9, 0xc9, 0xa5, 0x07, 0xc9, 0xc1, 0xa4,
+    0x07, 0xc9, 0xb9, 0xa3, 0x07, 0xc9, 0xb1, 0xa2, 0x07, 0xc9, 0xa9, 0xa1,
+    0x07, 0xc9, 0xa1, 0xa0, 0x07, 0xc9, 0x99, 0x9d, 0x07, 0xc9, 0x81, 0x9e,
+    0x07, 0xc9, 0x89, 0x9f, 0x07, 0xc9, 0x90, 0xa4, 0x07, 0xc9, 0x39, 0xa3,
+    0x07, 0xc9, 0x31, 0xa2, 0x07, 0xc9, 0x29, 0xa1, 0x07, 0xc9, 0x21, 0xa0,
+    0x07, 0xc9, 0x19, 0x9f, 0x07, 0xc9, 0x11, 0x9d, 0x07, 0xc9, 0x01, 0x9e,
+    0x07, 0xc9, 0x09, 0xa5, 0x07, 0xc9, 0x41, 0xa6, 0x07, 0xc9, 0x49, 0x83,
+    0x07, 0xc9, 0x51, 0x84, 0x07, 0xc9, 0x59, 0x85, 0x07, 0xc9, 0x61, 0x86,
+    0x07, 0xc9, 0x69, 0x87, 0x07, 0xc9, 0x71, 0x88, 0x07, 0xc9, 0x78, 0x86,
+    0x07, 0xc8, 0xe9, 0x85, 0x07, 0xc8, 0xe1, 0x84, 0x07, 0xc8, 0xd9, 0x83,
+    0x07, 0xc8, 0xd1, 0xa6, 0x07, 0xc8, 0xc9, 0xa5, 0x07, 0xc8, 0xc1, 0xa4,
+    0x07, 0xc8, 0xb9, 0xa3, 0x07, 0xc8, 0xb1, 0xa2, 0x07, 0xc8, 0xa9, 0xa1,
+    0x07, 0xc8, 0xa1, 0xa0, 0x07, 0xc8, 0x99, 0x9f, 0x07, 0xc8, 0x91, 0x9e,
+    0x07, 0xc8, 0x89, 0x9d, 0x07, 0xc8, 0x81, 0x87, 0x07, 0xc8, 0xf1, 0x88,
+    0x07, 0xc8, 0xf8, 0x88, 0x07, 0xc8, 0x79, 0x87, 0x07, 0xc8, 0x71, 0x86,
+    0x07, 0xc8, 0x69, 0x85, 0x07, 0xc8, 0x61, 0x84, 0x07, 0xc8, 0x59, 0x83,
+    0x07, 0xc8, 0x51, 0xa6, 0x07, 0xc8, 0x49, 0xa5, 0x07, 0xc8, 0x41, 0xa4,
+    0x07, 0xc8, 0x39, 0xa3, 0x07, 0xc8, 0x31, 0xa2, 0x07, 0xc8, 0x29, 0xa1,
+    0x07, 0xc8, 0x21, 0xa0, 0x07, 0xc8, 0x19, 0x9d, 0x07, 0xc8, 0x01, 0x9e,
+    0x07, 0xc8, 0x09, 0x9f, 0x07, 0xc8, 0x10, 0xc3, 0xa6, 0x59, 0x01, 0x75,
+    0x81, 0xc2, 0x02, 0xe0, 0x01, 0x76, 0x29, 0xc5, 0x6f, 0xb7, 0x01, 0x76,
+    0x41, 0xc4, 0x08, 0x92, 0x01, 0x76, 0x49, 0xc3, 0x07, 0xe5, 0x01, 0x77,
+    0x38, 0xc3, 0x1a, 0x7c, 0x01, 0x76, 0x81, 0xc3, 0x00, 0xfe, 0x01, 0x76,
+    0xa0, 0xc3, 0x08, 0x48, 0x01, 0x76, 0x99, 0xc3, 0x47, 0x24, 0x01, 0x76,
+    0xd0, 0xcd, 0x7f, 0x4c, 0x01, 0x76, 0xc9, 0xc4, 0xe4, 0x33, 0x01, 0x77,
+    0x71, 0xc5, 0xd5, 0x65, 0x01, 0x77, 0x98, 0xc2, 0x00, 0x35, 0x01, 0x76,
+    0xe1, 0xc3, 0x04, 0x5a, 0x01, 0x77, 0x29, 0xc3, 0x23, 0x6d, 0x01, 0x77,
+    0x50, 0xc2, 0x00, 0xfe, 0x01, 0x77, 0x01, 0xc3, 0x18, 0x11, 0x01, 0x77,
+    0x60, 0xc3, 0x05, 0x14, 0x01, 0x74, 0x11, 0x16, 0x42, 0x1a, 0x7a, 0xc3,
+    0x05, 0x14, 0x01, 0x74, 0xa1, 0xc3, 0x02, 0x9f, 0x01, 0x74, 0xa8, 0x0a,
+    0xc2, 0x1a, 0x86, 0x19, 0xc2, 0x1a, 0x92, 0xc6, 0xc6, 0x9b, 0x01, 0x77,
+    0x48, 0xc2, 0x02, 0xa0, 0x01, 0x74, 0x79, 0xc4, 0x02, 0xde, 0x01, 0x74,
+    0x80, 0xc3, 0x05, 0x14, 0x01, 0x74, 0xb1, 0xc3, 0x02, 0x9f, 0x01, 0x74,
+    0xb8, 0xc3, 0x05, 0x14, 0x01, 0x76, 0xa9, 0xc3, 0x02, 0x9f, 0x01, 0x76,
+    0xb0, 0xc3, 0x05, 0x14, 0x01, 0x75, 0x09, 0xc3, 0x02, 0x9f, 0x01, 0x75,
+    0x10, 0xc3, 0x05, 0x14, 0x01, 0x76, 0x69, 0xc3, 0x02, 0x9f, 0x01, 0x76,
+    0x70, 0xc4, 0xe4, 0x33, 0x01, 0x77, 0x69, 0xc5, 0xd5, 0x65, 0x01, 0x77,
+    0x90, 0xc2, 0x02, 0xa0, 0x01, 0x76, 0xf1, 0xc4, 0x02, 0xde, 0x01, 0x76,
+    0xf8, 0xc2, 0x02, 0xa0, 0x01, 0x75, 0xf9, 0xc4, 0x02, 0xde, 0x01, 0x76,
+    0x00, 0x92, 0x01, 0x8e, 0x59, 0x9c, 0x01, 0x8e, 0x72, 0x02, 0x1a, 0x9e,
+    0x89, 0x01, 0x8e, 0x40, 0x09, 0xc2, 0x1a, 0xa2, 0x98, 0x05, 0x5b, 0xa9,
+    0x97, 0x05, 0x5b, 0xa1, 0x91, 0x05, 0x5b, 0x99, 0x8b, 0x05, 0x5b, 0x91,
+    0x87, 0x05, 0x5b, 0x89, 0x83, 0x05, 0x5b, 0x81, 0x1b, 0xc2, 0x1a, 0xba,
+    0x19, 0xc2, 0x1a, 0xd2, 0x16, 0xc2, 0x1a, 0xea, 0x10, 0xc2, 0x1a, 0xfe,
+    0x0a, 0xc2, 0x1b, 0x19, 0x0f, 0xc2, 0x1b, 0x37, 0x0e, 0xc2, 0x1b, 0x4f,
+    0xc2, 0x02, 0x2b, 0x05, 0x5b, 0xb9, 0x42, 0x00, 0xe3, 0xc2, 0x1b, 0x67,
+    0x95, 0x05, 0x5c, 0xeb, 0x02, 0x1b, 0x7f, 0x06, 0x42, 0x1b, 0x97, 0x83,
+    0x00, 0x9d, 0x01, 0x87, 0x00, 0x9d, 0x09, 0x8b, 0x00, 0x9d, 0x11, 0x91,
+    0x00, 0x9d, 0x19, 0x97, 0x00, 0x9d, 0x21, 0x98, 0x00, 0x9d, 0x29, 0x09,
+    0xc2, 0x1b, 0xb5, 0xc2, 0x02, 0x2b, 0x00, 0x9d, 0x39, 0x0a, 0xc2, 0x1b,
+    0xcd, 0x0e, 0xc2, 0x1b, 0xeb, 0x0f, 0xc2, 0x1c, 0x03, 0x10, 0xc2, 0x1c,
+    0x1b, 0x42, 0x00, 0xe3, 0xc2, 0x1c, 0x36, 0x95, 0x00, 0x9e, 0x6b, 0x02,
+    0x1c, 0x4e, 0x06, 0xc2, 0x1c, 0x66, 0x16, 0xc2, 0x1c, 0x84, 0x19, 0xc2,
+    0x1c, 0x98, 0x1b, 0x42, 0x1c, 0xb0, 0x00, 0x42, 0x1c, 0xc8, 0xcd, 0x77,
+    0x94, 0x0f, 0xa5, 0xc8, 0xc3, 0x39, 0x6e, 0x08, 0x8a, 0x21, 0xc2, 0x04,
+    0xc6, 0x08, 0x89, 0x18, 0xc2, 0x04, 0xc6, 0x08, 0x89, 0x09, 0xc3, 0xa9,
+    0x9c, 0x08, 0x89, 0x00, 0xc3, 0x39, 0x6e, 0x08, 0x88, 0xf1, 0xc2, 0x04,
+    0xc6, 0x08, 0x88, 0xe8, 0xc3, 0x39, 0x6e, 0x08, 0x88, 0xe1, 0xc2, 0x04,
+    0xc6, 0x08, 0x88, 0xd8, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0xd1, 0xc3, 0x3c,
+    0x8a, 0x08, 0x88, 0xa9, 0xc3, 0xa9, 0x9c, 0x08, 0x88, 0x81, 0xc3, 0x4f,
+    0x37, 0x08, 0x88, 0x58, 0xc3, 0x39, 0x6e, 0x08, 0x88, 0xc9, 0xc2, 0x04,
+    0xc6, 0x08, 0x88, 0xc1, 0x06, 0x42, 0x1c, 0xd4, 0xc3, 0x39, 0x6e, 0x08,
+    0x88, 0xb9, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0xb1, 0x16, 0x42, 0x1c, 0xe0,
+    0xc3, 0x39, 0x6e, 0x08, 0x88, 0x79, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x70,
+    0xc3, 0x39, 0x6e, 0x08, 0x88, 0x69, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x60,
+    0xc3, 0x39, 0x6e, 0x08, 0x88, 0x51, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x48,
+    0xc3, 0x39, 0x6e, 0x08, 0x88, 0x41, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x38,
+    0x87, 0x08, 0x89, 0x63, 0x02, 0x1c, 0xec, 0x83, 0x08, 0x89, 0x3b, 0x02,
+    0x1c, 0xf0, 0x91, 0x08, 0x89, 0x73, 0x02, 0x1c, 0xfc, 0x97, 0x08, 0x89,
+    0x53, 0x02, 0x1d, 0x00, 0x8b, 0x08, 0x89, 0x42, 0x02, 0x1d, 0x04, 0xc4,
+    0x26, 0x78, 0x08, 0x89, 0xf9, 0xc5, 0x06, 0xdb, 0x08, 0x89, 0xf1, 0x15,
+    0xc2, 0x1d, 0x08, 0x08, 0xc2, 0x1d, 0x14, 0x16, 0xc2, 0x1d, 0x20, 0xc3,
+    0x05, 0x14, 0x08, 0x89, 0xb9, 0xc4, 0x15, 0xe7, 0x08, 0x89, 0xb0, 0xc7,
+    0x40, 0xe5, 0x08, 0x88, 0x11, 0xc8, 0x14, 0x38, 0x08, 0x88, 0x09, 0xcb,
+    0x1e, 0x89, 0x08, 0x88, 0x00, 0x8a, 0x05, 0x52, 0x69, 0x8f, 0x05, 0x52,
+    0x61, 0xc2, 0x00, 0x75, 0x05, 0x52, 0x18, 0x87, 0x05, 0x51, 0x90, 0x97,
+    0x05, 0x51, 0x89, 0x8b, 0x05, 0x51, 0x81, 0x83, 0x05, 0x51, 0x48, 0x87,
+    0x05, 0x51, 0x70, 0x8b, 0x05, 0x51, 0x58, 0x83, 0x05, 0x51, 0x39, 0xc2,
+    0x0d, 0xf6, 0x05, 0x51, 0x30, 0x09, 0xc2, 0x1d, 0x2c, 0x83, 0x05, 0x50,
+    0xc1, 0xc2, 0x0f, 0xe1, 0x05, 0x50, 0xb9, 0x0a, 0x42, 0x1d, 0x36, 0xc2,
+    0x00, 0xd0, 0x05, 0x50, 0x49, 0x83, 0x05, 0x50, 0x40, 0xc2, 0x00, 0xd0,
+    0x05, 0x50, 0x39, 0x83, 0x05, 0x50, 0x30, 0x8b, 0x05, 0x50, 0x20, 0xc2,
+    0x00, 0xcc, 0x05, 0x52, 0x59, 0x8e, 0x05, 0x52, 0x51, 0x94, 0x05, 0x52,
+    0x49, 0x9b, 0x05, 0x52, 0x41, 0x92, 0x05, 0x52, 0x39, 0x90, 0x05, 0x52,
+    0x33, 0x02, 0x1d, 0x46, 0x96, 0x05, 0x52, 0x29, 0xc2, 0x11, 0xee, 0x05,
+    0x52, 0x21, 0x89, 0x05, 0x52, 0x09, 0x8d, 0x05, 0x52, 0x00, 0xc2, 0x01,
+    0x5d, 0x05, 0x51, 0x09, 0x83, 0x05, 0x50, 0xe9, 0xc2, 0x00, 0xd0, 0x05,
+    0x50, 0xf0, 0x83, 0x05, 0x51, 0x01, 0xc2, 0x0f, 0xe1, 0x05, 0x50, 0xf8,
+    0xc2, 0x00, 0xd0, 0x05, 0x50, 0xe1, 0xc2, 0x00, 0xb0, 0x05, 0x50, 0xd9,
+    0x83, 0x05, 0x50, 0xd0, 0xc2, 0x0e, 0x9a, 0x05, 0x50, 0xc9, 0xc2, 0x00,
+    0xd0, 0x05, 0x50, 0xb1, 0x83, 0x05, 0x50, 0xa8, 0xc2, 0x00, 0xd0, 0x05,
+    0x50, 0xa1, 0x83, 0x05, 0x50, 0x98, 0xc2, 0x00, 0xd0, 0x05, 0x50, 0x79,
+    0x83, 0x05, 0x50, 0x70, 0xc2, 0x00, 0xd0, 0x05, 0x50, 0x69, 0x83, 0x05,
+    0x50, 0x60, 0xcb, 0x97, 0xf5, 0x05, 0x52, 0xf1, 0xc4, 0x19, 0x53, 0x05,
+    0x52, 0xe8, 0xc4, 0x18, 0x10, 0x05, 0x52, 0xb9, 0xc2, 0x22, 0xcc, 0x05,
+    0x52, 0xb0, 0xc3, 0x0d, 0x14, 0x05, 0x52, 0xa9, 0xc3, 0x09, 0x9e, 0x05,
+    0x52, 0xa0, 0xc4, 0x02, 0xde, 0x05, 0x52, 0x99, 0xc2, 0x02, 0xa0, 0x05,
+    0x52, 0x90, 0xc8, 0x0d, 0x03, 0x08, 0x7e, 0x58, 0x19, 0xc2, 0x1d, 0x4a,
+    0xc2, 0x00, 0xc4, 0x08, 0x7e, 0x49, 0xc4, 0x02, 0xde, 0x08, 0x7e, 0x38,
+    0xc3, 0x11, 0xef, 0x08, 0x7e, 0x19, 0xca, 0xa5, 0xf8, 0x08, 0x7d, 0x89,
+    0xc5, 0xdc, 0x2c, 0x08, 0x7d, 0xf8, 0xc2, 0x00, 0x8e, 0x08, 0x7d, 0xc8,
+    0xc4, 0x36, 0xb5, 0x08, 0x7d, 0x81, 0xc3, 0x16, 0x5a, 0x08, 0x7e, 0x00,
+    0xc9, 0xad, 0x41, 0x01, 0x31, 0x49, 0xc8, 0xb8, 0xa2, 0x01, 0x31, 0x40,
+    0xc5, 0xcb, 0xf4, 0x0f, 0xaa, 0x13, 0x02, 0x1d, 0x54, 0x4a, 0x9b, 0xf8,
+    0x42, 0x1d, 0x5a, 0xe0, 0x0b, 0x07, 0x0f, 0x8c, 0x50, 0x08, 0xc2, 0x1d,
+    0x66, 0x8b, 0x0f, 0x00, 0x5b, 0x02, 0x1d, 0x72, 0x04, 0xc2, 0x1d, 0x84,
+    0x1b, 0xc2, 0x1d, 0x90, 0x15, 0xc2, 0x1d, 0xa2, 0xc6, 0x7b, 0xab, 0x0f,
+    0x00, 0xe9, 0x16, 0xc2, 0x1d, 0xb2, 0xc4, 0xdf, 0x9f, 0x0f, 0x00, 0xc1,
+    0xc3, 0xc5, 0x6f, 0x0f, 0x00, 0xb1, 0xc5, 0xd7, 0xb3, 0x0f, 0x00, 0x99,
+    0xc6, 0xcb, 0xed, 0x0f, 0x00, 0x91, 0xc3, 0x06, 0xc5, 0x0f, 0x00, 0x89,
+    0xc5, 0xdb, 0x78, 0x0f, 0x00, 0x81, 0xc7, 0x60, 0xdd, 0x0f, 0x00, 0x79,
+    0xc7, 0xc4, 0x48, 0x0f, 0x00, 0x71, 0xc4, 0xe1, 0x6b, 0x0f, 0x00, 0x69,
+    0x06, 0xc2, 0x1d, 0xbe, 0x1c, 0xc2, 0x1d, 0xca, 0xc7, 0xc1, 0xf5, 0x0f,
+    0x00, 0x19, 0xc4, 0xdf, 0x83, 0x0f, 0x00, 0x11, 0xc3, 0xe5, 0x4b, 0x0f,
+    0x00, 0x00, 0x44, 0x29, 0xb5, 0xc2, 0x1d, 0xd6, 0x03, 0x42, 0x1d, 0xf4,
+    0xc5, 0x00, 0xd4, 0x01, 0x07, 0x81, 0xc5, 0x05, 0x02, 0x00, 0x1a, 0xc8,
+    0xcc, 0x80, 0xc1, 0x01, 0x07, 0x39, 0x4c, 0x05, 0xf6, 0x42, 0x1e, 0x06,
+    0xc5, 0x05, 0x02, 0x00, 0xef, 0xe9, 0xc5, 0x00, 0xd4, 0x00, 0x1a, 0x60,
+    0x02, 0xc2, 0x1e, 0x12, 0x00, 0x42, 0x1e, 0x1e, 0x43, 0x00, 0x2e, 0xc2,
+    0x1e, 0x2d, 0x43, 0x00, 0x75, 0x42, 0x1e, 0x35, 0x45, 0x01, 0xd5, 0xc2,
+    0x1e, 0x47, 0xd2, 0x49, 0xf7, 0x00, 0x19, 0x10, 0x00, 0xc2, 0x1e, 0x53,
+    0x46, 0x01, 0x4a, 0x42, 0x1e, 0x6f, 0x43, 0x00, 0x75, 0xc2, 0x1e, 0x7b,
+    0xc6, 0x80, 0x30, 0x00, 0x19, 0x90, 0x4d, 0x29, 0xb9, 0xc2, 0x1e, 0x8b,
+    0x55, 0x37, 0xac, 0x42, 0x1f, 0x0e, 0xde, 0x0f, 0x22, 0x00, 0xd5, 0xc9,
+    0x46, 0x19, 0x9d, 0x42, 0x1f, 0x22, 0xcc, 0x86, 0x91, 0x01, 0x07, 0x49,
+    0xd5, 0x32, 0xea, 0x00, 0xef, 0xc8, 0xc8, 0xb9, 0x8a, 0x01, 0x07, 0x41,
+    0xcc, 0x83, 0x0d, 0x00, 0xd6, 0x59, 0xc3, 0x02, 0xa3, 0x00, 0xd5, 0xa0,
+    0x00, 0x42, 0x1f, 0x34, 0x44, 0x00, 0x5a, 0xc2, 0x1f, 0x4c, 0x16, 0xc2,
+    0x1f, 0x56, 0x42, 0x01, 0x48, 0x42, 0x1f, 0x60, 0xcb, 0x8f, 0xc0, 0x00,
+    0xef, 0xd9, 0x49, 0xb4, 0x7f, 0x42, 0x1f, 0x6c, 0xc5, 0xd9, 0xf7, 0x00,
+    0xd5, 0x89, 0xc6, 0x05, 0x01, 0x00, 0x19, 0x20, 0xd8, 0x24, 0x23, 0x01,
+    0x07, 0x21, 0xc6, 0xce, 0xc3, 0x01, 0x07, 0x19, 0x15, 0xc2, 0x1f, 0x7e,
+    0xc6, 0x02, 0xd1, 0x01, 0x06, 0xeb, 0x02, 0x1f, 0x8a, 0xc7, 0x3a, 0x19,
+    0x01, 0x06, 0xf8, 0xcc, 0x89, 0x25, 0x01, 0x06, 0xc9, 0xcb, 0x02, 0x5c,
+    0x01, 0x06, 0xa8, 0xcd, 0x33, 0xee, 0x00, 0x24, 0x49, 0x48, 0x0d, 0x04,
+    0xc2, 0x1f, 0x90, 0x12, 0xc2, 0x1f, 0x9c, 0xce, 0x6c, 0xa6, 0x00, 0x24,
+    0x29, 0x16, 0xc2, 0x1f, 0xac, 0x47, 0x02, 0x0e, 0xc2, 0x1f, 0xc1, 0xc5,
+    0xda, 0x88, 0x05, 0x33, 0x79, 0xc6, 0x4a, 0x9f, 0x05, 0x33, 0xe0, 0xc6,
+    0x05, 0x01, 0x00, 0x19, 0x68, 0xc3, 0x01, 0xe7, 0x00, 0x18, 0x63, 0x02,
+    0x20, 0x2f, 0xc9, 0x1e, 0x8b, 0x00, 0x18, 0x80, 0x44, 0x0a, 0x8c, 0xc2,
+    0x20, 0x35, 0xcf, 0x60, 0xa8, 0x07, 0xf1, 0x32, 0x02, 0x20, 0x44, 0xd5,
+    0x36, 0x86, 0x01, 0x06, 0x99, 0x15, 0x42, 0x20, 0x4a, 0xcd, 0x7d, 0x92,
+    0x00, 0xd6, 0x29, 0xc4, 0x05, 0x03, 0x00, 0x19, 0xd8, 0xe0, 0x08, 0x47,
+    0x00, 0xd5, 0xd0, 0xc3, 0x0f, 0xbe, 0x00, 0x18, 0x33, 0x02, 0x20, 0x56,
+    0x45, 0x32, 0xf5, 0x42, 0x20, 0x62, 0xc4, 0x00, 0x49, 0x00, 0xef, 0xb9,
+    0xc5, 0x00, 0x2c, 0x00, 0xef, 0xb0, 0xd1, 0x2f, 0xfb, 0x01, 0x84, 0xc9,
+    0xd6, 0x2f, 0xf6, 0x01, 0x84, 0xd0, 0x46, 0x9a, 0x3c, 0xc2, 0x20, 0x6e,
+    0xd1, 0x3c, 0x67, 0x00, 0x1a, 0x70, 0x47, 0x1d, 0x71, 0xc2, 0x20, 0x7a,
+    0xc6, 0x65, 0x43, 0x00, 0xd5, 0x90, 0xc6, 0x00, 0xd3, 0x00, 0xee, 0x70,
+    0xc2, 0x00, 0xd1, 0x08, 0x1b, 0xb1, 0xc3, 0x63, 0x78, 0x08, 0x1b, 0xb9,
+    0xc4, 0xde, 0xdb, 0x08, 0x1b, 0xc1, 0xc5, 0xdb, 0x6e, 0x08, 0x1b, 0xc9,
+    0xc3, 0xe6, 0x0b, 0x08, 0x1b, 0xd0, 0x02, 0xc2, 0x20, 0x86, 0x00, 0x42,
+    0x20, 0x98, 0xc5, 0x00, 0xd4, 0x00, 0xd6, 0x41, 0xc5, 0x05, 0x02, 0x00,
+    0x18, 0xf8, 0x4a, 0x57, 0x93, 0xc2, 0x20, 0xb0, 0xd4, 0x3e, 0x08, 0x00,
+    0x19, 0x08, 0xc5, 0x00, 0xd4, 0x00, 0x19, 0xe9, 0xc5, 0x05, 0x02, 0x00,
+    0x1a, 0x98, 0xc5, 0x00, 0xd4, 0x00, 0x18, 0x69, 0xc5, 0x05, 0x02, 0x00,
+    0x19, 0x48, 0xc4, 0x26, 0x78, 0x0e, 0x9b, 0x89, 0xc5, 0x06, 0xdb, 0x0e,
+    0x9b, 0x81, 0x15, 0xc2, 0x20, 0xc2, 0x08, 0xc2, 0x20, 0xce, 0x16, 0xc2,
+    0x20, 0xda, 0xc3, 0x05, 0x14, 0x0e, 0x9b, 0x48, 0xc4, 0x26, 0x78, 0x0e,
+    0x9b, 0x41, 0xc5, 0x06, 0xdb, 0x0e, 0x9b, 0x39, 0x15, 0xc2, 0x20, 0xe6,
+    0x08, 0xc2, 0x20, 0xf2, 0x16, 0xc2, 0x20, 0xfe, 0xc3, 0x05, 0x14, 0x0e,
+    0x9b, 0x00, 0xc7, 0x80, 0x70, 0x01, 0x17, 0xe9, 0x48, 0x00, 0x5f, 0xc2,
+    0x21, 0x0a, 0xd6, 0x2c, 0x86, 0x01, 0x17, 0xd0, 0xcf, 0x4c, 0x01, 0x01,
+    0x15, 0x9b, 0x02, 0x21, 0x10, 0xc6, 0x00, 0x4e, 0x01, 0x10, 0x58, 0x0d,
+    0xc2, 0x21, 0x16, 0x0a, 0xc2, 0x21, 0x26, 0x42, 0x01, 0x30, 0xc2, 0x21,
+    0x32, 0x15, 0xc2, 0x21, 0x3e, 0x06, 0xc2, 0x21, 0x54, 0x03, 0xc2, 0x21,
+    0x66, 0xc4, 0xdf, 0x33, 0x01, 0x64, 0x19, 0xc3, 0xd1, 0x8c, 0x01, 0x64,
+    0x49, 0xc4, 0xde, 0xdb, 0x01, 0x64, 0x69, 0x16, 0xc2, 0x21, 0x72, 0xc5,
+    0xd8, 0xcb, 0x01, 0x64, 0x99, 0x0e, 0xc2, 0x21, 0x7e, 0xc2, 0x02, 0x2f,
+    0x01, 0x64, 0xc9, 0xc2, 0x00, 0xec, 0x01, 0x64, 0xd9, 0x91, 0x01, 0x64,
+    0xfb, 0x02, 0x21, 0x8a, 0x12, 0xc2, 0x21, 0x96, 0xc2, 0x00, 0x79, 0x01,
+    0x65, 0x19, 0xc2, 0x00, 0xe4, 0x01, 0x65, 0x49, 0x08, 0xc2, 0x21, 0xa0,
+    0x42, 0x07, 0x2f, 0xc2, 0x21, 0xaa, 0xcd, 0x7c, 0x40, 0x01, 0x67, 0x98,
+    0x0d, 0xc2, 0x21, 0xb6, 0xc5, 0xda, 0xb5, 0x01, 0x67, 0x29, 0xc5, 0xd8,
+    0x08, 0x01, 0x67, 0x31, 0x15, 0xc2, 0x21, 0xc2, 0xc6, 0xd1, 0x45, 0x01,
+    0x67, 0x40, 0x0a, 0xc2, 0x21, 0xce, 0x42, 0x01, 0x30, 0xc2, 0x21, 0xda,
+    0x15, 0xc2, 0x21, 0xe6, 0x06, 0xc2, 0x21, 0xfc, 0x03, 0xc2, 0x22, 0x0e,
+    0xc4, 0xdf, 0x33, 0x01, 0x64, 0x11, 0xc3, 0xd1, 0x8c, 0x01, 0x64, 0x41,
+    0xc4, 0xde, 0xdb, 0x01, 0x64, 0x61, 0x16, 0xc2, 0x22, 0x1a, 0xc5, 0xd8,
+    0xcb, 0x01, 0x64, 0x91, 0x0d, 0xc2, 0x22, 0x26, 0x0e, 0xc2, 0x22, 0x36,
+    0xc2, 0x02, 0x2f, 0x01, 0x64, 0xc1, 0xc2, 0x00, 0xec, 0x01, 0x64, 0xd1,
+    0x91, 0x01, 0x64, 0xf3, 0x02, 0x22, 0x42, 0x12, 0xc2, 0x22, 0x4e, 0xc2,
+    0x00, 0x79, 0x01, 0x65, 0x11, 0xc2, 0x00, 0xe4, 0x01, 0x65, 0x41, 0x08,
+    0xc2, 0x22, 0x58, 0x42, 0x07, 0x2f, 0xc2, 0x22, 0x62, 0xcd, 0x7c, 0x40,
+    0x01, 0x67, 0x90, 0xc8, 0xbb, 0xa2, 0x01, 0x67, 0x79, 0x49, 0xac, 0x21,
+    0x42, 0x22, 0x6e, 0xc3, 0x05, 0x14, 0x08, 0x17, 0x09, 0x16, 0xc2, 0x22,
+    0x7a, 0x08, 0xc2, 0x22, 0x86, 0x15, 0xc2, 0x22, 0x92, 0xc5, 0x06, 0xdb,
+    0x08, 0x17, 0x41, 0xc4, 0x26, 0x78, 0x08, 0x17, 0x48, 0x16, 0xc2, 0x22,
+    0x9e, 0x08, 0xc2, 0x22, 0xac, 0x15, 0xc2, 0x22, 0xb4, 0x45, 0x06, 0xdb,
+    0xc2, 0x22, 0xc0, 0x44, 0x26, 0x78, 0xc2, 0x22, 0xca, 0xcb, 0x0d, 0x00,
+    0x08, 0x17, 0x98, 0xcb, 0x9a, 0x5d, 0x0f, 0xa7, 0x59, 0xcc, 0x81, 0x81,
+    0x0f, 0xa7, 0x50, 0xc7, 0x57, 0x8b, 0x0f, 0x98, 0x11, 0xd0, 0x59, 0x82,
+    0x01, 0x52, 0x62, 0x02, 0x22, 0xd6, 0xc4, 0x0e, 0xa6, 0x01, 0x56, 0x7b,
+    0x02, 0x22, 0xdc, 0xc6, 0x2d, 0xd0, 0x01, 0x56, 0x82, 0x02, 0x22, 0xe2,
+    0xcf, 0x62, 0xe2, 0x01, 0x11, 0x91, 0xd2, 0x4e, 0x77, 0x01, 0x4a, 0x08,
+    0xd3, 0x44, 0x7c, 0x01, 0x0d, 0xb9, 0xe0, 0x0b, 0xa7, 0x01, 0x5b, 0x70,
+    0xdb, 0x16, 0xda, 0x0f, 0xae, 0xc1, 0x46, 0x01, 0x4a, 0x42, 0x22, 0xe8,
+    0xe0, 0x09, 0x07, 0x0f, 0xa8, 0x18, 0x19, 0xc2, 0x22, 0xf1, 0x42, 0x00,
+    0xc4, 0xc2, 0x22, 0xfb, 0x44, 0x02, 0xde, 0x42, 0x23, 0x07, 0x45, 0x66,
+    0xb1, 0xc2, 0x23, 0x13, 0x44, 0x00, 0x2d, 0x42, 0x23, 0x1f, 0xc7, 0xc1,
+    0xd9, 0x0f, 0xab, 0x21, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xc0, 0x44, 0x18,
+    0x10, 0xc2, 0x23, 0x2b, 0x42, 0x22, 0xcc, 0x42, 0x23, 0x37, 0x43, 0x0d,
+    0x14, 0xc2, 0x23, 0x43, 0x43, 0x09, 0x9e, 0x42, 0x23, 0x4f, 0xc7, 0xc1,
+    0xd9, 0x0f, 0xaa, 0xe1, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0x80, 0x44, 0x0d,
+    0x21, 0xc2, 0x23, 0x5b, 0xd8, 0x02, 0xef, 0x0f, 0x8b, 0x71, 0x85, 0x0f,
+    0x8b, 0x69, 0x86, 0x0f, 0x89, 0x68, 0xdb, 0x15, 0x45, 0x01, 0x3d, 0x91,
+    0xd8, 0x22, 0x8b, 0x01, 0x1c, 0x49, 0xcb, 0x8f, 0x73, 0x0f, 0x8b, 0x79,
+    0x46, 0xc3, 0x3f, 0x42, 0x23, 0x65, 0x45, 0x01, 0xfd, 0xc2, 0x23, 0xab,
+    0x9c, 0x0f, 0x89, 0x70, 0x0b, 0xc2, 0x23, 0xb7, 0xc3, 0x02, 0x2c, 0x01,
+    0x14, 0xe9, 0x11, 0x42, 0x23, 0xc3, 0x45, 0x0b, 0x12, 0xc2, 0x23, 0xcd,
+    0xc8, 0x00, 0xcb, 0x01, 0x4e, 0x00, 0x16, 0xc2, 0x23, 0xd9, 0xc8, 0x4b,
+    0x5f, 0x01, 0x23, 0x91, 0x07, 0xc2, 0x23, 0xee, 0x15, 0xc2, 0x23, 0xfa,
+    0x08, 0x42, 0x24, 0x06, 0xc7, 0x01, 0x93, 0x0f, 0xbe, 0xab, 0x02, 0x24,
+    0x10, 0xc4, 0x03, 0x4e, 0x01, 0x14, 0xb8, 0xd0, 0x5b, 0x32, 0x01, 0x14,
+    0xd9, 0x4c, 0x04, 0x1b, 0x42, 0x24, 0x16, 0xcc, 0x87, 0x51, 0x01, 0x14,
+    0xd1, 0xce, 0x61, 0xd5, 0x01, 0x4d, 0xc0, 0xc4, 0x1d, 0x1e, 0x01, 0x14,
+    0xb1, 0x49, 0x1f, 0x19, 0x42, 0x24, 0x22, 0xc3, 0x25, 0xd6, 0x01, 0x14,
+    0xa9, 0xcc, 0x8b, 0x29, 0x01, 0x4d, 0xc9, 0xc7, 0x36, 0x16, 0x01, 0x4d,
+    0xb9, 0xca, 0x9a, 0xa4, 0x01, 0x81, 0xb0, 0x49, 0x9f, 0x87, 0xc2, 0x24,
+    0x28, 0x5b, 0x16, 0xf5, 0xc2, 0x24, 0x74, 0xd1, 0x53, 0x87, 0x0f, 0xb6,
+    0x40, 0xc5, 0x1c, 0xb5, 0x01, 0x4d, 0xf9, 0xc5, 0xdc, 0x4a, 0x01, 0x5d,
+    0xf8, 0x50, 0x4b, 0xf0, 0xc2, 0x24, 0x7c, 0x48, 0xbc, 0xc2, 0x42, 0x24,
+    0x88, 0x03, 0xc2, 0x24, 0xc0, 0x46, 0x02, 0xae, 0xc2, 0x24, 0xc6, 0x0e,
+    0xc2, 0x24, 0xd2, 0xd0, 0x5d, 0x52, 0x01, 0x2e, 0x89, 0xcd, 0x7a, 0x93,
+    0x01, 0x2e, 0x69, 0x43, 0x02, 0x9f, 0xc2, 0x24, 0xde, 0x15, 0xc2, 0x24,
+    0xe4, 0xce, 0x0e, 0xf1, 0x01, 0x4d, 0xa8, 0xe0, 0x07, 0xa7, 0x01, 0x4d,
+    0xd0, 0xa2, 0x09, 0x1b, 0x5b, 0x02, 0x24, 0xf0, 0xd1, 0x54, 0x20, 0x09,
+    0x2a, 0x11, 0x8f, 0x09, 0x1b, 0x71, 0xc3, 0x2b, 0x88, 0x09, 0x1b, 0x68,
+    0xa4, 0x09, 0x2a, 0x09, 0xc2, 0xd1, 0x86, 0x09, 0x1b, 0x09, 0x89, 0x09,
+    0x1b, 0x01, 0x00, 0x42, 0x24, 0xf6, 0xc2, 0xde, 0xe9, 0x09, 0x1b, 0x49,
+    0x89, 0x09, 0x1b, 0x41, 0x84, 0x09, 0x1b, 0x33, 0x02, 0x25, 0x02, 0xa0,
+    0x09, 0x1b, 0x29, 0xc8, 0xb5, 0xba, 0x09, 0x1b, 0x20, 0x97, 0x09, 0x19,
+    0xbb, 0x02, 0x25, 0x08, 0x9f, 0x09, 0x19, 0x5b, 0x02, 0x25, 0x17, 0x8b,
+    0x09, 0x19, 0xab, 0x02, 0x25, 0x1b, 0xa1, 0x09, 0x19, 0xa1, 0x00, 0x42,
+    0x25, 0x1f, 0x97, 0x09, 0x1c, 0xcb, 0x02, 0x25, 0x2b, 0x47, 0x1b, 0x73,
+    0xc2, 0x25, 0x31, 0xc3, 0x6c, 0x49, 0x09, 0x18, 0x60, 0x47, 0x03, 0x4c,
+    0xc2, 0x25, 0x43, 0xc2, 0x01, 0xdf, 0x09, 0x19, 0x1b, 0x02, 0x25, 0x5c,
+    0xc3, 0x1d, 0xd4, 0x09, 0x19, 0x10, 0x97, 0x09, 0x1a, 0xe1, 0xa0, 0x09,
+    0x1a, 0xd2, 0x02, 0x25, 0x62, 0xc3, 0xe5, 0x21, 0x09, 0x1a, 0xc1, 0x9f,
+    0x09, 0x1a, 0xb9, 0x9a, 0x09, 0x1a, 0xb1, 0x47, 0x03, 0x4c, 0x42, 0x25,
+    0x68, 0xc5, 0x39, 0xc7, 0x09, 0x19, 0x38, 0xc2, 0x0b, 0x47, 0x09, 0x18,
+    0xe1, 0x00, 0x42, 0x25, 0x7b, 0x8f, 0x09, 0x18, 0x43, 0x02, 0x25, 0x96,
+    0x94, 0x09, 0x18, 0x4b, 0x02, 0x25, 0x9c, 0x8d, 0x09, 0x18, 0x39, 0xc2,
+    0x0b, 0x48, 0x09, 0x18, 0x30, 0xc2, 0x38, 0xb6, 0x09, 0x17, 0xd3, 0x02,
+    0x25, 0xa2, 0x94, 0x09, 0x17, 0xd9, 0x89, 0x09, 0x17, 0x9b, 0x02, 0x25,
+    0xa8, 0x84, 0x09, 0x17, 0x83, 0x02, 0x25, 0xae, 0x00, 0x42, 0x25, 0xb2,
+    0x9f, 0x09, 0x1c, 0xb9, 0x94, 0x09, 0x18, 0x0b, 0x02, 0x25, 0xc4, 0x8e,
+    0x09, 0x18, 0x01, 0xc5, 0x58, 0xf4, 0x09, 0x17, 0xf8, 0xc5, 0x39, 0xc7,
+    0x09, 0x17, 0xe8, 0x00, 0xc2, 0x25, 0xc8, 0xc3, 0xd8, 0x33, 0x09, 0x17,
+    0x09, 0xc2, 0x9c, 0x98, 0x09, 0x17, 0x01, 0x89, 0x09, 0x16, 0xea, 0x02,
+    0x25, 0xd4, 0x97, 0x09, 0x16, 0xbb, 0x02, 0x25, 0xdb, 0x87, 0x09, 0x15,
+    0xd3, 0x02, 0x25, 0xee, 0x83, 0x09, 0x15, 0x6b, 0x02, 0x26, 0x05, 0x0b,
+    0x42, 0x26, 0x1f, 0x89, 0x09, 0x14, 0xab, 0x02, 0x26, 0x40, 0x94, 0x09,
+    0x15, 0x61, 0xc4, 0xe3, 0xaf, 0x09, 0x15, 0x59, 0x8e, 0x09, 0x15, 0x4a,
+    0x02, 0x26, 0x44, 0x94, 0x09, 0x17, 0x4b, 0x02, 0x26, 0x4a, 0x8f, 0x09,
+    0x17, 0x3b, 0x02, 0x26, 0x4e, 0xc3, 0x06, 0x47, 0x09, 0x17, 0x31, 0x86,
+    0x09, 0x17, 0x23, 0x02, 0x26, 0x54, 0xc8, 0x8b, 0x5c, 0x09, 0x17, 0x18,
+    0x90, 0x09, 0x1c, 0x7b, 0x02, 0x26, 0x58, 0xc3, 0x78, 0x3e, 0x09, 0x13,
+    0x01, 0x8f, 0x09, 0x12, 0x7b, 0x02, 0x26, 0x65, 0x9f, 0x09, 0x12, 0x71,
+    0xc8, 0x98, 0x84, 0x09, 0x12, 0x68, 0xc2, 0x2b, 0x85, 0x09, 0x13, 0x13,
+    0x02, 0x26, 0x6b, 0x90, 0x09, 0x13, 0x1a, 0x02, 0x26, 0x6f, 0xa1, 0x09,
+    0x1c, 0x71, 0x8f, 0x09, 0x12, 0x33, 0x02, 0x26, 0x7c, 0xc2, 0x01, 0x30,
+    0x09, 0x12, 0x03, 0x02, 0x26, 0x86, 0x9f, 0x09, 0x11, 0xf8, 0x00, 0x42,
+    0x26, 0x8e, 0xc2, 0x01, 0xe2, 0x09, 0x11, 0x93, 0x02, 0x26, 0x9a, 0xc4,
+    0xe4, 0xc3, 0x09, 0x11, 0x89, 0xc4, 0xe4, 0x7f, 0x09, 0x11, 0x81, 0x89,
+    0x09, 0x11, 0x73, 0x02, 0x26, 0xa5, 0xc8, 0xb5, 0xd2, 0x09, 0x11, 0x68,
+    0xc9, 0xab, 0xc7, 0x09, 0x28, 0xf9, 0x90, 0x09, 0x11, 0x58, 0x95, 0x09,
+    0x11, 0x4a, 0x02, 0x26, 0xab, 0xc2, 0x01, 0xe2, 0x09, 0x11, 0x33, 0x02,
+    0x26, 0xaf, 0x94, 0x09, 0x11, 0x29, 0x8a, 0x09, 0x11, 0x21, 0x9f, 0x09,
+    0x11, 0x19, 0x00, 0x42, 0x26, 0xb3, 0x9f, 0x09, 0x0f, 0xeb, 0x02, 0x26,
+    0xbf, 0x8f, 0x09, 0x10, 0xeb, 0x02, 0x26, 0xc3, 0x8e, 0x09, 0x10, 0xe1,
+    0x8a, 0x09, 0x10, 0xd9, 0xc3, 0x38, 0x73, 0x09, 0x10, 0xbb, 0x02, 0x26,
+    0xcc, 0xa0, 0x09, 0x10, 0xb1, 0xca, 0x8d, 0x2d, 0x09, 0x0f, 0xe0, 0x42,
+    0x0c, 0x67, 0xc2, 0x26, 0xd0, 0x42, 0x01, 0x30, 0xc2, 0x26, 0xf2, 0x8f,
+    0x09, 0x0f, 0xa3, 0x02, 0x27, 0x00, 0x8e, 0x09, 0x0f, 0x93, 0x02, 0x27,
+    0x09, 0xc4, 0xdf, 0xdb, 0x09, 0x0f, 0x88, 0xc2, 0x01, 0xe2, 0x09, 0x0f,
+    0xd1, 0xc4, 0xe3, 0xe7, 0x09, 0x0f, 0xc9, 0x8e, 0x09, 0x0f, 0xc0, 0x47,
+    0x03, 0x4c, 0xc2, 0x27, 0x0f, 0xc9, 0xae, 0xdf, 0x09, 0x1b, 0x79, 0xc4,
+    0x45, 0xaf, 0x09, 0x0c, 0xe3, 0x02, 0x27, 0x5b, 0x0f, 0xc2, 0x27, 0x5f,
+    0x8e, 0x09, 0x0c, 0xbb, 0x02, 0x27, 0x67, 0x8d, 0x09, 0x0c, 0xab, 0x02,
+    0x27, 0x6b, 0x06, 0xc2, 0x27, 0x71, 0x84, 0x09, 0x0c, 0x79, 0x9f, 0x09,
+    0x0c, 0x6a, 0x02, 0x27, 0x84, 0xc4, 0x5d, 0xd2, 0x09, 0x0d, 0xa9, 0x94,
+    0x09, 0x0d, 0x9b, 0x02, 0x27, 0x8a, 0x90, 0x09, 0x0d, 0x91, 0x8e, 0x09,
+    0x0d, 0x83, 0x02, 0x27, 0x90, 0xa4, 0x09, 0x0d, 0x79, 0xa1, 0x09, 0x0d,
+    0x6b, 0x02, 0x27, 0x96, 0xa0, 0x09, 0x0d, 0x61, 0x49, 0x05, 0x54, 0x42,
+    0x27, 0x9c, 0x15, 0xc2, 0x27, 0xa2, 0x90, 0x09, 0x0d, 0x29, 0x86, 0x09,
+    0x0d, 0x21, 0x47, 0x03, 0x4c, 0x42, 0x27, 0xb5, 0x47, 0x03, 0x4c, 0x42,
+    0x27, 0xc2, 0x00, 0xc2, 0x27, 0xf3, 0x8e, 0x09, 0x09, 0x60, 0xc2, 0x01,
+    0xe2, 0x09, 0x1b, 0xe9, 0xc2, 0xaf, 0x5c, 0x09, 0x09, 0xf1, 0xc2, 0x58,
+    0xf2, 0x09, 0x09, 0xc2, 0x02, 0x28, 0x02, 0x86, 0x09, 0x08, 0xf3, 0x02,
+    0x28, 0x08, 0x9f, 0x09, 0x08, 0xc3, 0x02, 0x28, 0x0c, 0x94, 0x09, 0x09,
+    0x2b, 0x02, 0x28, 0x10, 0x8f, 0x09, 0x09, 0x1b, 0x02, 0x28, 0x18, 0x8e,
+    0x09, 0x09, 0x11, 0xcc, 0x88, 0xe9, 0x09, 0x08, 0xb8, 0x15, 0xc2, 0x28,
+    0x1e, 0x89, 0x09, 0x1b, 0xe1, 0x14, 0xc2, 0x28, 0x2b, 0xc3, 0x7e, 0x08,
+    0x09, 0x08, 0x39, 0xa1, 0x09, 0x08, 0x23, 0x02, 0x28, 0x39, 0x00, 0x42,
+    0x28, 0x3d, 0xc5, 0xda, 0xba, 0x09, 0x07, 0xf3, 0x02, 0x28, 0x49, 0xc2,
+    0xe1, 0x2e, 0x09, 0x1b, 0xd8, 0xc2, 0x01, 0x5d, 0x09, 0x07, 0x73, 0x02,
+    0x28, 0x4f, 0x9f, 0x09, 0x05, 0xbb, 0x02, 0x28, 0x53, 0xc4, 0x09, 0x26,
+    0x09, 0x07, 0xe9, 0x94, 0x09, 0x07, 0xdb, 0x02, 0x28, 0x57, 0x90, 0x09,
+    0x07, 0xb3, 0x02, 0x28, 0x5b, 0x8f, 0x09, 0x07, 0xa9, 0x8e, 0x09, 0x07,
+    0x93, 0x02, 0x28, 0x62, 0x86, 0x09, 0x07, 0x83, 0x02, 0x28, 0x6e, 0xc5,
+    0x39, 0xc7, 0x09, 0x05, 0xb0, 0x00, 0x42, 0x28, 0x74, 0xce, 0x73, 0x28,
+    0x09, 0x25, 0x60, 0xc3, 0x9e, 0x4d, 0x09, 0x04, 0xfb, 0x02, 0x28, 0x80,
+    0xc2, 0x00, 0xc4, 0x09, 0x04, 0xf0, 0x47, 0x03, 0x4c, 0x42, 0x28, 0x86,
+    0x00, 0x42, 0x28, 0xac, 0xd3, 0x42, 0x55, 0x09, 0x04, 0x61, 0xc9, 0xa8,
+    0xe5, 0x09, 0x04, 0x58, 0x89, 0x09, 0x04, 0x0b, 0x02, 0x28, 0xc4, 0x84,
+    0x09, 0x03, 0xf3, 0x02, 0x28, 0xd0, 0xc2, 0x38, 0x6a, 0x09, 0x04, 0x49,
+    0x90, 0x09, 0x04, 0x23, 0x02, 0x28, 0xda, 0x8a, 0x09, 0x04, 0x19, 0x00,
+    0x42, 0x28, 0xe5, 0x8f, 0x09, 0x03, 0xa3, 0x02, 0x28, 0xf7, 0xc2, 0x01,
+    0xe2, 0x09, 0x03, 0xcb, 0x02, 0x29, 0x04, 0x90, 0x09, 0x03, 0xbb, 0x02,
+    0x29, 0x0a, 0x84, 0x09, 0x03, 0x98, 0x89, 0x09, 0x02, 0xb3, 0x02, 0x29,
+    0x10, 0xcb, 0x38, 0xad, 0x09, 0x24, 0x41, 0x94, 0x09, 0x03, 0x7b, 0x02,
+    0x29, 0x18, 0x8f, 0x09, 0x03, 0x70, 0x00, 0xc2, 0x29, 0x1c, 0x94, 0x09,
+    0x02, 0x9b, 0x02, 0x29, 0x28, 0xc3, 0x6c, 0x4d, 0x09, 0x02, 0x8a, 0x02,
+    0x29, 0x2c, 0xc4, 0x38, 0x68, 0x09, 0x02, 0x1b, 0x02, 0x29, 0x32, 0x86,
+    0x09, 0x02, 0x0b, 0x02, 0x29, 0x38, 0x94, 0x09, 0x02, 0x3b, 0x02, 0x29,
+    0x3e, 0x8e, 0x09, 0x02, 0x23, 0x02, 0x29, 0x44, 0xc2, 0xe6, 0xad, 0x09,
+    0x02, 0x10, 0x47, 0x03, 0x4c, 0x42, 0x29, 0x50, 0xcb, 0x98, 0x84, 0x09,
+    0x24, 0x10, 0x00, 0xc2, 0x29, 0x60, 0x9f, 0x09, 0x00, 0xb2, 0x02, 0x29,
+    0x6c, 0x47, 0x03, 0x4c, 0x42, 0x29, 0x72, 0x8a, 0x09, 0x01, 0xc3, 0x02,
+    0x29, 0x7e, 0xc3, 0xe5, 0x9f, 0x09, 0x01, 0xb8, 0xc3, 0x91, 0xee, 0x09,
+    0x01, 0xb1, 0xc2, 0x01, 0x9d, 0x09, 0x01, 0xa2, 0x02, 0x29, 0x8c, 0xc3,
+    0x04, 0x65, 0x09, 0x01, 0x91, 0x00, 0x42, 0x29, 0x92, 0xc3, 0x36, 0xb6,
+    0x09, 0x01, 0x51, 0xc2, 0x00, 0xd1, 0x09, 0x01, 0x49, 0x47, 0x03, 0x4c,
+    0x42, 0x29, 0xa4, 0x47, 0x03, 0x4c, 0x42, 0x29, 0xcc, 0xc3, 0x78, 0x3e,
+    0x09, 0x00, 0x41, 0xc4, 0x7a, 0x34, 0x09, 0x00, 0x39, 0xca, 0x39, 0xc2,
+    0x09, 0x00, 0x31, 0xc3, 0x04, 0x2a, 0x09, 0x00, 0x29, 0xc2, 0x00, 0xd0,
+    0x09, 0x00, 0x21, 0xc9, 0x5d, 0x99, 0x09, 0x00, 0x19, 0xc3, 0x62, 0x19,
+    0x09, 0x00, 0x11, 0x83, 0x09, 0x00, 0x08, 0x14, 0xc2, 0x29, 0xd8, 0x00,
+    0x42, 0x29, 0xe5, 0xc9, 0x0a, 0xfe, 0x09, 0x1c, 0xa0, 0x92, 0x09, 0x13,
+    0xe9, 0x90, 0x09, 0x13, 0xe1, 0x86, 0x09, 0x13, 0xd8, 0x84, 0x09, 0x14,
+    0x80, 0xc2, 0x00, 0x74, 0x09, 0x0a, 0x99, 0x00, 0x42, 0x29, 0xf1, 0x9f,
+    0x09, 0x0a, 0x69, 0xd0, 0x5d, 0x92, 0x09, 0x0a, 0x60, 0x8b, 0x09, 0x0a,
+    0x32, 0x02, 0x2a, 0x09, 0x4b, 0x96, 0xa0, 0x42, 0x2a, 0x0d, 0x97, 0x09,
+    0x20, 0xa3, 0x02, 0x2a, 0x19, 0xd3, 0x42, 0xa1, 0x09, 0x22, 0x33, 0x02,
+    0x2a, 0x1f, 0xc5, 0xdb, 0xdc, 0x09, 0x21, 0x59, 0xc5, 0xd7, 0xf9, 0x09,
+    0x20, 0xe9, 0xc4, 0x04, 0x59, 0x09, 0x20, 0x71, 0xc3, 0x02, 0x2c, 0x09,
+    0x20, 0x38, 0xc3, 0x26, 0x1a, 0x09, 0x22, 0xb9, 0xc3, 0x0f, 0xd6, 0x09,
+    0x22, 0xb0, 0x97, 0x09, 0x20, 0x9b, 0x02, 0x2a, 0x2d, 0xd1, 0x53, 0x21,
+    0x09, 0x22, 0x23, 0x02, 0x2a, 0x33, 0xc5, 0xdb, 0xdc, 0x09, 0x21, 0x51,
+    0xc5, 0xd7, 0xf9, 0x09, 0x20, 0xe1, 0xc4, 0x04, 0x59, 0x09, 0x20, 0x69,
+    0xc3, 0x02, 0x2c, 0x09, 0x20, 0x30, 0x08, 0xc2, 0x2a, 0x37, 0xca, 0x9d,
+    0x2e, 0x09, 0x23, 0x31, 0xc9, 0xac, 0xcc, 0x09, 0x23, 0x28, 0x97, 0x09,
+    0x20, 0x93, 0x02, 0x2a, 0x43, 0x51, 0x52, 0xdd, 0xc2, 0x2a, 0x49, 0xc5,
+    0xdb, 0xdc, 0x09, 0x21, 0x49, 0xc5, 0xd7, 0xf9, 0x09, 0x20, 0xd9, 0xc4,
+    0x04, 0x59, 0x09, 0x20, 0x61, 0xc3, 0x02, 0x2c, 0x09, 0x20, 0x28, 0x97,
+    0x09, 0x20, 0x8b, 0x02, 0x2a, 0x51, 0xc3, 0x02, 0x2c, 0x09, 0x20, 0x23,
+    0x02, 0x2a, 0x57, 0xd1, 0x54, 0x64, 0x09, 0x22, 0x01, 0xc5, 0xdb, 0xdc,
+    0x09, 0x21, 0x41, 0xc5, 0xd7, 0xf9, 0x09, 0x20, 0xd1, 0xc4, 0x04, 0x59,
+    0x09, 0x20, 0x58, 0xc3, 0x0f, 0xd6, 0x09, 0x21, 0x99, 0xc4, 0x04, 0x59,
+    0x09, 0x21, 0x90, 0x97, 0x09, 0x20, 0x83, 0x02, 0x2a, 0x5d, 0x15, 0xc2,
+    0x2a, 0x63, 0x04, 0xc2, 0x2a, 0x6f, 0xc3, 0x02, 0x2c, 0x09, 0x20, 0x1b,
+    0x02, 0x2a, 0x7e, 0x44, 0x64, 0xa6, 0xc2, 0x2a, 0x84, 0xc4, 0x04, 0x59,
+    0x09, 0x20, 0x50, 0x97, 0x09, 0x20, 0x7b, 0x02, 0x2a, 0x8c, 0x04, 0xc2,
+    0x2a, 0x92, 0xc3, 0x02, 0x2c, 0x09, 0x20, 0x13, 0x02, 0x2a, 0xa1, 0xd2,
+    0x49, 0x31, 0x09, 0x21, 0xe3, 0x02, 0x2a, 0xa7, 0x44, 0x7a, 0x36, 0xc2,
+    0x2a, 0xaf, 0x44, 0x64, 0xa6, 0xc2, 0x2a, 0xb7, 0xc4, 0x04, 0x59, 0x09,
+    0x20, 0x48, 0xc8, 0xbf, 0x52, 0x09, 0x23, 0x21, 0x48, 0x15, 0x02, 0xc2,
+    0x2a, 0xbf, 0x07, 0xc2, 0x2a, 0xcb, 0x46, 0x06, 0x67, 0xc2, 0x2a, 0xd7,
+    0x04, 0xc2, 0x2a, 0xe3, 0xc5, 0xdb, 0x8c, 0x09, 0x21, 0x61, 0x44, 0x64,
+    0xa6, 0x42, 0x2a, 0xef, 0xc7, 0x08, 0x79, 0x09, 0x23, 0x11, 0xc5, 0xd3,
+    0x5b, 0x09, 0x23, 0x08, 0x47, 0x8d, 0x4d, 0xc2, 0x2a, 0xf7, 0xc5, 0xdd,
+    0x62, 0x09, 0x22, 0xc9, 0x04, 0xc2, 0x2b, 0x03, 0xc3, 0x02, 0x2c, 0x09,
+    0x20, 0x03, 0x02, 0x2b, 0x0f, 0x44, 0x7a, 0x36, 0xc2, 0x2b, 0x15, 0x44,
+    0x64, 0xa6, 0x42, 0x2b, 0x1d, 0x04, 0xc2, 0x2b, 0x25, 0xc3, 0x02, 0x2c,
+    0x09, 0x20, 0x0b, 0x02, 0x2b, 0x34, 0x50, 0x57, 0x72, 0xc2, 0x2b, 0x3a,
+    0x44, 0x7a, 0x36, 0xc2, 0x2b, 0x46, 0x44, 0x64, 0xa6, 0xc2, 0x2b, 0x54,
+    0xc4, 0x04, 0x59, 0x09, 0x20, 0x40, 0xc2, 0x00, 0x11, 0x01, 0x3d, 0x81,
+    0x46, 0x19, 0xbb, 0x42, 0x2b, 0x5c, 0xa1, 0x09, 0x7f, 0x81, 0x9f, 0x09,
+    0x7f, 0x79, 0x9d, 0x09, 0x7f, 0x70, 0xa6, 0x09, 0x7f, 0x69, 0xa5, 0x09,
+    0x7f, 0x61, 0xa4, 0x09, 0x7f, 0x59, 0xa2, 0x09, 0x7f, 0x51, 0xa1, 0x09,
+    0x7f, 0x49, 0xa0, 0x09, 0x7f, 0x41, 0x9f, 0x09, 0x7f, 0x39, 0x9e, 0x09,
+    0x7f, 0x31, 0x9d, 0x09, 0x7f, 0x28, 0xa6, 0x09, 0x7f, 0x21, 0xa5, 0x09,
+    0x7f, 0x19, 0xa4, 0x09, 0x7f, 0x11, 0xa3, 0x09, 0x7f, 0x09, 0xa2, 0x09,
+    0x7f, 0x01, 0xa1, 0x09, 0x7e, 0xf9, 0x9f, 0x09, 0x7e, 0xf1, 0x9e, 0x09,
+    0x7e, 0xe9, 0x9d, 0x09, 0x7e, 0xe0, 0xa6, 0x09, 0x7e, 0xd9, 0xa5, 0x09,
+    0x7e, 0xd1, 0xa4, 0x09, 0x7e, 0xc9, 0xa3, 0x09, 0x7e, 0xc1, 0xa2, 0x09,
+    0x7e, 0xb9, 0xa1, 0x09, 0x7e, 0xb1, 0xa0, 0x09, 0x7e, 0xa9, 0x9f, 0x09,
+    0x7e, 0xa1, 0x9e, 0x09, 0x7e, 0x99, 0x9d, 0x09, 0x7e, 0x90, 0xa6, 0x09,
+    0x7e, 0x89, 0xa5, 0x09, 0x7e, 0x81, 0xa3, 0x09, 0x7e, 0x79, 0xa2, 0x09,
+    0x7e, 0x6b, 0x02, 0x2b, 0x68, 0xa1, 0x09, 0x7e, 0x61, 0xa0, 0x09, 0x7e,
+    0x59, 0x9f, 0x09, 0x7e, 0x51, 0x9e, 0x09, 0x7e, 0x49, 0x9d, 0x09, 0x7e,
+    0x40, 0xa6, 0x09, 0x7e, 0x39, 0xa5, 0x09, 0x7e, 0x31, 0xa4, 0x09, 0x7e,
+    0x29, 0xa3, 0x09, 0x7e, 0x21, 0xa1, 0x09, 0x7e, 0x19, 0xa0, 0x09, 0x7e,
+    0x11, 0x9f, 0x09, 0x7e, 0x09, 0x9e, 0x09, 0x7e, 0x01, 0x9d, 0x09, 0x7d,
+    0xf8, 0xa6, 0x09, 0x7d, 0xf1, 0xa5, 0x09, 0x7d, 0xe9, 0xa3, 0x09, 0x7d,
+    0xe1, 0xa2, 0x09, 0x7d, 0xd9, 0xa1, 0x09, 0x7d, 0xd1, 0xa0, 0x09, 0x7d,
+    0xc9, 0x9f, 0x09, 0x7d, 0xc1, 0x9e, 0x09, 0x7d, 0xb9, 0x9d, 0x09, 0x7d,
+    0xb0, 0xa6, 0x09, 0x7d, 0xa9, 0xa4, 0x09, 0x7d, 0xa1, 0xa3, 0x09, 0x7d,
+    0x99, 0xa1, 0x09, 0x7d, 0x91, 0x9e, 0x09, 0x7d, 0x89, 0x9d, 0x09, 0x7d,
+    0x80, 0xa6, 0x09, 0x7d, 0x79, 0xa5, 0x09, 0x7d, 0x71, 0xa4, 0x09, 0x7d,
+    0x69, 0xa3, 0x09, 0x7d, 0x61, 0xa2, 0x09, 0x7d, 0x59, 0xa1, 0x09, 0x7d,
+    0x51, 0xa0, 0x09, 0x7d, 0x49, 0x9d, 0x09, 0x7d, 0x40, 0xa6, 0x09, 0x7d,
+    0x39, 0xa5, 0x09, 0x7d, 0x31, 0xa4, 0x09, 0x7d, 0x29, 0xa3, 0x09, 0x7d,
+    0x21, 0xa2, 0x09, 0x7d, 0x19, 0xa1, 0x09, 0x7d, 0x11, 0xa0, 0x09, 0x7d,
+    0x09, 0x9e, 0x09, 0x7d, 0x00, 0xa6, 0x09, 0x7c, 0xf9, 0xa4, 0x09, 0x7c,
+    0xf1, 0xa2, 0x09, 0x7c, 0xe9, 0xa0, 0x09, 0x7c, 0xe1, 0x9f, 0x09, 0x7c,
+    0xd3, 0x02, 0x2b, 0x6c, 0x9e, 0x09, 0x7c, 0xc9, 0x9d, 0x09, 0x7c, 0xc0,
+    0xa6, 0x09, 0x7c, 0xb9, 0xa5, 0x09, 0x7c, 0xb1, 0xa4, 0x09, 0x7c, 0xa9,
+    0xa3, 0x09, 0x7c, 0xa1, 0xa2, 0x09, 0x7c, 0x99, 0xa1, 0x09, 0x7c, 0x91,
+    0x9f, 0x09, 0x7c, 0x89, 0x9e, 0x09, 0x7c, 0x80, 0xcb, 0x95, 0x2a, 0x00,
+    0xe4, 0x41, 0x46, 0x00, 0x8b, 0xc2, 0x2b, 0x70, 0x8d, 0x00, 0x23, 0xca,
+    0x02, 0x2b, 0x7a, 0x44, 0x03, 0x15, 0xc2, 0x2b, 0x80, 0xce, 0x73, 0xec,
+    0x00, 0xe4, 0x29, 0x87, 0x00, 0x22, 0x13, 0x02, 0x2b, 0x92, 0x15, 0xc2,
+    0x2b, 0x98, 0xc2, 0x00, 0x28, 0x05, 0x34, 0x69, 0xc3, 0x28, 0x28, 0x05,
+    0x34, 0x98, 0xc6, 0xd0, 0xf7, 0x00, 0xe4, 0x19, 0x87, 0x00, 0x28, 0xe8,
+    0xc7, 0x5b, 0xcd, 0x00, 0xe4, 0x11, 0xca, 0x9c, 0x34, 0x05, 0x32, 0x79,
+    0xc2, 0x1c, 0x52, 0x00, 0x22, 0xd0, 0xcd, 0x7b, 0x2f, 0x00, 0xe4, 0x09,
+    0xc2, 0x00, 0xd0, 0x00, 0x28, 0xa9, 0xc2, 0x1c, 0x52, 0x00, 0x22, 0xc9,
+    0xc9, 0x51, 0x80, 0x00, 0x23, 0x38, 0x44, 0x0d, 0xed, 0xc2, 0x2b, 0xae,
+    0xc2, 0x00, 0xd0, 0x00, 0x28, 0xb9, 0x48, 0x10, 0x2f, 0x42, 0x2b, 0xba,
+    0x8e, 0x00, 0x21, 0xdb, 0x02, 0x2b, 0xd2, 0x90, 0x00, 0x21, 0xeb, 0x02,
+    0x2b, 0xd8, 0xcf, 0x6b, 0x16, 0x00, 0x27, 0x69, 0x8f, 0x00, 0x21, 0xe3,
+    0x02, 0x2b, 0xde, 0x95, 0x00, 0x22, 0x0b, 0x02, 0x2b, 0xe4, 0x94, 0x00,
+    0x22, 0x03, 0x02, 0x2b, 0xea, 0x88, 0x00, 0x22, 0x20, 0xc3, 0x28, 0x28,
+    0x00, 0x29, 0x69, 0x1c, 0xc2, 0x2b, 0xf0, 0x46, 0x00, 0x59, 0xc2, 0x2c,
+    0x07, 0xc2, 0x1c, 0x52, 0x00, 0x22, 0x93, 0x02, 0x2c, 0x11, 0x87, 0x00,
+    0x21, 0xa1, 0xc2, 0x00, 0x28, 0x05, 0x34, 0x08, 0x0a, 0xc2, 0x2c, 0x17,
+    0xc4, 0x74, 0x82, 0x00, 0x26, 0xcb, 0x02, 0x2c, 0x36, 0xc9, 0xb5, 0x06,
+    0x00, 0x25, 0x7b, 0x02, 0x2c, 0x3c, 0xcc, 0x84, 0xbd, 0x00, 0x24, 0x69,
+    0x44, 0x62, 0x60, 0x42, 0x2c, 0x42, 0x87, 0x00, 0x21, 0xfb, 0x02, 0x2c,
+    0x52, 0xc7, 0xbe, 0xab, 0x00, 0x26, 0x79, 0xc2, 0x00, 0xba, 0x00, 0x23,
+    0x88, 0xc7, 0xc1, 0xcb, 0x00, 0x28, 0xf9, 0x49, 0xb1, 0x31, 0xc2, 0x2c,
+    0x58, 0x46, 0x00, 0x8b, 0x42, 0x2c, 0x6d, 0x83, 0x00, 0x22, 0x7b, 0x02,
+    0x2c, 0x79, 0xc3, 0x21, 0x51, 0x00, 0x22, 0x5b, 0x02, 0x2c, 0x81, 0x90,
+    0x05, 0x32, 0xf9, 0x97, 0x00, 0x22, 0x71, 0x8b, 0x00, 0x22, 0xb8, 0x11,
+    0xc2, 0x2c, 0x87, 0xcd, 0x78, 0x09, 0x00, 0x26, 0x61, 0x83, 0x00, 0x21,
+    0xd3, 0x02, 0x2c, 0x93, 0xc2, 0x1c, 0x52, 0x00, 0x22, 0xe1, 0xc2, 0x00,
+    0xba, 0x00, 0x23, 0x78, 0x83, 0x00, 0x22, 0x2b, 0x02, 0x2c, 0x99, 0xc2,
+    0x00, 0x28, 0x05, 0x34, 0xa8, 0xc2, 0x01, 0x7f, 0x00, 0x21, 0x9b, 0x02,
+    0x2c, 0xa5, 0xc2, 0x1c, 0x52, 0x00, 0x22, 0x98, 0x03, 0xc2, 0x2c, 0xab,
+    0xca, 0xa0, 0x44, 0x05, 0x32, 0x69, 0x87, 0x00, 0x21, 0x89, 0xca, 0xa2,
+    0x60, 0x05, 0x32, 0xd9, 0x0b, 0xc2, 0x2c, 0xba, 0xd7, 0x27, 0x46, 0x00,
+    0x22, 0xb0, 0xcf, 0x6b, 0x16, 0x00, 0x27, 0x39, 0xc4, 0x6d, 0xb5, 0x00,
+    0x23, 0x0b, 0x02, 0x2c, 0xc6, 0x96, 0x00, 0x23, 0xf8, 0x46, 0x00, 0x8b,
+    0xc2, 0x2c, 0xcc, 0x87, 0x00, 0x21, 0xab, 0x02, 0x2c, 0xde, 0xc6, 0xcb,
+    0x81, 0x00, 0x23, 0xab, 0x02, 0x2c, 0xe4, 0x91, 0x00, 0x22, 0x8a, 0x02,
+    0x2c, 0xea, 0x87, 0x00, 0x21, 0xbb, 0x02, 0x2c, 0xee, 0x0a, 0x42, 0x2c,
+    0xfa, 0xc2, 0x01, 0x7f, 0x00, 0x22, 0x3b, 0x02, 0x2d, 0x07, 0xc8, 0xb6,
+    0x5a, 0x05, 0x34, 0xd9, 0xd0, 0x51, 0x79, 0x05, 0x32, 0xc9, 0xc3, 0x28,
+    0x28, 0x05, 0x34, 0x38, 0xc8, 0x82, 0x09, 0x05, 0x32, 0x59, 0xc7, 0x7f,
+    0xba, 0x05, 0x33, 0x48, 0x8e, 0x00, 0x20, 0xdb, 0x02, 0x2d, 0x0d, 0x90,
+    0x00, 0x20, 0xeb, 0x02, 0x2d, 0x13, 0xcf, 0x6b, 0x16, 0x00, 0x27, 0x61,
+    0x8f, 0x00, 0x20, 0xe3, 0x02, 0x2d, 0x19, 0x95, 0x00, 0x21, 0x0b, 0x02,
+    0x2d, 0x1f, 0x94, 0x00, 0x21, 0x03, 0x02, 0x2d, 0x25, 0x88, 0x00, 0x21,
+    0x20, 0xc3, 0x28, 0x28, 0x00, 0x29, 0x61, 0x1c, 0xc2, 0x2d, 0x2b, 0x46,
+    0x00, 0x59, 0xc2, 0x2d, 0x42, 0xc2, 0x1c, 0x52, 0x00, 0x20, 0x13, 0x02,
+    0x2d, 0x4c, 0x87, 0x00, 0x20, 0xa1, 0xc2, 0x00, 0x28, 0x05, 0x34, 0x00,
+    0x0a, 0xc2, 0x2d, 0x52, 0xc4, 0x74, 0x82, 0x00, 0x26, 0xc3, 0x02, 0x2d,
+    0x71, 0xc9, 0xb5, 0x06, 0x00, 0x25, 0x73, 0x02, 0x2d, 0x77, 0xcc, 0x84,
+    0xbd, 0x00, 0x24, 0x61, 0x44, 0x62, 0x60, 0x42, 0x2d, 0x7d, 0x87, 0x00,
+    0x20, 0xfb, 0x02, 0x2d, 0x8d, 0xc2, 0x00, 0xba, 0x00, 0x23, 0x80, 0xc7,
+    0xc1, 0xcb, 0x00, 0x28, 0xf1, 0x49, 0xb1, 0x31, 0xc2, 0x2d, 0x93, 0x46,
+    0x00, 0x8b, 0x42, 0x2d, 0xa8, 0x83, 0x00, 0x21, 0x7b, 0x02, 0x2d, 0xb4,
+    0xc3, 0x21, 0x51, 0x00, 0x21, 0x5b, 0x02, 0x2d, 0xbc, 0x8b, 0x00, 0x20,
+    0x39, 0x97, 0x00, 0x21, 0x71, 0x90, 0x05, 0x32, 0xf0, 0xc2, 0x00, 0xd0,
+    0x00, 0x28, 0xb1, 0x48, 0x10, 0x2f, 0xc2, 0x2d, 0xc2, 0xca, 0x9b, 0xd0,
+    0x00, 0x23, 0xd0, 0xc2, 0x00, 0xd0, 0x00, 0x28, 0xa1, 0xc2, 0x1c, 0x52,
+    0x00, 0x20, 0x49, 0xc9, 0x51, 0x80, 0x00, 0x23, 0x30, 0x11, 0xc2, 0x2d,
+    0xda, 0xcd, 0x78, 0x09, 0x00, 0x26, 0x59, 0x83, 0x00, 0x20, 0xd3, 0x02,
+    0x2d, 0xe6, 0xc2, 0x1c, 0x52, 0x00, 0x20, 0x61, 0xc2, 0x00, 0xba, 0x00,
+    0x23, 0x70, 0x83, 0x00, 0x21, 0x2b, 0x02, 0x2d, 0xec, 0xc2, 0x00, 0x28,
+    0x05, 0x34, 0xa0, 0xc2, 0x01, 0x7f, 0x00, 0x20, 0x9b, 0x02, 0x2d, 0xf8,
+    0xc2, 0x1c, 0x52, 0x00, 0x20, 0x18, 0xc2, 0x01, 0x7f, 0x00, 0x21, 0x3b,
+    0x02, 0x2d, 0xfe, 0xc8, 0xb6, 0x5a, 0x05, 0x34, 0xd1, 0xd0, 0x51, 0x79,
+    0x05, 0x32, 0xc1, 0xc3, 0x28, 0x28, 0x05, 0x34, 0x30, 0x46, 0x00, 0x8b,
+    0xc2, 0x2e, 0x04, 0x8d, 0x00, 0x23, 0xc2, 0x02, 0x2e, 0x0e, 0x03, 0xc2,
+    0x2e, 0x14, 0xd7, 0x27, 0x46, 0x00, 0x20, 0x31, 0x87, 0x00, 0x20, 0x89,
+    0xca, 0xa0, 0x44, 0x05, 0x32, 0x61, 0xca, 0xa2, 0x60, 0x05, 0x32, 0xd1,
+    0x0b, 0x42, 0x2e, 0x23, 0xcf, 0x6b, 0x16, 0x00, 0x27, 0x31, 0xc4, 0x6d,
+    0xb5, 0x00, 0x23, 0x03, 0x02, 0x2e, 0x2f, 0x96, 0x00, 0x23, 0xf0, 0x46,
+    0x00, 0x8b, 0xc2, 0x2e, 0x35, 0x87, 0x00, 0x20, 0xab, 0x02, 0x2e, 0x47,
+    0xc6, 0xcb, 0x81, 0x00, 0x23, 0xa3, 0x02, 0x2e, 0x4d, 0x91, 0x00, 0x20,
+    0x0a, 0x02, 0x2e, 0x53, 0x87, 0x00, 0x20, 0xbb, 0x02, 0x2e, 0x57, 0x0a,
+    0x42, 0x2e, 0x63, 0x87, 0x00, 0x21, 0x13, 0x02, 0x2e, 0x70, 0x15, 0xc2,
+    0x2e, 0x76, 0xc2, 0x00, 0x28, 0x05, 0x34, 0x61, 0xc3, 0x28, 0x28, 0x05,
+    0x34, 0x90, 0xc2, 0x1c, 0x52, 0x00, 0x20, 0x51, 0xca, 0x9c, 0x34, 0x05,
+    0x32, 0x70, 0xc8, 0x82, 0x09, 0x05, 0x32, 0x51, 0xc7, 0x7f, 0xba, 0x05,
+    0x33, 0x40, 0xc4, 0x02, 0xde, 0x00, 0x04, 0x79, 0xc2, 0x02, 0xa0, 0x00,
+    0x04, 0x70, 0xe0, 0x06, 0x27, 0x01, 0x01, 0xd0, 0x07, 0xc2, 0x2e, 0x8c,
+    0xd3, 0x3f, 0x70, 0x01, 0x00, 0xd0, 0x44, 0x05, 0x14, 0xc2, 0x2e, 0x92,
+    0xc6, 0x2a, 0xfe, 0x08, 0x8f, 0x91, 0xc6, 0xcf, 0x9b, 0x08, 0x8f, 0x89,
+    0x15, 0xc2, 0x2e, 0x9e, 0x08, 0xc2, 0x2e, 0xaa, 0x16, 0x42, 0x2e, 0xb6,
+    0xc4, 0x26, 0x78, 0x08, 0x8f, 0x49, 0xc5, 0x06, 0xdb, 0x08, 0x8f, 0x41,
+    0x15, 0xc2, 0x2e, 0xc8, 0x08, 0xc2, 0x2e, 0xd4, 0x16, 0xc2, 0x2e, 0xe0,
+    0xc3, 0x05, 0x14, 0x08, 0x8f, 0x08, 0xc9, 0xaf, 0x39, 0x00, 0x6c, 0x11,
+    0xc8, 0xb5, 0x9a, 0x00, 0x6e, 0x50, 0x03, 0xc2, 0x2e, 0xec, 0x0b, 0xc2,
+    0x2f, 0x14, 0x17, 0xc2, 0x2f, 0x2c, 0x07, 0xc2, 0x2f, 0x38, 0x11, 0xc2,
+    0x2f, 0x44, 0x0f, 0xc2, 0x2f, 0x50, 0xd2, 0x4b, 0x05, 0x00, 0x6c, 0xf1,
+    0x48, 0xbb, 0xfa, 0xc2, 0x2f, 0x5a, 0x48, 0xb6, 0x92, 0xc2, 0x2f, 0x6a,
+    0x48, 0xb8, 0xda, 0xc2, 0x2f, 0x76, 0xc7, 0xca, 0x1b, 0x00, 0x6d, 0xd1,
+    0xc7, 0xc5, 0x3d, 0x00, 0x6d, 0xd9, 0xc7, 0xc0, 0x04, 0x00, 0x6e, 0x01,
+    0xc7, 0xc3, 0xc3, 0x00, 0x6e, 0x21, 0xc7, 0xc8, 0x0e, 0x00, 0x6e, 0x30,
+    0xc4, 0x15, 0xe7, 0x00, 0x6f, 0x31, 0xc3, 0x05, 0x14, 0x00, 0x6f, 0x39,
+    0x16, 0xc2, 0x2f, 0x88, 0x08, 0xc2, 0x2f, 0x94, 0x15, 0xc2, 0x2f, 0xa0,
+    0xc5, 0x06, 0xdb, 0x00, 0x6f, 0x71, 0xc4, 0x26, 0x78, 0x00, 0x6f, 0x78,
+    0x45, 0xb0, 0x74, 0xc2, 0x2f, 0xac, 0x44, 0xc8, 0xbe, 0x42, 0x2f, 0xbe,
+    0xca, 0xa7, 0x60, 0x00, 0x6e, 0x89, 0xc8, 0xb7, 0x82, 0x00, 0x6e, 0x99,
+    0xc9, 0xaf, 0x42, 0x00, 0x6e, 0xb1, 0xc7, 0xc8, 0xbd, 0x00, 0x6e, 0xd1,
+    0x42, 0x01, 0x30, 0x42, 0x2f, 0xcd, 0xca, 0x9c, 0xb6, 0x00, 0x6e, 0xc1,
+    0xc9, 0x93, 0x53, 0x00, 0x6e, 0xf8, 0x4a, 0x82, 0xf7, 0xc2, 0x2f, 0xd9,
+    0x02, 0x42, 0x2f, 0xfd, 0xc7, 0x0b, 0xc8, 0x0e, 0xc8, 0x99, 0xc8, 0x3b,
+    0xec, 0x0e, 0xc8, 0x91, 0xc6, 0x24, 0x3b, 0x0e, 0xc8, 0x88, 0x4c, 0x82,
+    0xf5, 0xc2, 0x30, 0x09, 0xc4, 0x09, 0x3a, 0x0e, 0xd3, 0xf0, 0xda, 0x19,
+    0xe2, 0x0e, 0xd3, 0x81, 0x44, 0x01, 0x10, 0x42, 0x30, 0x1d, 0xc8, 0xbe,
+    0x0a, 0x0e, 0xd0, 0x99, 0xc7, 0xc1, 0xb6, 0x0e, 0xd0, 0x91, 0xc7, 0x81,
+    0x92, 0x0e, 0xd0, 0x88, 0xca, 0xa4, 0x5e, 0x0e, 0xd0, 0x43, 0x02, 0x30,
+    0x27, 0xcf, 0x64, 0x2c, 0x0e, 0xd0, 0x38, 0xc3, 0x0d, 0xe5, 0x0e, 0xd4,
+    0x51, 0xc3, 0x0a, 0x8c, 0x0e, 0xd4, 0x38, 0xc6, 0xcf, 0x23, 0x0e, 0xd1,
+    0x61, 0xc7, 0x81, 0x92, 0x0e, 0xd1, 0x59, 0xc6, 0xcc, 0x7d, 0x0e, 0xd1,
+    0x50, 0xd2, 0x4d, 0x9f, 0x0e, 0xd3, 0x89, 0x44, 0x00, 0x7d, 0x42, 0x30,
+    0x2d, 0xd1, 0x57, 0x3f, 0x0e, 0xc9, 0x01, 0x15, 0xc2, 0x30, 0x39, 0x46,
+    0x17, 0x14, 0x42, 0x30, 0x45, 0xc7, 0x0b, 0xc8, 0x0e, 0xc8, 0xa9, 0xc7,
+    0x00, 0x91, 0x0e, 0xc8, 0xa0, 0xc7, 0x0b, 0xc8, 0x0e, 0xc8, 0x69, 0xc8,
+    0x3b, 0xec, 0x0e, 0xc8, 0x61, 0xc6, 0x24, 0x3b, 0x0e, 0xc8, 0x58, 0x00,
+    0xc2, 0x30, 0x51, 0x02, 0x42, 0x30, 0x6f, 0x43, 0x0e, 0xd1, 0xc2, 0x30,
+    0x7b, 0x12, 0x42, 0x30, 0x87, 0x44, 0xdf, 0x47, 0xc2, 0x30, 0x91, 0x45,
+    0xd9, 0x6b, 0xc2, 0x30, 0x9d, 0x44, 0xda, 0xac, 0x42, 0x30, 0xc1, 0xc3,
+    0x1e, 0x1b, 0x0e, 0xd3, 0x0b, 0x02, 0x30, 0xd3, 0x4b, 0x94, 0x64, 0x42,
+    0x30, 0xd7, 0x4b, 0x40, 0xb3, 0xc2, 0x30, 0xe9, 0x4a, 0x18, 0xa5, 0x42,
+    0x30, 0xf5, 0x45, 0xd7, 0x95, 0xc2, 0x31, 0x07, 0x47, 0xc0, 0x90, 0xc2,
+    0x31, 0x13, 0x00, 0xc2, 0x31, 0x25, 0x42, 0x00, 0x97, 0xc2, 0x31, 0x31,
+    0x4f, 0x67, 0x74, 0x42, 0x31, 0x4f, 0xc2, 0x01, 0x29, 0x0e, 0xd3, 0x59,
+    0x43, 0x12, 0x8f, 0x42, 0x31, 0x61, 0x00, 0x42, 0x31, 0x7f, 0x19, 0xc2,
+    0x31, 0x8b, 0xc7, 0xc1, 0xb6, 0x0e, 0xd1, 0x91, 0xc7, 0x81, 0x92, 0x0e,
+    0xd1, 0x88, 0x4b, 0x40, 0xb3, 0xc2, 0x31, 0x97, 0x4a, 0x18, 0xa5, 0xc2,
+    0x31, 0xdd, 0x49, 0x1e, 0x56, 0xc2, 0x32, 0x23, 0x46, 0xd3, 0xd3, 0x42,
+    0x32, 0x35, 0x49, 0xa9, 0x6c, 0xc2, 0x32, 0x47, 0x05, 0xc2, 0x32, 0x53,
+    0xc5, 0xaf, 0xb5, 0x0e, 0xd2, 0x83, 0x02, 0x32, 0x5f, 0xc4, 0x64, 0xa0,
+    0x0e, 0xd2, 0x6b, 0x02, 0x32, 0x63, 0x45, 0x05, 0x75, 0xc2, 0x32, 0x67,
+    0xc5, 0x7d, 0x5e, 0x0e, 0xd2, 0x0b, 0x02, 0x32, 0x8b, 0xc5, 0xa9, 0x3a,
+    0x0e, 0xd1, 0xf2, 0x02, 0x32, 0x8f, 0xc6, 0xd3, 0x3d, 0x0e, 0xd1, 0xd1,
+    0xc6, 0xcf, 0xa7, 0x0e, 0xd1, 0xc8, 0xc7, 0x0b, 0xc8, 0x0e, 0xc8, 0x81,
+    0xc8, 0x3b, 0xec, 0x0e, 0xc8, 0x79, 0xc6, 0x24, 0x3b, 0x0e, 0xc8, 0x70,
+    0xd0, 0x5a, 0x42, 0x0e, 0xd1, 0xc1, 0xc6, 0x03, 0x31, 0x0e, 0xd1, 0xb0,
+    0xd0, 0x5a, 0x42, 0x0e, 0xd1, 0xb9, 0xc7, 0x5b, 0x27, 0x0e, 0xd1, 0xa8,
+    0x48, 0xb8, 0xea, 0xc2, 0x32, 0x93, 0xca, 0xa4, 0x68, 0x0e, 0xd0, 0x79,
+    0xcc, 0x81, 0x8d, 0x0e, 0xd0, 0x70, 0xc7, 0xc0, 0x66, 0x0e, 0xcf, 0xf1,
+    0xd0, 0x5f, 0x72, 0x0e, 0xcf, 0xe9, 0x15, 0xc2, 0x32, 0x9f, 0xc7, 0x38,
+    0xd9, 0x0e, 0xcf, 0xd1, 0xc5, 0xaf, 0xb5, 0x0e, 0xcf, 0xc9, 0xc4, 0xe0,
+    0x43, 0x0e, 0xcf, 0xb9, 0x4a, 0x03, 0xde, 0x42, 0x32, 0xae, 0xca, 0xa3,
+    0x78, 0x08, 0xae, 0xe3, 0x02, 0x32, 0xba, 0x97, 0x08, 0xad, 0xd9, 0x8b,
+    0x08, 0xad, 0xc9, 0x83, 0x08, 0xad, 0x78, 0x94, 0x08, 0xad, 0xa8, 0x97,
+    0x08, 0xad, 0x98, 0x8b, 0x08, 0xad, 0x88, 0xca, 0xa3, 0x78, 0x08, 0xae,
+    0xd9, 0x97, 0x08, 0xac, 0x69, 0x8b, 0x08, 0xac, 0x59, 0x83, 0x08, 0xac,
+    0x08, 0xd5, 0x33, 0x3e, 0x08, 0xae, 0xcb, 0x02, 0x32, 0xbe, 0x0a, 0xc2,
+    0x32, 0xc2, 0x83, 0x08, 0xac, 0xe9, 0x16, 0x42, 0x32, 0xcc, 0x83, 0x08,
+    0xad, 0x69, 0xc2, 0x0d, 0xf6, 0x08, 0xad, 0x61, 0xc2, 0x00, 0xd0, 0x08,
+    0xad, 0x58, 0x83, 0x08, 0xad, 0x51, 0x47, 0xb2, 0x2e, 0x42, 0x32, 0xd6,
+    0xc2, 0x00, 0xd0, 0x08, 0xad, 0x29, 0x83, 0x08, 0xad, 0x20, 0xc2, 0x00,
+    0xd0, 0x08, 0xad, 0x19, 0x83, 0x08, 0xad, 0x10, 0x83, 0x08, 0xad, 0x09,
+    0xc2, 0x00, 0xc1, 0x08, 0xac, 0xe1, 0xc2, 0x19, 0x2c, 0x08, 0xac, 0xb9,
+    0xc2, 0x01, 0x30, 0x08, 0xac, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0xad, 0x01,
+    0x83, 0x08, 0xac, 0xf9, 0x06, 0x42, 0x32, 0xe4, 0xc2, 0x00, 0xd0, 0x08,
+    0xac, 0xb1, 0x83, 0x08, 0xac, 0xa8, 0xc2, 0x00, 0xd0, 0x08, 0xac, 0xa1,
+    0x83, 0x08, 0xac, 0x98, 0xc2, 0x00, 0xd0, 0x08, 0xac, 0x89, 0x83, 0x08,
+    0xac, 0x80, 0xc2, 0x00, 0xd0, 0x08, 0xac, 0x79, 0x83, 0x08, 0xac, 0x70,
+    0x97, 0x08, 0xac, 0x28, 0x8b, 0x08, 0xac, 0x18, 0x4b, 0x94, 0x7a, 0xc2,
+    0x32, 0xee, 0x48, 0x1b, 0x0c, 0x42, 0x32, 0xfd, 0xc7, 0xc3, 0x61, 0x08,
+    0xae, 0x09, 0xc5, 0x33, 0x5d, 0x08, 0xae, 0x01, 0x42, 0x07, 0xb2, 0xc2,
+    0x33, 0x09, 0xc8, 0x14, 0x38, 0x08, 0xad, 0xe9, 0xcb, 0x1e, 0x89, 0x08,
+    0xad, 0xe0, 0xc7, 0xc7, 0x3c, 0x01, 0x39, 0x09, 0xc7, 0x18, 0x68, 0x01,
+    0x16, 0x30, 0xcf, 0x66, 0x66, 0x01, 0x5f, 0x51, 0xd0, 0x5d, 0x52, 0x01,
+    0x5f, 0x58, 0xcc, 0x7e, 0x49, 0x00, 0x04, 0x31, 0xc5, 0x0d, 0x5c, 0x00,
+    0x04, 0xc0, 0xc4, 0x1e, 0x97, 0x05, 0x46, 0x21, 0xc5, 0x40, 0xe7, 0x05,
+    0x44, 0x08, 0x97, 0x05, 0x46, 0x19, 0x8b, 0x05, 0x46, 0x01, 0x83, 0x05,
+    0x45, 0xa8, 0x91, 0x05, 0x46, 0x10, 0x87, 0x05, 0x45, 0xf8, 0x8e, 0x05,
+    0x45, 0xe3, 0x02, 0x33, 0x15, 0x94, 0x05, 0x45, 0xd2, 0x02, 0x33, 0x19,
+    0x8b, 0x05, 0x45, 0xb8, 0x97, 0x05, 0x45, 0xc8, 0xc2, 0x0d, 0xf6, 0x05,
+    0x45, 0x81, 0x83, 0x05, 0x45, 0x89, 0xc2, 0x00, 0xd0, 0x05, 0x45, 0x78,
+    0xc2, 0x00, 0xdb, 0x05, 0x45, 0x99, 0x83, 0x05, 0x45, 0x68, 0x83, 0x05,
+    0x44, 0x19, 0x8b, 0x05, 0x44, 0x71, 0x97, 0x05, 0x44, 0x88, 0x8b, 0x05,
+    0x44, 0x28, 0x97, 0x05, 0x44, 0x38, 0x47, 0xb2, 0x2e, 0xc2, 0x33, 0x1d,
+    0x83, 0x05, 0x45, 0x70, 0x87, 0x05, 0x44, 0x68, 0x91, 0x05, 0x44, 0x80,
+    0x83, 0x05, 0x44, 0x91, 0xc2, 0x00, 0xd0, 0x05, 0x44, 0x98, 0x83, 0x05,
+    0x44, 0xa1, 0xc2, 0x00, 0xd0, 0x05, 0x44, 0xa8, 0xc2, 0x01, 0x30, 0x05,
+    0x44, 0xb1, 0xc2, 0x19, 0x2c, 0x05, 0x44, 0xd9, 0xc2, 0x00, 0xc1, 0x05,
+    0x45, 0x01, 0x83, 0x05, 0x45, 0x28, 0x83, 0x05, 0x44, 0xb9, 0xc2, 0x00,
+    0xd0, 0x05, 0x44, 0xc0, 0x83, 0x05, 0x44, 0xc9, 0xc2, 0x00, 0xd0, 0x05,
+    0x44, 0xd0, 0x16, 0xc2, 0x33, 0x2b, 0x83, 0x05, 0x45, 0x09, 0xc2, 0x00,
+    0xd0, 0x05, 0x45, 0x10, 0x06, 0xc2, 0x33, 0x35, 0x83, 0x05, 0x45, 0x19,
+    0xc2, 0x00, 0xd0, 0x05, 0x45, 0x20, 0x83, 0x05, 0x45, 0x31, 0xc2, 0x00,
+    0xd0, 0x05, 0x45, 0x38, 0x83, 0x05, 0x45, 0x41, 0xc2, 0x00, 0xd0, 0x05,
+    0x45, 0x48, 0xc4, 0x15, 0xe7, 0x05, 0x46, 0x81, 0xc3, 0x05, 0x14, 0x05,
+    0x46, 0x89, 0x16, 0xc2, 0x33, 0x3f, 0x08, 0xc2, 0x33, 0x4b, 0x15, 0xc2,
+    0x33, 0x57, 0xc5, 0x06, 0xdb, 0x05, 0x46, 0xc1, 0xc4, 0x26, 0x78, 0x05,
+    0x46, 0xc8, 0xdd, 0x0a, 0x8a, 0x0f, 0xb3, 0xb9, 0x44, 0x05, 0x9e, 0x42,
+    0x33, 0x63, 0xe0, 0x0b, 0x27, 0x0f, 0xb3, 0xc0, 0xc4, 0xe3, 0xf3, 0x00,
+    0x41, 0xf1, 0xc3, 0x0d, 0xe8, 0x00, 0x41, 0x90, 0xc5, 0xd8, 0xe4, 0x00,
+    0x40, 0xb8, 0x83, 0x00, 0x40, 0xf0, 0x83, 0x00, 0x40, 0xf8, 0xd0, 0x5f,
+    0xc2, 0x01, 0x54, 0xb8, 0xd0, 0x5f, 0xc2, 0x01, 0x54, 0xc0, 0x07, 0xc2,
+    0x33, 0x69, 0x44, 0x00, 0xbb, 0xc2, 0x33, 0x75, 0xc9, 0xb0, 0x98, 0x08,
+    0x8e, 0x69, 0xca, 0xa0, 0x26, 0x08, 0x8e, 0x48, 0xc3, 0xad, 0x77, 0x08,
+    0x8e, 0xd1, 0xd5, 0x34, 0x64, 0x08, 0x8e, 0x60, 0x45, 0x09, 0x98, 0xc2,
+    0x33, 0xa3, 0xcb, 0x97, 0xf5, 0x08, 0x8e, 0x31, 0xc4, 0x19, 0x53, 0x08,
+    0x8e, 0x28, 0x45, 0x00, 0xba, 0xc2, 0x33, 0xc7, 0xcd, 0x7b, 0xbe, 0x08,
+    0x8e, 0x58, 0xc2, 0x00, 0xd0, 0x08, 0x8d, 0x91, 0x15, 0xc2, 0x33, 0xed,
+    0x18, 0xc2, 0x33, 0xfd, 0x0e, 0xc2, 0x34, 0x07, 0xc2, 0x00, 0x39, 0x08,
+    0x8d, 0x59, 0xc2, 0x19, 0x2c, 0x08, 0x8d, 0x51, 0xc2, 0x01, 0xc3, 0x08,
+    0x8d, 0x49, 0x04, 0xc2, 0x34, 0x11, 0x12, 0xc2, 0x34, 0x1b, 0x10, 0xc2,
+    0x34, 0x25, 0x06, 0xc2, 0x34, 0x3b, 0x16, 0xc2, 0x34, 0x49, 0x0c, 0xc2,
+    0x34, 0x57, 0x05, 0xc2, 0x34, 0x61, 0x09, 0xc2, 0x34, 0x6b, 0x0d, 0xc2,
+    0x34, 0x75, 0x83, 0x08, 0x8c, 0x1b, 0x02, 0x34, 0x7f, 0x91, 0x08, 0x8c,
+    0x79, 0x87, 0x08, 0x8c, 0x69, 0x97, 0x08, 0x8c, 0x3b, 0x02, 0x34, 0x8b,
+    0x8b, 0x08, 0x8c, 0x2a, 0x02, 0x34, 0x8f, 0xc2, 0x01, 0xbb, 0x08, 0x22,
+    0x89, 0x0a, 0x42, 0x34, 0x93, 0x91, 0x08, 0x22, 0xa9, 0xc3, 0x14, 0xc8,
+    0x08, 0x22, 0xb0, 0x83, 0x08, 0x22, 0xc1, 0x99, 0x08, 0x23, 0xf8, 0xc3,
+    0x38, 0x86, 0x08, 0x22, 0xc9, 0xc4, 0xe2, 0x3b, 0x08, 0x23, 0x18, 0xc6,
+    0x14, 0xc5, 0x08, 0x23, 0x01, 0xc3, 0x03, 0x4e, 0x08, 0x23, 0x28, 0x87,
+    0x08, 0x23, 0x11, 0xc2, 0x00, 0x95, 0x08, 0x23, 0x58, 0x88, 0x08, 0x23,
+    0x31, 0xc2, 0x00, 0x89, 0x08, 0x23, 0x91, 0xc2, 0x00, 0xd1, 0x08, 0x23,
+    0xf0, 0xc2, 0x0f, 0xf5, 0x08, 0x23, 0x39, 0x03, 0xc2, 0x34, 0x9f, 0xc2,
+    0x01, 0xa3, 0x08, 0x23, 0xd8, 0xc2, 0x01, 0xe2, 0x08, 0x23, 0x41, 0xc2,
+    0x00, 0x58, 0x08, 0x23, 0x49, 0x8a, 0x08, 0x23, 0x69, 0xc2, 0x09, 0x3b,
+    0x08, 0x23, 0x89, 0xc2, 0x00, 0x28, 0x08, 0x23, 0xb9, 0x14, 0xc2, 0x34,
+    0xa7, 0xc2, 0x01, 0x29, 0x08, 0x23, 0xd0, 0x90, 0x08, 0x23, 0x51, 0xc2,
+    0x00, 0xa4, 0x08, 0x23, 0x61, 0xc2, 0x06, 0x4e, 0x08, 0x23, 0xa1, 0xc3,
+    0x0a, 0xe1, 0x08, 0x23, 0xa9, 0xc2, 0x00, 0x71, 0x08, 0x23, 0xb1, 0x94,
+    0x08, 0x23, 0xc8, 0xe0, 0x09, 0xe7, 0x01, 0x4a, 0x20, 0xcd, 0x80, 0x6a,
+    0x01, 0x57, 0x38, 0x00, 0x42, 0x34, 0xb1, 0xd6, 0x2e, 0x54, 0x01, 0x5a,
+    0x79, 0x4c, 0x81, 0xa5, 0x42, 0x34, 0xbd, 0x00, 0x42, 0x34, 0xc3, 0xc3,
+    0xe5, 0x8a, 0x0f, 0xb3, 0x09, 0xc9, 0xb4, 0x91, 0x0f, 0xb2, 0xc9, 0xc4,
+    0x47, 0x23, 0x0f, 0xb2, 0x88, 0xc7, 0x10, 0x9c, 0x01, 0x5b, 0xc8, 0x00,
+    0x42, 0x34, 0xcf, 0xc3, 0xe5, 0x8a, 0x0f, 0xb3, 0x19, 0xc9, 0xb4, 0x91,
+    0x0f, 0xb2, 0xd9, 0xc4, 0x47, 0x23, 0x0f, 0xb2, 0x98, 0xc7, 0x10, 0x9c,
+    0x01, 0x5b, 0xc0, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0x49, 0x83, 0x08, 0xd3,
+    0x40, 0xc2, 0x00, 0xd0, 0x08, 0xd3, 0xb1, 0x83, 0x08, 0xd3, 0xa8, 0xc2,
+    0x00, 0xd0, 0x08, 0xd3, 0x39, 0x83, 0x08, 0xd3, 0x30, 0x8e, 0x08, 0xd2,
+    0xd1, 0x94, 0x08, 0xd2, 0xc8, 0x97, 0x08, 0xd2, 0xc1, 0x8b, 0x08, 0xd2,
+    0xb8, 0x87, 0x08, 0xd2, 0xb0, 0x87, 0x08, 0xd2, 0x90, 0xca, 0x50, 0x5e,
+    0x08, 0x7a, 0xb0, 0xc3, 0x77, 0x79, 0x08, 0x79, 0xf9, 0xc4, 0xdc, 0x2d,
+    0x08, 0x79, 0xe0, 0xc5, 0xcf, 0xae, 0x0f, 0xbc, 0xb1, 0xc2, 0x00, 0x45,
+    0x01, 0x99, 0x39, 0xc2, 0xd4, 0x88, 0x01, 0x9c, 0xa0, 0x11, 0xc2, 0x34,
+    0xe7, 0x8f, 0x01, 0x9c, 0xc8, 0x44, 0x00, 0x8d, 0xc2, 0x34, 0xf3, 0xc4,
+    0x89, 0x91, 0x01, 0x9a, 0xb9, 0x84, 0x01, 0x9e, 0xe8, 0x11, 0xc2, 0x35,
+    0x2d, 0xd5, 0x32, 0x2d, 0x01, 0x56, 0x69, 0x8f, 0x01, 0x9e, 0x81, 0x90,
+    0x01, 0x9e, 0x89, 0x9a, 0x01, 0x9e, 0x98, 0xca, 0x27, 0xba, 0x01, 0x14,
+    0x83, 0x02, 0x35, 0x37, 0xc3, 0x67, 0x21, 0x01, 0x98, 0x49, 0xc3, 0x14,
+    0x47, 0x01, 0x98, 0x51, 0x98, 0x01, 0x9b, 0xa8, 0xc7, 0x3c, 0x51, 0x01,
+    0x14, 0x7b, 0x02, 0x35, 0x3d, 0x90, 0x01, 0x9e, 0x63, 0x02, 0x35, 0x43,
+    0x97, 0x01, 0x9b, 0xd0, 0xc2, 0x02, 0xae, 0x01, 0x14, 0xa1, 0x03, 0xc2,
+    0x35, 0x4f, 0x85, 0x01, 0x9e, 0x21, 0x86, 0x01, 0x9e, 0x29, 0xc8, 0xb5,
+    0x42, 0x01, 0x9e, 0x31, 0x91, 0x01, 0x9e, 0x3b, 0x02, 0x35, 0x57, 0x8f,
+    0x01, 0x9c, 0xea, 0x02, 0x35, 0x5d, 0xc3, 0x65, 0xba, 0x01, 0x10, 0xd1,
+    0x0b, 0xc2, 0x35, 0x61, 0x17, 0xc2, 0x35, 0x73, 0x07, 0xc2, 0x35, 0x7f,
+    0xc2, 0x01, 0x9d, 0x01, 0x9d, 0x6a, 0x02, 0x35, 0x8b, 0xcc, 0x86, 0xc1,
+    0x0f, 0x90, 0x01, 0x89, 0x01, 0x96, 0x61, 0x83, 0x01, 0x9e, 0x53, 0x02,
+    0x35, 0x94, 0x17, 0xc2, 0x35, 0x9a, 0x07, 0xc2, 0x35, 0xac, 0x11, 0xc2,
+    0x35, 0xb8, 0x92, 0x01, 0x9e, 0x5b, 0x02, 0x35, 0xc0, 0x9c, 0x01, 0x9c,
+    0x80, 0x8c, 0x0f, 0x8c, 0x81, 0x83, 0x01, 0x9b, 0x93, 0x02, 0x35, 0xc4,
+    0xc3, 0x13, 0x6e, 0x01, 0x99, 0x29, 0xc3, 0x27, 0x49, 0x01, 0x99, 0x31,
+    0x84, 0x01, 0x9e, 0x41, 0x8f, 0x01, 0x9b, 0xbb, 0x02, 0x35, 0xca, 0x8e,
+    0x01, 0x9c, 0xb8, 0x11, 0xc2, 0x35, 0xce, 0x83, 0x01, 0x9d, 0x4b, 0x02,
+    0x35, 0xe0, 0x0b, 0xc2, 0x35, 0xea, 0x07, 0xc2, 0x35, 0xf4, 0x8a, 0x01,
+    0x9e, 0xb9, 0x8f, 0x01, 0x9e, 0xc1, 0xc2, 0x4c, 0x90, 0x01, 0x9e, 0xc9,
+    0x94, 0x01, 0x9e, 0xd1, 0x85, 0x01, 0x9b, 0xb1, 0x88, 0x01, 0x9c, 0x51,
+    0x95, 0x01, 0x9d, 0x81, 0x98, 0x01, 0x9d, 0xa1, 0x99, 0x01, 0x9d, 0xd0,
+    0x14, 0xc2, 0x36, 0x04, 0x98, 0x01, 0x96, 0x71, 0xc7, 0xc5, 0x6e, 0x01,
+    0x98, 0x39, 0xc4, 0x90, 0x43, 0x01, 0x98, 0x40, 0xc5, 0xd4, 0x07, 0x01,
+    0x98, 0x01, 0xc5, 0xdc, 0xa4, 0x01, 0x98, 0x09, 0xc4, 0xe4, 0x4f, 0x01,
+    0x98, 0x11, 0xc3, 0x3d, 0x51, 0x01, 0x98, 0x19, 0x97, 0x01, 0x9b, 0x99,
+    0x8f, 0x01, 0x9e, 0x11, 0xc7, 0x23, 0x58, 0x01, 0x9e, 0xf8, 0x83, 0x01,
+    0x9c, 0x23, 0x02, 0x36, 0x0e, 0xc5, 0xd9, 0x0c, 0x01, 0x98, 0x91, 0xc3,
+    0x1a, 0x05, 0x01, 0x98, 0xa3, 0x02, 0x36, 0x18, 0x42, 0x00, 0x33, 0xc2,
+    0x36, 0x2a, 0xc4, 0x2b, 0x09, 0x01, 0x98, 0xe1, 0x11, 0xc2, 0x36, 0x36,
+    0x89, 0x01, 0x9c, 0x79, 0x8d, 0x01, 0x9e, 0x69, 0x8f, 0x01, 0x9c, 0xf3,
+    0x02, 0x36, 0x42, 0x96, 0x01, 0x9e, 0x79, 0x84, 0x01, 0x9c, 0x29, 0xc3,
+    0x00, 0x64, 0x01, 0x9c, 0x49, 0xc2, 0xd4, 0x88, 0x01, 0x9c, 0x89, 0x8e,
+    0x01, 0x9c, 0xc1, 0xc2, 0x00, 0xb0, 0x01, 0x9d, 0x51, 0x98, 0x01, 0x9d,
+    0xc1, 0x99, 0x01, 0x9d, 0xf1, 0xc4, 0xe3, 0xb3, 0x01, 0x9e, 0x00, 0x03,
+    0xc2, 0x36, 0x46, 0x0b, 0xc2, 0x36, 0x56, 0xc5, 0xd2, 0x2a, 0x01, 0x98,
+    0xc3, 0x02, 0x36, 0x68, 0x9b, 0x01, 0x9e, 0x49, 0x84, 0x01, 0x9c, 0x39,
+    0xc2, 0xd4, 0x88, 0x01, 0x9c, 0x99, 0xc2, 0x00, 0xb0, 0x01, 0x9d, 0x60,
+    0x03, 0xc2, 0x36, 0x6e, 0xc6, 0xd3, 0x31, 0x01, 0x99, 0x09, 0x43, 0x00,
+    0xc4, 0xc2, 0x36, 0x7a, 0x94, 0x01, 0x9e, 0xd9, 0x98, 0x01, 0x9e, 0xe0,
+    0x83, 0x01, 0x9c, 0x0b, 0x02, 0x36, 0x82, 0xc4, 0x07, 0x9b, 0x01, 0x99,
+    0x49, 0x88, 0x01, 0x9c, 0x59, 0x8f, 0x01, 0x9c, 0xd1, 0x95, 0x01, 0x9d,
+    0x89, 0x98, 0x01, 0x9d, 0xa9, 0x99, 0x01, 0x9d, 0xd8, 0x03, 0xc2, 0x36,
+    0x88, 0xc3, 0xcd, 0xc8, 0x01, 0x99, 0x89, 0xc7, 0xc6, 0x86, 0x01, 0x99,
+    0xa1, 0xc4, 0xe2, 0xdb, 0x01, 0x99, 0xe1, 0xc5, 0xde, 0x07, 0x01, 0x99,
+    0xf1, 0x93, 0x01, 0x9e, 0x18, 0x83, 0x01, 0x9c, 0x1b, 0x02, 0x36, 0x92,
+    0x0b, 0xc2, 0x36, 0xa8, 0x07, 0xc2, 0x36, 0xbb, 0x42, 0x03, 0x53, 0xc2,
+    0x36, 0xca, 0x89, 0x01, 0x9c, 0x71, 0x00, 0xc2, 0x36, 0xea, 0x84, 0x01,
+    0x9c, 0x33, 0x02, 0x36, 0xfa, 0xc2, 0x00, 0x95, 0x01, 0x9e, 0xb1, 0xc2,
+    0xd4, 0x88, 0x01, 0x9c, 0x91, 0x8e, 0x01, 0x9c, 0xb1, 0x8f, 0x01, 0x9c,
+    0xe3, 0x02, 0x37, 0x00, 0xc2, 0x00, 0xb0, 0x01, 0x9d, 0x59, 0x95, 0x01,
+    0x9d, 0x99, 0x98, 0x01, 0x9d, 0xbb, 0x02, 0x37, 0x04, 0x99, 0x01, 0x9d,
+    0xea, 0x02, 0x37, 0x0a, 0x42, 0x04, 0xc6, 0xc2, 0x37, 0x10, 0xc3, 0x93,
+    0x9b, 0x01, 0x9a, 0x80, 0x11, 0xc2, 0x37, 0x1c, 0x45, 0x0b, 0x12, 0x42,
+    0x37, 0x28, 0xc6, 0x13, 0x52, 0x01, 0x36, 0xe9, 0xc2, 0x00, 0xa6, 0x0f,
+    0x8d, 0x51, 0xc6, 0xd2, 0x1d, 0x0f, 0x8d, 0x19, 0x07, 0xc2, 0x37, 0x34,
+    0xc2, 0x07, 0xa3, 0x0f, 0x8c, 0xc1, 0xc5, 0x0b, 0x0a, 0x01, 0x4e, 0x41,
+    0xcb, 0x12, 0x2e, 0x01, 0x4e, 0x39, 0x86, 0x0f, 0x8a, 0x61, 0x95, 0x0f,
+    0x8a, 0x68, 0xc2, 0x17, 0x28, 0x01, 0x35, 0xf9, 0x48, 0xbc, 0xc2, 0x42,
+    0x37, 0x40, 0xc4, 0x03, 0x4e, 0x01, 0x15, 0x01, 0x19, 0xc2, 0x37, 0x52,
+    0xc6, 0x02, 0xde, 0x0f, 0x8c, 0xd8, 0xc4, 0x1d, 0x1e, 0x01, 0x14, 0xf9,
+    0x98, 0x0f, 0x8a, 0x58, 0xc3, 0x25, 0xd6, 0x01, 0x14, 0xf1, 0xc2, 0x52,
+    0xdc, 0x0f, 0x8a, 0x70, 0x55, 0x30, 0x23, 0xc2, 0x37, 0x5e, 0xc3, 0x8d,
+    0x08, 0x0f, 0x8c, 0x91, 0x8e, 0x0f, 0x8c, 0x88, 0xc2, 0x00, 0x6c, 0x0f,
+    0x8d, 0x61, 0x95, 0x0f, 0x8c, 0xd0, 0xc2, 0x7e, 0x61, 0x0f, 0x8d, 0x59,
+    0xd7, 0x28, 0xcd, 0x0f, 0x8c, 0xc8, 0xc5, 0xd8, 0x62, 0x0f, 0x8d, 0x41,
+    0xc2, 0x02, 0xbc, 0x0f, 0x8d, 0x39, 0x98, 0x0f, 0x8a, 0x51, 0x85, 0x0f,
+    0x8d, 0x30, 0xd3, 0x40, 0x54, 0x0f, 0x8d, 0x21, 0x8d, 0x0f, 0x8c, 0xb8,
+    0xcd, 0x77, 0x60, 0x0f, 0x8d, 0x01, 0x44, 0x09, 0x9e, 0xc2, 0x37, 0x78,
+    0xc3, 0x02, 0xdf, 0x0f, 0x8c, 0x99, 0xd5, 0x35, 0x0c, 0x01, 0x4e, 0x28,
+    0x89, 0x0f, 0x8c, 0xb1, 0xc2, 0x04, 0xe6, 0x0f, 0x8c, 0xa8, 0xc9, 0x2a,
+    0xec, 0x01, 0x21, 0x30, 0xc2, 0x00, 0x74, 0x01, 0x20, 0x79, 0xc3, 0x00,
+    0xa3, 0x01, 0x20, 0x70, 0xc4, 0x27, 0xe3, 0x01, 0x20, 0x11, 0xc7, 0xc3,
+    0x92, 0x01, 0x20, 0x08, 0xc4, 0x6e, 0x67, 0x01, 0x21, 0x0b, 0x02, 0x37,
+    0x82, 0x4d, 0x7e, 0xd7, 0x42, 0x37, 0x88, 0xc5, 0xd5, 0xc4, 0x01, 0x21,
+    0x21, 0xd2, 0x49, 0x43, 0x01, 0x20, 0xa8, 0x45, 0x0a, 0x11, 0xc2, 0x37,
+    0x98, 0xc5, 0xd6, 0x0f, 0x01, 0x20, 0x28, 0x49, 0xb3, 0xd4, 0xc2, 0x37,
+    0xa2, 0xc2, 0x03, 0x4e, 0x00, 0x39, 0x08, 0x46, 0xcd, 0xbb, 0x42, 0x37,
+    0xca, 0xc2, 0x39, 0x8b, 0x00, 0x39, 0x61, 0xc3, 0x1e, 0x1b, 0x00, 0x38,
+    0xda, 0x02, 0x37, 0xdc, 0xc3, 0x11, 0xef, 0x00, 0x39, 0x59, 0xc4, 0x77,
+    0x78, 0x00, 0x39, 0x41, 0xc6, 0x7e, 0x1b, 0x00, 0x39, 0x19, 0xd0, 0x58,
+    0x42, 0x00, 0x38, 0x89, 0x47, 0xc9, 0x57, 0x42, 0x37, 0xe2, 0xc3, 0x04,
+    0x5a, 0x00, 0x39, 0x51, 0xca, 0x9d, 0xc4, 0x00, 0x39, 0x38, 0xc3, 0x11,
+    0x38, 0x00, 0x38, 0xf0, 0xc2, 0x00, 0x8e, 0x00, 0x38, 0xd0, 0xd2, 0x49,
+    0x79, 0x00, 0x38, 0xb1, 0xc5, 0x49, 0x81, 0x00, 0x38, 0xa8, 0xc9, 0xad,
+    0xa4, 0x00, 0x38, 0xa0, 0x00, 0xc2, 0x37, 0xf4, 0xcd, 0x75, 0x7f, 0x00,
+    0x39, 0xe0, 0xca, 0xa1, 0x02, 0x00, 0x38, 0x69, 0xc9, 0xaa, 0x71, 0x00,
+    0x38, 0x61, 0xc6, 0xaa, 0x74, 0x00, 0x38, 0x58, 0xc5, 0x05, 0x02, 0x00,
+    0x39, 0xb9, 0xc5, 0x00, 0xd4, 0x00, 0x39, 0xb0, 0xc5, 0x00, 0x2c, 0x00,
+    0x38, 0x39, 0xc4, 0x00, 0x49, 0x00, 0x38, 0x30, 0xc5, 0x33, 0x24, 0x00,
+    0x38, 0x23, 0x02, 0x38, 0x00, 0xc9, 0x11, 0xf6, 0x00, 0x38, 0x10, 0xc5,
+    0x33, 0x24, 0x00, 0x38, 0x1b, 0x02, 0x38, 0x06, 0xc9, 0x11, 0xf6, 0x00,
+    0x38, 0x08, 0xc5, 0x00, 0xd4, 0x00, 0x39, 0xe9, 0xc5, 0x05, 0x02, 0x00,
+    0x39, 0xf0, 0xc5, 0x00, 0xd4, 0x00, 0x3a, 0x19, 0xc5, 0x05, 0x02, 0x00,
+    0x3a, 0x20, 0xc5, 0x00, 0xd4, 0x00, 0x3a, 0x29, 0xc5, 0x05, 0x02, 0x00,
+    0x3a, 0x30, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x89, 0x91, 0x05, 0x40, 0x80,
+    0x91, 0x05, 0x40, 0x91, 0xc2, 0x01, 0x23, 0x05, 0x40, 0x98, 0xd1, 0x52,
+    0xff, 0x0f, 0xa8, 0x51, 0xce, 0x6f, 0x1c, 0x0f, 0xa8, 0x49, 0xd3, 0x23,
+    0xc8, 0x0f, 0xa8, 0x38, 0x00, 0x42, 0x38, 0x0c, 0xcf, 0x09, 0xf8, 0x01,
+    0x4b, 0xd9, 0x42, 0x06, 0x62, 0x42, 0x38, 0x21, 0xc3, 0x02, 0xa3, 0x01,
+    0x55, 0xf1, 0xcf, 0x60, 0xf3, 0x01, 0x56, 0x01, 0xd9, 0x1f, 0x18, 0x01,
+    0x56, 0x10, 0xc6, 0x0e, 0xa4, 0x01, 0x56, 0xb9, 0xde, 0x0e, 0x8c, 0x01,
+    0x56, 0xc0, 0x52, 0x47, 0xdb, 0xc2, 0x38, 0x2d, 0xcf, 0x1d, 0xed, 0x01,
+    0x03, 0xe8, 0xca, 0x0e, 0xbe, 0x01, 0x03, 0xe1, 0xc4, 0x00, 0x2d, 0x01,
+    0x03, 0xc0, 0xc4, 0x18, 0x10, 0x01, 0x03, 0xb9, 0xc2, 0x22, 0xcc, 0x01,
+    0x03, 0xb0, 0xc3, 0x0d, 0x14, 0x01, 0x03, 0xa9, 0xc3, 0x09, 0x9e, 0x01,
+    0x03, 0xa0, 0xc2, 0x02, 0xa0, 0x00, 0x05, 0x91, 0xc4, 0x02, 0xde, 0x00,
+    0x05, 0x98, 0xc6, 0xca, 0xf7, 0x00, 0xe6, 0x11, 0xc7, 0xc6, 0x2b, 0x00,
+    0xe6, 0x08, 0x45, 0x21, 0xed, 0xc2, 0x38, 0x35, 0x83, 0x00, 0xdc, 0xb0,
+    0xc2, 0x00, 0xd0, 0x00, 0xdd, 0xe9, 0x83, 0x00, 0xdc, 0xc0, 0xc2, 0x2c,
+    0x43, 0x00, 0xdd, 0xe1, 0x83, 0x00, 0xdc, 0xe0, 0xc2, 0x2c, 0x43, 0x00,
+    0xdd, 0xd9, 0x83, 0x00, 0xdc, 0xd8, 0xc2, 0x19, 0x2c, 0x00, 0xdd, 0x79,
+    0x83, 0x00, 0xdc, 0xf0, 0xc2, 0x00, 0xd0, 0x00, 0xdd, 0x71, 0x83, 0x00,
+    0xdc, 0x50, 0x83, 0x00, 0xdc, 0xa1, 0xc2, 0x19, 0x2c, 0x00, 0xdc, 0x89,
+    0xc2, 0x01, 0x30, 0x00, 0xdc, 0x68, 0x97, 0x00, 0xdc, 0x48, 0x87, 0x00,
+    0xdc, 0x30, 0xc4, 0x18, 0x10, 0x00, 0xdd, 0xb9, 0xc2, 0x22, 0xcc, 0x00,
+    0xdd, 0xb0, 0xc3, 0x0d, 0x14, 0x00, 0xdd, 0xa9, 0xc3, 0x09, 0x9e, 0x00,
+    0xdd, 0xa0, 0xc4, 0x02, 0xde, 0x00, 0xdd, 0x99, 0xc2, 0x02, 0xa0, 0x00,
+    0xdd, 0x90, 0xc2, 0x01, 0x4a, 0x00, 0xdd, 0x69, 0xc2, 0x01, 0xc3, 0x00,
+    0xdd, 0x60, 0xc3, 0xd7, 0xd6, 0x00, 0xdd, 0x19, 0xc4, 0x89, 0x32, 0x00,
+    0xdd, 0x10, 0xc5, 0xdb, 0xc3, 0x00, 0xdd, 0x51, 0x10, 0x42, 0x38, 0x3d,
+    0xc7, 0xc6, 0x08, 0x00, 0xdd, 0x49, 0xc5, 0x0d, 0xe4, 0x00, 0xdd, 0x39,
+    0xc7, 0xc3, 0xbc, 0x00, 0xdd, 0x31, 0xc4, 0xde, 0xff, 0x00, 0xdd, 0x29,
+    0xc5, 0xd8, 0x9e, 0x00, 0xdd, 0x20, 0xcb, 0x0e, 0xbd, 0x01, 0x55, 0x81,
+    0xcc, 0x24, 0x47, 0x01, 0x55, 0x90, 0xc8, 0x07, 0x5f, 0x01, 0x55, 0xb1,
+    0xcf, 0x6a, 0x8f, 0x01, 0x55, 0xd0, 0xd1, 0x55, 0x52, 0x01, 0x14, 0x51,
+    0xcb, 0x23, 0xa0, 0x01, 0x14, 0x33, 0x02, 0x38, 0x47, 0x46, 0x00, 0xd4,
+    0x42, 0x38, 0x4d, 0xc6, 0x2d, 0xd0, 0x01, 0x56, 0x99, 0xc4, 0x0e, 0xa6,
+    0x01, 0x56, 0xa8, 0xca, 0x22, 0x09, 0x0f, 0xb0, 0x1b, 0x02, 0x38, 0x65,
+    0x0a, 0xc2, 0x38, 0x6b, 0x15, 0xc2, 0x38, 0x7d, 0xc4, 0x21, 0x23, 0x0f,
+    0xcb, 0x90, 0xca, 0x22, 0x09, 0x0f, 0xb1, 0xd1, 0xd1, 0x55, 0x0e, 0x0f,
+    0xb1, 0xd8, 0x47, 0xc2, 0x11, 0xc2, 0x38, 0x8c, 0x42, 0x0a, 0x8c, 0xc2,
+    0x38, 0x98, 0xc3, 0x0d, 0xe5, 0x07, 0xf2, 0xa8, 0xc9, 0x81, 0x9c, 0x01,
+    0x10, 0x53, 0x02, 0x38, 0xa2, 0xcf, 0x0f, 0x0a, 0x07, 0xf2, 0xb9, 0xc6,
+    0xbc, 0x34, 0x07, 0xf2, 0xc1, 0xca, 0x0e, 0xbe, 0x07, 0xf3, 0x30, 0x4d,
+    0x78, 0x7e, 0xc2, 0x38, 0xa8, 0x45, 0x00, 0x2d, 0xc2, 0x38, 0xc7, 0xce,
+    0x61, 0xd5, 0x07, 0xf3, 0x40, 0xe0, 0x05, 0x07, 0x08, 0x59, 0xd9, 0xc4,
+    0x1e, 0xc9, 0x00, 0x16, 0xe0, 0xc7, 0x2e, 0x21, 0x0f, 0xb7, 0x49, 0xc8,
+    0x36, 0x21, 0x07, 0xf3, 0x01, 0xc7, 0x0b, 0x00, 0x07, 0xf3, 0x08, 0x43,
+    0x00, 0x4b, 0xc2, 0x38, 0xd9, 0xcc, 0x8b, 0x11, 0x07, 0xf3, 0x20, 0xc8,
+    0x60, 0xf4, 0x07, 0xf3, 0x11, 0xcb, 0x8e, 0x13, 0x07, 0xf3, 0x50, 0x9f,
+    0x00, 0x04, 0x91, 0x9e, 0x00, 0x04, 0x88, 0xc3, 0x02, 0x9f, 0x00, 0x04,
+    0x91, 0xc3, 0x05, 0x14, 0x00, 0x04, 0x88, 0xc5, 0xd7, 0xa4, 0x0f, 0xad,
+    0xb0, 0xca, 0x37, 0x4e, 0x01, 0x13, 0xf1, 0xc5, 0x07, 0x62, 0x01, 0x13,
+    0xe0, 0x4c, 0x24, 0x3b, 0xc2, 0x38, 0xeb, 0xcb, 0x0e, 0xbd, 0x01, 0x55,
+    0x99, 0x44, 0x1f, 0xb2, 0xc2, 0x38, 0xf7, 0xcf, 0x6a, 0x8f, 0x01, 0x55,
+    0xb8, 0xc3, 0x0d, 0xe5, 0x07, 0xf0, 0x99, 0xc3, 0x0a, 0x8c, 0x07, 0xf0,
+    0x80, 0xcf, 0x0f, 0x0a, 0x07, 0xf0, 0xa9, 0xc6, 0xbc, 0x34, 0x07, 0xf1,
+    0x89, 0xc6, 0xcb, 0x5d, 0x07, 0xf1, 0x90, 0x44, 0x00, 0x4a, 0xc2, 0x39,
+    0x03, 0xc7, 0x80, 0x2f, 0x07, 0xf1, 0x98, 0xcb, 0x1a, 0x50, 0x07, 0xf1,
+    0xb1, 0x05, 0xc2, 0x39, 0x31, 0xd6, 0x08, 0x88, 0x07, 0xf1, 0xd1, 0xd8,
+    0x21, 0x83, 0x07, 0xf1, 0xe1, 0xd4, 0x38, 0xf4, 0x07, 0xf1, 0xf1, 0xce,
+    0x25, 0xad, 0x07, 0xf2, 0x41, 0x46, 0x01, 0xfc, 0xc2, 0x39, 0x3d, 0xcd,
+    0x0b, 0x91, 0x07, 0xf2, 0x00, 0xc5, 0x0a, 0x8a, 0x07, 0xf0, 0x89, 0xc9,
+    0x11, 0xf6, 0x07, 0xf0, 0x90, 0xc3, 0x00, 0x3a, 0x0f, 0x85, 0x01, 0xca,
+    0xa6, 0x98, 0x0f, 0x86, 0x78, 0xc6, 0xcf, 0x05, 0x0f, 0x85, 0x09, 0xc6,
+    0x78, 0x78, 0x0f, 0x85, 0x89, 0xc8, 0xba, 0x2a, 0x0f, 0x86, 0x09, 0xc5,
+    0xdd, 0x49, 0x0f, 0x86, 0x88, 0x46, 0xd2, 0xe9, 0xc2, 0x39, 0x49, 0x48,
+    0xbe, 0x4a, 0xc2, 0x39, 0x61, 0x46, 0xa8, 0xfa, 0xc2, 0x39, 0x79, 0x45,
+    0xdc, 0xf9, 0x42, 0x39, 0x91, 0x11, 0xc2, 0x39, 0xbb, 0x47, 0xc7, 0x2e,
+    0x42, 0x39, 0xc7, 0x46, 0xd1, 0xf9, 0xc2, 0x39, 0xdf, 0x48, 0xb5, 0x32,
+    0x42, 0x39, 0xf7, 0xc6, 0xcf, 0x05, 0x0f, 0x85, 0x41, 0xc6, 0x78, 0x78,
+    0x0f, 0x85, 0xc1, 0xc8, 0xba, 0x2a, 0x0f, 0x86, 0x41, 0xc5, 0xdd, 0x49,
+    0x0f, 0x86, 0xc0, 0xc6, 0xcf, 0x05, 0x0f, 0x85, 0x49, 0xc6, 0x78, 0x78,
+    0x0f, 0x85, 0xc9, 0xc8, 0xba, 0x2a, 0x0f, 0x86, 0x49, 0xc5, 0xdd, 0x49,
+    0x0f, 0x86, 0xc8, 0xc6, 0xcf, 0x05, 0x0f, 0x85, 0x59, 0xc6, 0x78, 0x78,
+    0x0f, 0x85, 0xd9, 0xc8, 0xba, 0x2a, 0x0f, 0x86, 0x59, 0xc5, 0xdd, 0x49,
+    0x0f, 0x86, 0xd8, 0x49, 0xae, 0x46, 0xc2, 0x3a, 0x0f, 0x47, 0x35, 0xce,
+    0x42, 0x3a, 0x27, 0xc6, 0xcf, 0x05, 0x0f, 0x85, 0x69, 0xc6, 0x78, 0x78,
+    0x0f, 0x85, 0xe9, 0xc8, 0xba, 0x2a, 0x0f, 0x86, 0x69, 0xc5, 0xdd, 0x49,
+    0x0f, 0x86, 0xe8, 0xc2, 0x02, 0xa0, 0x01, 0x5e, 0x99, 0xc4, 0x02, 0xde,
+    0x01, 0x5e, 0xa0, 0xc3, 0x09, 0x9e, 0x01, 0x5e, 0xa9, 0xc3, 0x0d, 0x14,
+    0x01, 0x5e, 0xb0, 0x43, 0x03, 0x35, 0xc2, 0x3a, 0x3f, 0x45, 0x00, 0x8c,
+    0xc2, 0x3a, 0x51, 0xd1, 0x0e, 0xb7, 0x01, 0x53, 0x90, 0xcb, 0x90, 0xe9,
+    0x0f, 0xae, 0xf9, 0xc3, 0x00, 0x33, 0x0f, 0xa6, 0x18, 0x45, 0x02, 0x6d,
+    0xc2, 0x3a, 0x6d, 0xcc, 0x43, 0x07, 0x01, 0x10, 0x10, 0x9c, 0x01, 0x25,
+    0xa9, 0x9b, 0x01, 0x25, 0xa1, 0x9a, 0x01, 0x25, 0x99, 0x99, 0x01, 0x25,
+    0x91, 0x98, 0x01, 0x25, 0x89, 0x97, 0x01, 0x25, 0x81, 0x96, 0x01, 0x25,
+    0x79, 0x95, 0x01, 0x25, 0x71, 0x94, 0x01, 0x25, 0x69, 0x93, 0x01, 0x25,
+    0x61, 0x92, 0x01, 0x25, 0x59, 0x91, 0x01, 0x25, 0x51, 0x90, 0x01, 0x25,
+    0x49, 0x8f, 0x01, 0x25, 0x41, 0x8e, 0x01, 0x25, 0x39, 0x8d, 0x01, 0x25,
+    0x31, 0x8c, 0x01, 0x25, 0x29, 0x8b, 0x01, 0x25, 0x21, 0x8a, 0x01, 0x25,
+    0x19, 0x89, 0x01, 0x25, 0x11, 0x88, 0x01, 0x25, 0x09, 0x87, 0x01, 0x25,
+    0x01, 0x86, 0x01, 0x24, 0xf9, 0x85, 0x01, 0x24, 0xf1, 0x84, 0x01, 0x24,
+    0xe9, 0x83, 0x01, 0x24, 0xe0, 0x99, 0x0f, 0x89, 0x31, 0x9a, 0x0f, 0x89,
+    0x39, 0x9b, 0x0f, 0x89, 0x41, 0x9c, 0x0f, 0x89, 0x49, 0x83, 0x0f, 0x88,
+    0x81, 0x84, 0x0f, 0x88, 0x89, 0x85, 0x0f, 0x88, 0x91, 0x86, 0x0f, 0x88,
+    0x99, 0x87, 0x0f, 0x88, 0xa1, 0x88, 0x0f, 0x88, 0xa9, 0x89, 0x0f, 0x88,
+    0xb1, 0x8a, 0x0f, 0x88, 0xb9, 0x8b, 0x0f, 0x88, 0xc1, 0x8c, 0x0f, 0x88,
+    0xc9, 0x8d, 0x0f, 0x88, 0xd1, 0x8e, 0x0f, 0x88, 0xd9, 0x8f, 0x0f, 0x88,
+    0xe1, 0x90, 0x0f, 0x88, 0xe9, 0x91, 0x0f, 0x88, 0xf1, 0x92, 0x0f, 0x88,
+    0xf9, 0x93, 0x0f, 0x89, 0x01, 0x94, 0x0f, 0x89, 0x09, 0x95, 0x0f, 0x89,
+    0x11, 0x96, 0x0f, 0x89, 0x19, 0x97, 0x0f, 0x89, 0x21, 0x98, 0x0f, 0x89,
+    0x28, 0x42, 0x00, 0x28, 0xc2, 0x3a, 0x85, 0xc7, 0x52, 0xcc, 0x01, 0x24,
+    0x01, 0xc2, 0x00, 0xc4, 0x01, 0x23, 0xe8, 0xc7, 0x1f, 0x6e, 0x01, 0x24,
+    0x29, 0xc5, 0x66, 0xb1, 0x01, 0x23, 0xf0, 0xc8, 0x48, 0x23, 0x01, 0x24,
+    0x21, 0xc6, 0x44, 0x9c, 0x01, 0x24, 0x18, 0xc6, 0x14, 0x07, 0x01, 0x24,
+    0x11, 0xc7, 0x34, 0x37, 0x01, 0x24, 0x08, 0xc4, 0x18, 0x10, 0x01, 0x23,
+    0xd1, 0xc2, 0x22, 0xcc, 0x01, 0x23, 0xc8, 0xc3, 0x0d, 0x14, 0x01, 0x23,
+    0xc1, 0xc3, 0x09, 0x9e, 0x01, 0x23, 0xb8, 0xc4, 0x02, 0xde, 0x01, 0x23,
+    0xb1, 0xc2, 0x02, 0xa0, 0x01, 0x23, 0xa8, 0xc5, 0x8e, 0xdf, 0x01, 0x90,
+    0x03, 0x02, 0x3a, 0x91, 0xc6, 0xbb, 0xec, 0x01, 0x90, 0x52, 0x02, 0x3a,
+    0x97, 0xc2, 0x00, 0xd3, 0x01, 0x90, 0x78, 0xc5, 0xc0, 0x7d, 0x01, 0x90,
+    0x13, 0x02, 0x3a, 0x9d, 0xc6, 0xc1, 0x86, 0x01, 0x90, 0x5a, 0x02, 0x3a,
+    0xa3, 0xc2, 0x00, 0xd3, 0x01, 0x90, 0x88, 0xc2, 0x00, 0xd3, 0x01, 0x90,
+    0x90, 0xc4, 0x79, 0xf3, 0x01, 0x90, 0x2b, 0x02, 0x3a, 0xa9, 0xc6, 0xba,
+    0x7c, 0x01, 0x90, 0x62, 0x02, 0x3a, 0xaf, 0xc2, 0x00, 0xd3, 0x01, 0x90,
+    0xa0, 0xc2, 0x00, 0xd3, 0x01, 0x90, 0xa8, 0xc4, 0xc6, 0x7a, 0x01, 0x90,
+    0x43, 0x02, 0x3a, 0xb5, 0xc6, 0xc6, 0x79, 0x01, 0x90, 0x4a, 0x02, 0x3a,
+    0xb9, 0xc2, 0x00, 0xd3, 0x01, 0x90, 0xd8, 0xc2, 0x02, 0xa0, 0x01, 0x91,
+    0x09, 0xc4, 0x02, 0xde, 0x01, 0x91, 0x11, 0xc2, 0x00, 0xc4, 0x01, 0x91,
+    0x48, 0xc3, 0x09, 0x9e, 0x01, 0x91, 0x19, 0x0b, 0xc2, 0x3a, 0xbf, 0xc7,
+    0xc8, 0x9a, 0x01, 0x92, 0x00, 0xc2, 0x22, 0xcc, 0x01, 0x91, 0x29, 0x07,
+    0xc2, 0x3a, 0xd1, 0x17, 0xc2, 0x3a, 0xdd, 0x16, 0xc2, 0x3a, 0xe7, 0xc6,
+    0xcc, 0xbf, 0x01, 0x91, 0x99, 0xc6, 0xca, 0xe5, 0x01, 0x91, 0xa8, 0xc4,
+    0x00, 0x2d, 0x01, 0x91, 0x39, 0xc4, 0x61, 0xc1, 0x01, 0x91, 0x79, 0xc9,
+    0xaf, 0x8a, 0x01, 0x91, 0xe8, 0xc3, 0x02, 0x6e, 0x01, 0x91, 0x41, 0xc3,
+    0x00, 0xc2, 0x01, 0x91, 0xa0, 0xc3, 0x01, 0x54, 0x01, 0x91, 0x51, 0xc4,
+    0x04, 0x87, 0x01, 0x91, 0x70, 0xc4, 0x03, 0xd7, 0x01, 0x91, 0x61, 0xc3,
+    0x29, 0x82, 0x01, 0x91, 0x68, 0xcd, 0x7b, 0x3c, 0x01, 0x91, 0xb9, 0xc3,
+    0x03, 0x15, 0x01, 0x91, 0xd0, 0xc7, 0x75, 0x78, 0x01, 0x91, 0xc9, 0x15,
+    0xc2, 0x3a, 0xf3, 0xc3, 0x29, 0x43, 0x01, 0x92, 0x18, 0xd1, 0x01, 0x68,
+    0x01, 0x57, 0x91, 0xce, 0x33, 0x92, 0x01, 0x57, 0x98, 0xc5, 0x26, 0xf7,
+    0x08, 0xd7, 0xb9, 0xc4, 0x0d, 0xe5, 0x08, 0xd7, 0x9a, 0x02, 0x3a, 0xfd,
+    0x45, 0x21, 0xed, 0xc2, 0x3b, 0x03, 0x83, 0x08, 0xd6, 0x98, 0x83, 0x08,
+    0xd6, 0xd8, 0x83, 0x08, 0xd6, 0xd0, 0xc2, 0x00, 0xd0, 0x08, 0xd6, 0xa1,
+    0x83, 0x08, 0xd6, 0x68, 0xc2, 0x00, 0xd0, 0x08, 0xd6, 0x89, 0x83, 0x08,
+    0xd6, 0x00, 0x83, 0x08, 0xd6, 0x81, 0xc2, 0x01, 0x30, 0x08, 0xd6, 0x38,
+    0xc2, 0x00, 0xd0, 0x08, 0xd6, 0x79, 0x83, 0x08, 0xd6, 0x70, 0xc2, 0x00,
+    0xd0, 0x08, 0xd6, 0x51, 0x83, 0x08, 0xd6, 0x08, 0xc5, 0x26, 0xf7, 0x08,
+    0xd7, 0x71, 0xc4, 0x0d, 0xe5, 0x08, 0xd7, 0x5a, 0x02, 0x3b, 0x26, 0xc6,
+    0x26, 0xf6, 0x08, 0xd7, 0x40, 0x16, 0xc2, 0x3b, 0x2c, 0x08, 0xc2, 0x3b,
+    0x3c, 0xc3, 0x05, 0x14, 0x08, 0x43, 0xc8, 0xd3, 0x42, 0xb4, 0x08, 0x43,
+    0xb9, 0x45, 0x02, 0x10, 0x42, 0x3b, 0x48, 0xc2, 0xbe, 0xd3, 0x0b, 0x5c,
+    0x79, 0xc2, 0x19, 0x2d, 0x0b, 0x5c, 0x50, 0xc2, 0x24, 0x82, 0x0b, 0x5c,
+    0x71, 0xc3, 0xa4, 0xa3, 0x0b, 0x5c, 0x41, 0xc2, 0x01, 0x24, 0x0b, 0x5c,
+    0x10, 0x15, 0xc2, 0x3b, 0xb1, 0xc3, 0xe5, 0xcc, 0x0b, 0x5c, 0x28, 0xc2,
+    0x19, 0x2d, 0x0b, 0x5c, 0x61, 0xc3, 0xe0, 0x95, 0x0b, 0x5b, 0xf0, 0x8f,
+    0x0b, 0x5c, 0x49, 0xc2, 0xbe, 0xd3, 0x0b, 0x5c, 0x18, 0xc3, 0xe5, 0x33,
+    0x0b, 0x5c, 0x01, 0xc2, 0x00, 0xfa, 0x0b, 0x5b, 0xf8, 0xc2, 0x20, 0xec,
+    0x0b, 0x59, 0x79, 0xc3, 0xa6, 0x62, 0x0b, 0x59, 0x38, 0xc2, 0x20, 0xec,
+    0x0b, 0x59, 0x61, 0x16, 0xc2, 0x3b, 0xc3, 0xc4, 0xe3, 0x17, 0x0b, 0x59,
+    0x41, 0xc3, 0xdb, 0xb7, 0x0b, 0x59, 0x11, 0xc3, 0x20, 0xeb, 0x0b, 0x59,
+    0x00, 0xc3, 0x57, 0x0c, 0x0b, 0x59, 0x49, 0xc3, 0x20, 0xeb, 0x0b, 0x59,
+    0x29, 0xc2, 0x20, 0xec, 0x0b, 0x58, 0xf8, 0xc3, 0xe6, 0x53, 0x0b, 0x5b,
+    0xa3, 0x02, 0x3b, 0xcf, 0xc7, 0xbf, 0xe1, 0x0b, 0x5a, 0x28, 0xca, 0xa7,
+    0x6a, 0x0b, 0x5b, 0x99, 0xc4, 0x12, 0xc1, 0x0b, 0x59, 0xc8, 0xc5, 0xd5,
+    0x51, 0x0b, 0x5b, 0x71, 0xc4, 0xdf, 0x2f, 0x0b, 0x5a, 0x08, 0xc2, 0x01,
+    0x24, 0x0b, 0x5b, 0x21, 0x44, 0x19, 0x61, 0x42, 0x3b, 0xd5, 0x0a, 0xc2,
+    0x3b, 0xed, 0xc9, 0xa8, 0x82, 0x0b, 0x59, 0xc0, 0x00, 0xc2, 0x3b, 0xf9,
+    0x95, 0x0b, 0x5a, 0xd8, 0x98, 0x0b, 0x58, 0xd9, 0x84, 0x0b, 0x58, 0xd0,
+    0x98, 0x0b, 0x58, 0x79, 0x84, 0x0b, 0x58, 0x70, 0x98, 0x0b, 0x58, 0x59,
+    0x84, 0x0b, 0x58, 0x50, 0x98, 0x0b, 0x58, 0x29, 0x84, 0x0b, 0x58, 0x20,
+    0x98, 0x0b, 0x58, 0xa9, 0x84, 0x0b, 0x58, 0xa0, 0x98, 0x0b, 0x58, 0x69,
+    0x84, 0x0b, 0x58, 0x60, 0x98, 0x0b, 0x58, 0x89, 0x84, 0x0b, 0x58, 0x80,
+    0x98, 0x0b, 0x58, 0x09, 0x84, 0x0b, 0x58, 0x00, 0xc5, 0x11, 0x55, 0x01,
+    0x81, 0x00, 0x45, 0x00, 0x8c, 0xc2, 0x3c, 0x05, 0xc8, 0x7d, 0x5e, 0x0f,
+    0xb2, 0x69, 0x14, 0xc2, 0x3c, 0x21, 0xcd, 0x80, 0x5d, 0x0f, 0xb2, 0x39,
+    0xcf, 0x63, 0x78, 0x0f, 0xc9, 0xc1, 0x43, 0x03, 0x35, 0xc2, 0x3c, 0x27,
+    0xc8, 0xb5, 0xb2, 0x0f, 0xce, 0xb8, 0xc4, 0x02, 0xde, 0x08, 0x48, 0xd9,
+    0x19, 0xc2, 0x3c, 0x33, 0xc2, 0x00, 0xc4, 0x08, 0x48, 0xb8, 0xc8, 0x0d,
+    0x03, 0x08, 0x48, 0xc8, 0xc2, 0x20, 0xec, 0x08, 0x48, 0xa9, 0xc2, 0x00,
+    0x3d, 0x08, 0x48, 0x40, 0xc3, 0x11, 0xef, 0x08, 0x48, 0xa1, 0xc3, 0x01,
+    0x9d, 0x08, 0x48, 0x89, 0xc3, 0x7e, 0x1b, 0x08, 0x48, 0x70, 0xc2, 0x00,
+    0x74, 0x08, 0x48, 0x79, 0xc2, 0x01, 0xd0, 0x08, 0x48, 0x00, 0x96, 0x08,
+    0x48, 0x38, 0x83, 0x05, 0x42, 0x01, 0xc2, 0x00, 0xd0, 0x05, 0x42, 0x08,
+    0x83, 0x05, 0x42, 0x11, 0xc2, 0x01, 0x30, 0x05, 0x43, 0x28, 0xc2, 0x01,
+    0x30, 0x05, 0x42, 0x19, 0xc2, 0x19, 0x2c, 0x05, 0x42, 0x39, 0x83, 0x05,
+    0x42, 0x59, 0xc2, 0x00, 0xc1, 0x05, 0x43, 0x60, 0x83, 0x05, 0x42, 0x23,
+    0x02, 0x3c, 0x3d, 0xc2, 0x00, 0xd0, 0x05, 0x42, 0x28, 0x83, 0x05, 0x42,
+    0x41, 0xc2, 0x00, 0xd0, 0x05, 0x42, 0x49, 0x15, 0xc2, 0x3c, 0x43, 0x16,
+    0x42, 0x3c, 0x4d, 0x83, 0x05, 0x42, 0x51, 0xc2, 0x02, 0x1c, 0x05, 0x42,
+    0x91, 0xc2, 0x0e, 0x9a, 0x05, 0x43, 0x58, 0x83, 0x05, 0x42, 0x61, 0xc2,
+    0x00, 0xd0, 0x05, 0x42, 0x68, 0xc2, 0x00, 0xd0, 0x05, 0x42, 0xa1, 0x83,
+    0x05, 0x42, 0xa8, 0xc6, 0x24, 0x9c, 0x05, 0x42, 0xb1, 0xc2, 0x00, 0xd0,
+    0x05, 0x42, 0xd1, 0x83, 0x05, 0x42, 0xd8, 0xcb, 0x91, 0xf1, 0x05, 0x43,
+    0x69, 0xcb, 0x8f, 0xaa, 0x05, 0x43, 0x80, 0x87, 0x05, 0x43, 0x30, 0xc8,
+    0xbc, 0x12, 0x05, 0x43, 0x71, 0xc4, 0x0c, 0x2b, 0x05, 0x43, 0x78, 0x4f,
+    0x5c, 0xf3, 0xc2, 0x3c, 0x57, 0xd2, 0x47, 0xc9, 0x05, 0x43, 0x90, 0xc9,
+    0xb4, 0xf4, 0x08, 0x0e, 0x89, 0xc8, 0xbf, 0x22, 0x08, 0x0f, 0x90, 0xc5,
+    0x61, 0xba, 0x08, 0x0e, 0x99, 0xcd, 0x76, 0x1b, 0x08, 0x0f, 0x11, 0x96,
+    0x08, 0x0f, 0x60, 0xc2, 0x00, 0x50, 0x08, 0x0f, 0x23, 0x02, 0x3c, 0x69,
+    0xc4, 0xe4, 0x9f, 0x08, 0x0f, 0x30, 0x99, 0x08, 0x0e, 0xd1, 0xc7, 0xc9,
+    0xce, 0x08, 0x0f, 0x08, 0xc4, 0xd3, 0x73, 0x08, 0x0f, 0x38, 0xc3, 0x19,
+    0x78, 0x08, 0x0e, 0xd9, 0x92, 0x08, 0x0f, 0x40, 0xc8, 0x74, 0xc4, 0x00,
+    0x4a, 0x91, 0xc6, 0x74, 0xc6, 0x00, 0x4a, 0x88, 0x42, 0x07, 0xb2, 0xc2,
+    0x3c, 0x6f, 0x03, 0xc2, 0x3c, 0x7b, 0xc5, 0x33, 0x5d, 0x00, 0x49, 0xe1,
+    0xcb, 0x1e, 0x89, 0x00, 0x48, 0x0b, 0x02, 0x3c, 0x87, 0xd4, 0x39, 0xa8,
+    0x00, 0x48, 0x01, 0x15, 0xc2, 0x3c, 0x8b, 0xc8, 0xbe, 0xca, 0x05, 0x47,
+    0xc1, 0xd9, 0x1e, 0x82, 0x05, 0x47, 0xa1, 0xd0, 0x5a, 0x12, 0x00, 0x4b,
+    0x88, 0x99, 0x00, 0x4a, 0x79, 0x97, 0x00, 0x4a, 0x61, 0x8b, 0x00, 0x4a,
+    0x41, 0x83, 0x00, 0x49, 0xf1, 0x9b, 0x05, 0x47, 0xf8, 0xc2, 0x49, 0x0c,
+    0x00, 0x49, 0xd9, 0x87, 0x00, 0x49, 0xd0, 0x91, 0x00, 0x4a, 0x51, 0x87,
+    0x00, 0x4a, 0x30, 0x91, 0x00, 0x4a, 0x49, 0x87, 0x00, 0x4a, 0x29, 0xc6,
+    0xcf, 0x2f, 0x00, 0x4a, 0xa8, 0x94, 0x00, 0x4a, 0x1b, 0x02, 0x3c, 0x97,
+    0x8e, 0x00, 0x4b, 0x12, 0x02, 0x3c, 0x9b, 0x97, 0x00, 0x4a, 0x13, 0x02,
+    0x3c, 0x9f, 0x87, 0x00, 0x4a, 0xb0, 0x8b, 0x00, 0x4a, 0x00, 0x83, 0x00,
+    0x49, 0xc9, 0xc7, 0xc4, 0xb1, 0x00, 0x4b, 0xd0, 0x83, 0x00, 0x49, 0xc1,
+    0xc2, 0x0d, 0xf6, 0x00, 0x49, 0xb9, 0x0a, 0x42, 0x3c, 0xa3, 0x83, 0x00,
+    0x49, 0xa9, 0x47, 0xb2, 0x2e, 0x42, 0x3c, 0xad, 0x0e, 0xc2, 0x3c, 0xbb,
+    0x83, 0x00, 0x49, 0x90, 0xc2, 0x00, 0x39, 0x00, 0x49, 0x89, 0x83, 0x00,
+    0x49, 0x81, 0xc2, 0x00, 0xd0, 0x00, 0x4a, 0xe8, 0x83, 0x00, 0x49, 0x79,
+    0xc2, 0x19, 0x2c, 0x00, 0x4a, 0xf8, 0xc9, 0xad, 0x53, 0x00, 0x4b, 0xc0,
+    0xc2, 0x00, 0xd0, 0x00, 0x49, 0x69, 0x83, 0x00, 0x49, 0x61, 0xc2, 0x01,
+    0x5d, 0x00, 0x4b, 0xf8, 0xc2, 0x00, 0xd0, 0x00, 0x49, 0x59, 0x83, 0x00,
+    0x49, 0x50, 0x10, 0xc2, 0x3c, 0xc5, 0x83, 0x00, 0x49, 0x41, 0xc2, 0x19,
+    0x2c, 0x00, 0x48, 0xf1, 0xc2, 0x01, 0x30, 0x00, 0x48, 0xc8, 0xc2, 0x00,
+    0xd0, 0x00, 0x49, 0x39, 0x83, 0x00, 0x49, 0x31, 0x06, 0x42, 0x3c, 0xcf,
+    0xc2, 0x00, 0xd0, 0x00, 0x49, 0x29, 0x83, 0x00, 0x49, 0x21, 0x16, 0x42,
+    0x3c, 0xdd, 0xc2, 0x00, 0xd0, 0x00, 0x48, 0xe9, 0x83, 0x00, 0x48, 0xe1,
+    0xc2, 0x25, 0x3b, 0x00, 0x4b, 0xe0, 0xc2, 0x00, 0xd0, 0x00, 0x48, 0xd9,
+    0x83, 0x00, 0x48, 0xd2, 0x02, 0x3c, 0xe7, 0x0a, 0xc2, 0x3c, 0xed, 0x83,
+    0x00, 0x48, 0xb9, 0xc2, 0x01, 0x30, 0x00, 0x4b, 0xd9, 0xcb, 0x23, 0x34,
+    0x00, 0x4b, 0xe8, 0x0a, 0xc2, 0x3c, 0xf7, 0x83, 0x00, 0x48, 0xa8, 0x97,
+    0x00, 0x48, 0xa1, 0x8b, 0x00, 0x48, 0x81, 0x83, 0x00, 0x48, 0x31, 0x9b,
+    0x05, 0x47, 0xf1, 0x99, 0x00, 0x4b, 0xa8, 0x87, 0x00, 0x4b, 0x99, 0xc2,
+    0x49, 0x0c, 0x00, 0x4b, 0xa0, 0x97, 0x00, 0x48, 0x53, 0x02, 0x3d, 0x01,
+    0x87, 0x00, 0x4b, 0xb0, 0x8b, 0x00, 0x48, 0x40, 0x83, 0x00, 0x4a, 0xd9,
+    0xc2, 0x00, 0xd0, 0x00, 0x4b, 0xc8, 0xc4, 0x26, 0x78, 0x00, 0x4b, 0x79,
+    0xc5, 0x06, 0xdb, 0x00, 0x4b, 0x71, 0x15, 0xc2, 0x3d, 0x05, 0x08, 0xc2,
+    0x3d, 0x11, 0x16, 0xc2, 0x3d, 0x1d, 0xc3, 0x05, 0x14, 0x00, 0x4b, 0x39,
+    0xc4, 0x15, 0xe7, 0x00, 0x4b, 0x30, 0x45, 0x2c, 0x86, 0xc2, 0x3d, 0x29,
+    0x46, 0x2e, 0xee, 0xc2, 0x3d, 0x3f, 0xc2, 0x0c, 0x42, 0x08, 0x20, 0x61,
+    0x11, 0xc2, 0x3d, 0x55, 0xc2, 0x14, 0x68, 0x08, 0x20, 0x71, 0xc3, 0x17,
+    0x29, 0x08, 0x20, 0x79, 0x8a, 0x08, 0x20, 0x81, 0xc3, 0x6f, 0xb7, 0x08,
+    0x20, 0x89, 0xc3, 0xb2, 0x36, 0x08, 0x20, 0x91, 0x16, 0xc2, 0x3d, 0x5d,
+    0xc3, 0x80, 0x64, 0x08, 0x20, 0xa1, 0xc4, 0x46, 0xfd, 0x08, 0x20, 0xa9,
+    0xc3, 0x30, 0xc1, 0x08, 0x20, 0xb1, 0xc3, 0x72, 0xc8, 0x08, 0x20, 0xb9,
+    0xc3, 0x93, 0x51, 0x08, 0x20, 0xc1, 0x07, 0xc2, 0x3d, 0x69, 0xc3, 0x0a,
+    0x85, 0x08, 0x20, 0xd1, 0x1c, 0x42, 0x3d, 0x91, 0x45, 0x2c, 0x86, 0xc2,
+    0x3d, 0x9d, 0x46, 0x2e, 0xee, 0xc2, 0x3d, 0xb3, 0xc2, 0x0c, 0x42, 0x08,
+    0x21, 0xa1, 0x11, 0xc2, 0x3d, 0xc9, 0xc2, 0x14, 0x68, 0x08, 0x21, 0xb1,
+    0xc3, 0x17, 0x29, 0x08, 0x21, 0xb9, 0x8a, 0x08, 0x21, 0xc1, 0xc3, 0x6f,
+    0xb7, 0x08, 0x21, 0xc9, 0xc3, 0xb2, 0x36, 0x08, 0x21, 0xd1, 0x16, 0xc2,
+    0x3d, 0xd1, 0xc3, 0x80, 0x64, 0x08, 0x21, 0xe1, 0xc4, 0x46, 0xfd, 0x08,
+    0x21, 0xe9, 0xc3, 0x30, 0xc1, 0x08, 0x21, 0xf1, 0xc3, 0x72, 0xc8, 0x08,
+    0x21, 0xf9, 0xc3, 0x93, 0x51, 0x08, 0x22, 0x01, 0x07, 0xc2, 0x3d, 0xdd,
+    0xc3, 0x0a, 0x85, 0x08, 0x22, 0x11, 0x1c, 0x42, 0x3e, 0x05, 0xc4, 0x00,
+    0x49, 0x01, 0x1e, 0x61, 0xc5, 0x00, 0x2c, 0x01, 0x1d, 0xf8, 0xc4, 0x00,
+    0x49, 0x01, 0x1e, 0x59, 0xc5, 0x00, 0x2c, 0x01, 0x1d, 0xf0, 0xc4, 0x8f,
+    0x73, 0x0e, 0x98, 0x21, 0xc5, 0x73, 0xcb, 0x0e, 0x98, 0x18, 0xc9, 0x11,
+    0xf6, 0x01, 0x24, 0x81, 0xc5, 0x0a, 0x8a, 0x0f, 0x88, 0x50, 0xc9, 0x11,
+    0xf6, 0x01, 0x24, 0x79, 0xc5, 0x0a, 0x8a, 0x0f, 0x88, 0x48, 0x00, 0x42,
+    0x3e, 0x11, 0x00, 0x42, 0x3e, 0x1d, 0x00, 0x42, 0x3e, 0x29, 0x00, 0x42,
+    0x3e, 0x35, 0x00, 0x42, 0x3e, 0x41, 0x00, 0x42, 0x3e, 0x4d, 0xc9, 0x11,
+    0xf6, 0x01, 0x24, 0x41, 0xc5, 0x0a, 0x8a, 0x0f, 0x88, 0x10, 0xc9, 0x11,
+    0xf6, 0x0f, 0x88, 0x01, 0xc5, 0x0a, 0x8a, 0x0f, 0x88, 0x08, 0xc4, 0x26,
+    0x78, 0x08, 0xca, 0xc9, 0xc5, 0x06, 0xdb, 0x08, 0xca, 0xc1, 0x15, 0xc2,
+    0x3e, 0x59, 0x08, 0xc2, 0x3e, 0x65, 0x16, 0xc2, 0x3e, 0x71, 0xc3, 0x05,
+    0x14, 0x08, 0xca, 0x89, 0xc4, 0x15, 0xe7, 0x08, 0xca, 0x80, 0x91, 0x08,
+    0xc9, 0xc1, 0x03, 0xc2, 0x3e, 0x7d, 0x87, 0x08, 0xc9, 0xa9, 0x97, 0x08,
+    0xc9, 0x9b, 0x02, 0x3e, 0x85, 0x8b, 0x08, 0xc9, 0x8a, 0x02, 0x3e, 0x89,
+    0xc2, 0x00, 0xdb, 0x08, 0xc9, 0x71, 0x83, 0x08, 0xc9, 0x40, 0x83, 0x08,
+    0xc9, 0x61, 0xc2, 0x0d, 0xf6, 0x08, 0xc9, 0x59, 0xc2, 0x00, 0xd0, 0x08,
+    0xc9, 0x50, 0xc2, 0x19, 0x2c, 0x08, 0xc9, 0x31, 0x83, 0x08, 0xc9, 0x28,
+    0xc2, 0x00, 0xd0, 0x08, 0xc9, 0x19, 0x83, 0x08, 0xc9, 0x10, 0xc2, 0x00,
+    0xd0, 0x08, 0xc9, 0x09, 0x83, 0x08, 0xc9, 0x00, 0x83, 0x08, 0xc8, 0xf9,
+    0xc2, 0x00, 0xc1, 0x08, 0xc8, 0xd1, 0xc2, 0x19, 0x2c, 0x08, 0xc8, 0xa9,
+    0xc2, 0x01, 0x30, 0x08, 0xc8, 0x80, 0xc2, 0x00, 0xd0, 0x08, 0xc8, 0xf1,
+    0x83, 0x08, 0xc8, 0xe9, 0x06, 0x42, 0x3e, 0x8d, 0xc2, 0x00, 0xd0, 0x08,
+    0xc8, 0xe1, 0x83, 0x08, 0xc8, 0xd9, 0xc2, 0x01, 0x6f, 0x08, 0xc8, 0xb0,
+    0xc2, 0x00, 0xd0, 0x08, 0xc8, 0x91, 0x83, 0x08, 0xc8, 0x88, 0xc2, 0x00,
+    0xd0, 0x08, 0xc8, 0x79, 0x83, 0x08, 0xc8, 0x70, 0xc2, 0x00, 0xd0, 0x08,
+    0xc8, 0x69, 0x83, 0x08, 0xc8, 0x60, 0x97, 0x08, 0xc8, 0x28, 0x8b, 0x08,
+    0xc8, 0x18, 0x83, 0x08, 0xc8, 0x08, 0xc4, 0x03, 0x03, 0x01, 0x10, 0xa9,
+    0xc3, 0x00, 0xbb, 0x00, 0x07, 0xb8, 0xc4, 0x26, 0x78, 0x01, 0x3c, 0x91,
+    0xc5, 0x06, 0xdb, 0x01, 0x3c, 0x89, 0x15, 0xc2, 0x3e, 0x97, 0x08, 0xc2,
+    0x3e, 0xa3, 0x16, 0xc2, 0x3e, 0xaf, 0xc3, 0x05, 0x14, 0x01, 0x3c, 0x51,
+    0xc4, 0x15, 0xe7, 0x0f, 0x88, 0x60, 0xc4, 0x18, 0x10, 0x01, 0x3b, 0xe1,
+    0xc2, 0x22, 0xcc, 0x01, 0x3b, 0xd8, 0xc3, 0x0d, 0x14, 0x01, 0x3b, 0xd1,
+    0xc3, 0x09, 0x9e, 0x01, 0x3b, 0xc8, 0xc4, 0x02, 0xde, 0x01, 0x3b, 0xc1,
+    0xc2, 0x02, 0xa0, 0x01, 0x3b, 0xb8, 0xc4, 0x18, 0x10, 0x01, 0x3c, 0x31,
+    0xc2, 0x22, 0xcc, 0x01, 0x3c, 0x28, 0xc3, 0x0d, 0x14, 0x01, 0x3c, 0x21,
+    0xc3, 0x09, 0x9e, 0x01, 0x3c, 0x18, 0xc4, 0x02, 0xde, 0x01, 0x3c, 0x11,
+    0xc2, 0x02, 0xa0, 0x01, 0x3c, 0x08, 0xcf, 0x66, 0x66, 0x01, 0x58, 0xb1,
+    0xd0, 0x5d, 0x52, 0x01, 0x58, 0xb9, 0xce, 0x74, 0xda, 0x01, 0x58, 0xc1,
+    0xd1, 0x53, 0xba, 0x01, 0x58, 0xc8, 0xc9, 0x33, 0xad, 0x0f, 0xc8, 0x50,
+    0xc9, 0x33, 0xad, 0x0f, 0xc8, 0x58, 0x42, 0x00, 0x2c, 0xc2, 0x3e, 0xbb,
+    0x42, 0x02, 0xa0, 0x42, 0x3e, 0xc7, 0xcf, 0x5b, 0xc3, 0x0f, 0xc2, 0x99,
+    0xcc, 0x88, 0xdd, 0x0f, 0xc1, 0xd8, 0x45, 0x11, 0x3a, 0xc2, 0x3e, 0xd3,
+    0x51, 0x01, 0x51, 0x42, 0x3e, 0xdf, 0xc4, 0x01, 0xa3, 0x01, 0x0c, 0x9b,
+    0x02, 0x3e, 0xeb, 0xc5, 0xdb, 0x50, 0x01, 0x70, 0xa0, 0xda, 0x1b, 0xd0,
+    0x0f, 0xc4, 0xb8, 0xcb, 0x82, 0xba, 0x01, 0x0f, 0x19, 0xcb, 0x82, 0x36,
+    0x01, 0x0e, 0x98, 0xc5, 0x01, 0xa2, 0x01, 0x58, 0x39, 0xd3, 0x43, 0xe4,
+    0x01, 0x5c, 0x58, 0xa3, 0x0f, 0x82, 0x99, 0x9d, 0x0f, 0x82, 0x69, 0x9e,
+    0x0f, 0x82, 0x71, 0x9f, 0x0f, 0x82, 0x79, 0xa0, 0x0f, 0x82, 0x81, 0xa1,
+    0x0f, 0x82, 0x89, 0xa2, 0x0f, 0x82, 0x90, 0xa3, 0x0f, 0x81, 0xf1, 0xa1,
+    0x0f, 0x81, 0xe1, 0x9d, 0x0f, 0x81, 0xc1, 0x9e, 0x0f, 0x81, 0xc9, 0x9f,
+    0x0f, 0x81, 0xd1, 0xa0, 0x0f, 0x81, 0xd9, 0xa2, 0x0f, 0x81, 0xe8, 0xa0,
+    0x0f, 0x81, 0xa1, 0x9f, 0x0f, 0x81, 0x99, 0x9e, 0x0f, 0x81, 0x91, 0x9d,
+    0x0f, 0x81, 0x89, 0xa1, 0x0f, 0x81, 0xa9, 0xa2, 0x0f, 0x81, 0xb1, 0xa3,
+    0x0f, 0x81, 0xb8, 0x9d, 0x0f, 0x81, 0xf9, 0x9e, 0x0f, 0x82, 0x01, 0x9f,
+    0x0f, 0x82, 0x09, 0xa0, 0x0f, 0x82, 0x11, 0xa1, 0x0f, 0x82, 0x19, 0xa2,
+    0x0f, 0x82, 0x21, 0xa3, 0x0f, 0x82, 0x28, 0x9d, 0x0f, 0x82, 0x31, 0x9e,
+    0x0f, 0x82, 0x39, 0x9f, 0x0f, 0x82, 0x41, 0xa0, 0x0f, 0x82, 0x49, 0xa1,
+    0x0f, 0x82, 0x51, 0xa2, 0x0f, 0x82, 0x59, 0xa3, 0x0f, 0x82, 0x60, 0x9d,
+    0x0f, 0x82, 0xa1, 0x9e, 0x0f, 0x82, 0xa9, 0x9f, 0x0f, 0x82, 0xb1, 0xa0,
+    0x0f, 0x82, 0xb9, 0xa1, 0x0f, 0x82, 0xc1, 0xa2, 0x0f, 0x82, 0xc9, 0xa3,
+    0x0f, 0x82, 0xd0, 0x9d, 0x0f, 0x82, 0xd9, 0x9e, 0x0f, 0x82, 0xe1, 0x9f,
+    0x0f, 0x82, 0xe9, 0xa0, 0x0f, 0x82, 0xf1, 0xa1, 0x0f, 0x82, 0xf9, 0xa2,
+    0x0f, 0x83, 0x01, 0xa3, 0x0f, 0x83, 0x08, 0x9d, 0x0f, 0x83, 0x19, 0x9e,
+    0x0f, 0x83, 0x21, 0x9f, 0x0f, 0x83, 0x29, 0xa0, 0x0f, 0x83, 0x31, 0xa1,
+    0x0f, 0x83, 0x39, 0xa2, 0x0f, 0x83, 0x41, 0xa3, 0x0f, 0x83, 0x48, 0x9d,
+    0x0f, 0x83, 0x51, 0x9e, 0x0f, 0x83, 0x59, 0x9f, 0x0f, 0x83, 0x61, 0xa0,
+    0x0f, 0x83, 0x69, 0xa1, 0x0f, 0x83, 0x71, 0xa2, 0x0f, 0x83, 0x79, 0xa3,
+    0x0f, 0x83, 0x80, 0x9d, 0x0f, 0x83, 0x89, 0x9e, 0x0f, 0x83, 0x91, 0x9f,
+    0x0f, 0x83, 0x99, 0xa0, 0x0f, 0x83, 0xa1, 0xa1, 0x0f, 0x83, 0xa9, 0xa2,
+    0x0f, 0x83, 0xb1, 0xa3, 0x0f, 0x83, 0xb8, 0x9d, 0x0f, 0x83, 0xc1, 0x9e,
+    0x0f, 0x83, 0xc9, 0x9f, 0x0f, 0x83, 0xd1, 0xa0, 0x0f, 0x83, 0xd9, 0xa1,
+    0x0f, 0x83, 0xe1, 0xa2, 0x0f, 0x83, 0xe9, 0xa3, 0x0f, 0x83, 0xf0, 0x9d,
+    0x0f, 0x83, 0xf9, 0x9e, 0x0f, 0x84, 0x01, 0x9f, 0x0f, 0x84, 0x09, 0xa0,
+    0x0f, 0x84, 0x11, 0xa1, 0x0f, 0x84, 0x19, 0xa2, 0x0f, 0x84, 0x21, 0xa3,
+    0x0f, 0x84, 0x28, 0x9e, 0x0f, 0x84, 0x39, 0x9f, 0x0f, 0x84, 0x41, 0xa0,
+    0x0f, 0x84, 0x49, 0xa1, 0x0f, 0x84, 0x51, 0xa2, 0x0f, 0x84, 0x59, 0xa3,
+    0x0f, 0x84, 0x61, 0x9d, 0x0f, 0x84, 0x30, 0x9d, 0x0f, 0x84, 0x69, 0x9e,
+    0x0f, 0x84, 0x71, 0x9f, 0x0f, 0x84, 0x79, 0xa0, 0x0f, 0x84, 0x81, 0xa1,
+    0x0f, 0x84, 0x89, 0xa2, 0x0f, 0x84, 0x91, 0xa3, 0x0f, 0x84, 0x98, 0xc9,
+    0xb0, 0x86, 0x01, 0x3d, 0xf9, 0x47, 0x20, 0x7d, 0xc2, 0x3e, 0xef, 0xca,
+    0xa6, 0x8e, 0x01, 0x53, 0xa0, 0xc3, 0x01, 0x5d, 0x01, 0x1f, 0xc3, 0x02,
+    0x3e, 0xfb, 0xc4, 0x02, 0x6d, 0x01, 0x00, 0xb0, 0xc4, 0x13, 0x85, 0x01,
+    0x16, 0x99, 0xc6, 0xc4, 0x5e, 0x01, 0x57, 0x58, 0xc8, 0x06, 0xbf, 0x01,
+    0x16, 0x91, 0xc4, 0x1e, 0x43, 0x01, 0x11, 0x60, 0x17, 0xc2, 0x3e, 0xff,
+    0x46, 0x1f, 0x87, 0xc2, 0x3f, 0x17, 0x16, 0xc2, 0x3f, 0x23, 0xcf, 0x62,
+    0xa6, 0x01, 0x57, 0xe8, 0x14, 0xc2, 0x3f, 0x2f, 0xc3, 0x25, 0xd6, 0x01,
+    0x4f, 0xd0, 0xc5, 0xce, 0x22, 0x01, 0x01, 0x09, 0xc8, 0x32, 0xb8, 0x01,
+    0x57, 0x50, 0xdd, 0x0f, 0xb9, 0x01, 0x00, 0xf9, 0xc5, 0x59, 0x93, 0x01,
+    0x72, 0x00, 0x11, 0xc2, 0x3f, 0x3e, 0xdc, 0x13, 0x19, 0x01, 0x4c, 0xa8,
+    0xc9, 0x00, 0xca, 0x01, 0x55, 0x0b, 0x02, 0x3f, 0x48, 0xcc, 0x07, 0xc7,
+    0x01, 0x55, 0x10, 0x47, 0xc7, 0x4a, 0xc2, 0x3f, 0x4e, 0xcf, 0x60, 0x4e,
+    0x01, 0x0a, 0x01, 0x48, 0x0b, 0x17, 0xc2, 0x3f, 0x5a, 0x46, 0x03, 0x13,
+    0x42, 0x3f, 0x7f, 0x4c, 0x24, 0xe3, 0xc2, 0x3f, 0x8b, 0x48, 0x00, 0xda,
+    0x42, 0x3f, 0x97, 0xc4, 0x1e, 0x97, 0x08, 0xc1, 0xc9, 0xc5, 0x40, 0xe7,
+    0x08, 0xc1, 0xc0, 0x97, 0x08, 0xc1, 0xb1, 0x8b, 0x08, 0xc1, 0xa1, 0x83,
+    0x08, 0xc1, 0x60, 0x94, 0x08, 0xc1, 0x90, 0x97, 0x08, 0xc1, 0x80, 0x8b,
+    0x08, 0xc1, 0x70, 0xc2, 0x00, 0x39, 0x08, 0xc1, 0x59, 0x83, 0x08, 0xc1,
+    0x20, 0x83, 0x08, 0xc1, 0x49, 0xc2, 0x0d, 0xf6, 0x08, 0xc1, 0x41, 0xc2,
+    0x00, 0xd0, 0x08, 0xc1, 0x38, 0xc2, 0x00, 0xd0, 0x08, 0xc1, 0x09, 0x83,
+    0x08, 0xc1, 0x00, 0xc2, 0x00, 0xd0, 0x08, 0xc0, 0xf9, 0x83, 0x08, 0xc0,
+    0xf0, 0x83, 0x08, 0xc0, 0xe9, 0xc2, 0x00, 0xc1, 0x08, 0xc0, 0xc1, 0xc2,
+    0x19, 0x2c, 0x08, 0xc0, 0x99, 0xc2, 0x01, 0x30, 0x08, 0xc0, 0x70, 0xc2,
+    0x00, 0xd0, 0x08, 0xc0, 0xe1, 0x83, 0x08, 0xc0, 0xd9, 0x06, 0x42, 0x3f,
+    0xa9, 0xc2, 0x00, 0xd0, 0x08, 0xc0, 0xd1, 0x83, 0x08, 0xc0, 0xc9, 0x16,
+    0x42, 0x3f, 0xb3, 0xc2, 0x00, 0xd0, 0x08, 0xc0, 0x91, 0x83, 0x08, 0xc0,
+    0x88, 0xc2, 0x00, 0xd0, 0x08, 0xc0, 0x81, 0x83, 0x08, 0xc0, 0x78, 0xc2,
+    0x00, 0xd0, 0x08, 0xc0, 0x69, 0x83, 0x08, 0xc0, 0x60, 0xc2, 0x00, 0xd0,
+    0x08, 0xc0, 0x59, 0x83, 0x08, 0xc0, 0x50, 0x97, 0x08, 0xc0, 0x49, 0x8b,
+    0x08, 0xc0, 0x39, 0x83, 0x08, 0xc0, 0x08, 0x97, 0x08, 0xc0, 0x28, 0x8b,
+    0x08, 0xc0, 0x18, 0x03, 0xc2, 0x3f, 0xbd, 0xc8, 0x00, 0x5f, 0x0d, 0xe4,
+    0xc3, 0x02, 0x3f, 0xc9, 0xc4, 0x51, 0xb7, 0x0d, 0xe4, 0xb9, 0x0e, 0xc2,
+    0x3f, 0xcf, 0xc6, 0x02, 0xd1, 0x0d, 0xe4, 0xa9, 0xc3, 0x02, 0xa3, 0x0d,
+    0xe4, 0xa1, 0xc5, 0x1f, 0x0c, 0x0d, 0xe4, 0x91, 0xcb, 0x8f, 0x94, 0x0d,
+    0xe4, 0x88, 0xc7, 0x27, 0x9b, 0x0d, 0xe3, 0xa8, 0xc3, 0x02, 0x6e, 0x0d,
+    0xe4, 0x31, 0xc9, 0xac, 0xf0, 0x0d, 0xe4, 0x18, 0xc5, 0xd9, 0x39, 0x0d,
+    0xe3, 0xc3, 0x02, 0x3f, 0xdb, 0xc2, 0x00, 0x71, 0x0d, 0xe3, 0xc8, 0x99,
+    0x0d, 0xe3, 0x00, 0xc3, 0x02, 0xe9, 0x0d, 0xe1, 0xb9, 0x95, 0x0d, 0xe1,
+    0xb0, 0x92, 0x0d, 0xe1, 0xa3, 0x02, 0x3f, 0xe1, 0x96, 0x0d, 0xe1, 0x93,
+    0x02, 0x3f, 0xe7, 0x8c, 0x0d, 0xe1, 0x03, 0x02, 0x3f, 0xed, 0x95, 0x0d,
+    0xe1, 0x51, 0xc8, 0x33, 0xae, 0x0d, 0xe1, 0x2b, 0x02, 0x3f, 0xf3, 0x8d,
+    0x0d, 0xe1, 0xfb, 0x02, 0x3f, 0xf9, 0x8f, 0x0d, 0xe1, 0xe1, 0x90, 0x0d,
+    0xe1, 0xd8, 0x8c, 0x0d, 0xe0, 0xa9, 0xc2, 0x08, 0x06, 0x0d, 0xe0, 0x91,
+    0x11, 0xc2, 0x3f, 0xff, 0xc2, 0x00, 0xd1, 0x0d, 0xe3, 0x41, 0x07, 0xc2,
+    0x40, 0x07, 0x97, 0x0d, 0xe2, 0xc0, 0x90, 0x0d, 0xe1, 0x83, 0x02, 0x40,
+    0x13, 0x95, 0x0d, 0xe1, 0x4b, 0x02, 0x40, 0x19, 0x8f, 0x0d, 0xe0, 0xfb,
+    0x02, 0x40, 0x1f, 0xc8, 0x33, 0xae, 0x0d, 0xe1, 0x1a, 0x02, 0x40, 0x25,
+    0x8f, 0x0d, 0xe0, 0xf3, 0x02, 0x40, 0x2b, 0x95, 0x0d, 0xe1, 0x41, 0xc8,
+    0x33, 0xae, 0x0d, 0xe1, 0x10, 0x83, 0x0d, 0xe3, 0x21, 0x8b, 0x0d, 0xe3,
+    0x19, 0x91, 0x0d, 0xe3, 0x11, 0x97, 0x0d, 0xe3, 0x08, 0x90, 0x0d, 0xe0,
+    0xeb, 0x02, 0x40, 0x31, 0x95, 0x0d, 0xe1, 0x39, 0xc8, 0x33, 0xae, 0x0d,
+    0xe1, 0x08, 0x97, 0x0d, 0xe2, 0xb1, 0x8b, 0x0d, 0xe2, 0x68, 0x97, 0x0d,
+    0xe2, 0xa9, 0x8b, 0x0d, 0xe2, 0x78, 0x8f, 0x0d, 0xe0, 0x79, 0xc3, 0x02,
+    0xe9, 0x0d, 0xe1, 0xe8, 0x8f, 0x0d, 0xe3, 0x31, 0x90, 0x0d, 0xe3, 0x28,
+    0xc7, 0x1b, 0x02, 0x00, 0x04, 0x69, 0xde, 0x0e, 0x50, 0x0f, 0xbe, 0x40,
+    0x00, 0x42, 0x40, 0x37, 0xcf, 0x09, 0xf8, 0x01, 0x5a, 0x09, 0xd0, 0x03,
+    0xb7, 0x01, 0x5a, 0x38, 0xda, 0x1c, 0xa0, 0x01, 0x30, 0xc9, 0xdf, 0x0c,
+    0x27, 0x0f, 0xac, 0x89, 0xca, 0x3f, 0x35, 0x01, 0x5f, 0xf0, 0xc4, 0x1e,
+    0xc9, 0x01, 0x11, 0xeb, 0x02, 0x40, 0x49, 0xcb, 0x94, 0x59, 0x01, 0x01,
+    0xb9, 0x46, 0xcf, 0x95, 0x42, 0x40, 0x4f, 0xd3, 0x46, 0xb6, 0x01, 0x0a,
+    0x19, 0xc8, 0x52, 0x00, 0x01, 0x02, 0x78, 0xcb, 0x92, 0xd8, 0x01, 0x02,
+    0x59, 0xc4, 0x18, 0x26, 0x01, 0x01, 0xa8, 0xc5, 0x18, 0x25, 0x01, 0x01,
+    0xb3, 0x02, 0x40, 0x5b, 0xcf, 0x68, 0xbe, 0x01, 0x57, 0x68, 0xce, 0x55,
+    0x99, 0x01, 0x4d, 0x28, 0xca, 0xa1, 0x34, 0x01, 0x33, 0xc9, 0xca, 0x9d,
+    0xce, 0x01, 0x33, 0xc1, 0xca, 0x9d, 0x42, 0x01, 0x33, 0xb9, 0xca, 0xa1,
+    0x48, 0x01, 0x33, 0xb1, 0xca, 0x9d, 0x9c, 0x01, 0x33, 0xa9, 0xca, 0xa0,
+    0x58, 0x01, 0x33, 0xa1, 0xca, 0x9a, 0x7c, 0x01, 0x33, 0x98, 0x83, 0x05,
+    0x4a, 0x71, 0x97, 0x05, 0x4a, 0x68, 0x97, 0x05, 0x4a, 0x61, 0x8b, 0x05,
+    0x4a, 0x50, 0xc2, 0x25, 0x3b, 0x05, 0x4a, 0x29, 0x83, 0x05, 0x49, 0xd8,
+    0xc2, 0x01, 0x30, 0x05, 0x4a, 0x19, 0x83, 0x05, 0x49, 0x90, 0xd1, 0x3f,
+    0xe4, 0x0f, 0xdc, 0x59, 0xd0, 0x05, 0xb7, 0x01, 0x16, 0x60, 0x00, 0x42,
+    0x40, 0x61, 0xd3, 0x01, 0xb4, 0x01, 0x00, 0xc9, 0xd0, 0x58, 0xd2, 0x01,
+    0x71, 0x38, 0xca, 0x6f, 0xb9, 0x0f, 0xaf, 0x49, 0xc4, 0x21, 0xdf, 0x0f,
+    0xab, 0x42, 0x02, 0x40, 0x79, 0x42, 0x00, 0xa9, 0xc2, 0x40, 0x7f, 0x09,
+    0x42, 0x40, 0x8b, 0x49, 0x05, 0xcb, 0xc2, 0x40, 0x9a, 0xd6, 0x13, 0x1f,
+    0x01, 0x4c, 0xa0, 0xcc, 0x06, 0xdb, 0x01, 0x2c, 0xa9, 0xcd, 0x15, 0x02,
+    0x0f, 0xdc, 0x38, 0x42, 0x00, 0x5b, 0xc2, 0x40, 0xa6, 0xcc, 0x01, 0xdb,
+    0x0f, 0xdc, 0x69, 0xcb, 0x96, 0x7f, 0x0f, 0xdd, 0x99, 0xc6, 0x9e, 0xf4,
+    0x0f, 0xdd, 0xd0, 0x00, 0x42, 0x40, 0xb2, 0xca, 0xa2, 0x74, 0x01, 0x1d,
+    0x01, 0xc9, 0x57, 0x36, 0x01, 0x1c, 0xf9, 0xca, 0xa3, 0x5a, 0x01, 0x1c,
+    0xf0, 0xc7, 0xb2, 0xec, 0x01, 0x4b, 0xe9, 0xd0, 0x4a, 0x77, 0x0f, 0xdc,
+    0x48, 0x44, 0x01, 0x94, 0xc2, 0x40, 0xc4, 0xd3, 0x41, 0xf6, 0x01, 0x70,
+    0x50, 0xcc, 0x86, 0xcd, 0x0f, 0xaf, 0x69, 0x44, 0x02, 0xdf, 0xc2, 0x40,
+    0xd3, 0xde, 0x06, 0x69, 0x0f, 0xde, 0x18, 0xce, 0x01, 0xb9, 0x01, 0x00,
+    0xe9, 0xcc, 0x8a, 0x09, 0x01, 0x4e, 0xd9, 0x03, 0xc2, 0x40, 0xdf, 0xcb,
+    0x1a, 0x50, 0x01, 0x71, 0x48, 0xcb, 0x1a, 0x50, 0x01, 0x4c, 0x31, 0x05,
+    0xc2, 0x40, 0xeb, 0xd2, 0x21, 0x89, 0x01, 0x80, 0xb9, 0xd6, 0x08, 0x88,
+    0x01, 0x80, 0xc9, 0xce, 0x25, 0xad, 0x01, 0x80, 0xd8, 0x00, 0x42, 0x40,
+    0xf7, 0x45, 0x01, 0x95, 0xc2, 0x41, 0x03, 0x44, 0x0b, 0x26, 0x42, 0x41,
+    0x0f, 0xcd, 0x7e, 0x3b, 0x01, 0x0d, 0x01, 0x48, 0x01, 0x9a, 0x42, 0x41,
+    0x1b, 0xcb, 0x6f, 0xff, 0x01, 0x0e, 0xe9, 0xca, 0x88, 0xdf, 0x0f, 0xc1,
+    0xd0, 0xd0, 0x58, 0x62, 0x0f, 0xc2, 0x11, 0xc5, 0x01, 0xa2, 0x0f, 0xc2,
+    0x30, 0x46, 0x01, 0x52, 0xc2, 0x41, 0x27, 0xc2, 0x02, 0x35, 0x0f, 0xd7,
+    0x88, 0x45, 0x00, 0x8c, 0xc2, 0x41, 0x33, 0x16, 0xc2, 0x41, 0x6f, 0xd4,
+    0x3b, 0x38, 0x01, 0x0e, 0x21, 0xc8, 0xae, 0xbc, 0x01, 0x0d, 0x33, 0x02,
+    0x41, 0x7b, 0x03, 0x42, 0x41, 0x81, 0xc5, 0x01, 0xa2, 0x01, 0x0e, 0x93,
+    0x02, 0x41, 0x8d, 0xca, 0x52, 0xc2, 0x01, 0x48, 0x68, 0xd3, 0x43, 0xe4,
+    0x01, 0x5c, 0x51, 0xc5, 0x01, 0xa2, 0x01, 0x5c, 0xa8, 0xca, 0x50, 0x5e,
+    0x00, 0x7e, 0xb8, 0xc7, 0x0d, 0x04, 0x01, 0x0b, 0x6b, 0x02, 0x41, 0x97,
+    0xc8, 0x4b, 0x94, 0x01, 0x0b, 0x7a, 0x02, 0x41, 0x9d, 0xc3, 0x45, 0x6b,
+    0x01, 0x0b, 0x63, 0x02, 0x41, 0xa3, 0xc2, 0x00, 0x5f, 0x01, 0x0b, 0x22,
+    0x02, 0x41, 0xa7, 0xca, 0xa0, 0xda, 0x01, 0x0c, 0x28, 0xc9, 0x57, 0x20,
+    0x01, 0x0c, 0x10, 0xc4, 0x22, 0x44, 0x01, 0x0b, 0x59, 0x91, 0x01, 0x0b,
+    0x08, 0xc8, 0xbd, 0x82, 0x08, 0x0c, 0x81, 0xc8, 0x45, 0xf0, 0x08, 0x0c,
+    0x98, 0x44, 0x1c, 0x74, 0xc2, 0x41, 0xab, 0xcf, 0x0c, 0x37, 0x0f, 0xac,
+    0x80, 0xc8, 0x0d, 0x03, 0x08, 0x73, 0xc1, 0xc2, 0x0d, 0x10, 0x08, 0x73,
+    0x78, 0xc8, 0x0d, 0x03, 0x08, 0x73, 0xb9, 0xc2, 0x0d, 0x10, 0x08, 0x73,
+    0x70, 0xca, 0x37, 0x63, 0x08, 0x73, 0xb1, 0xc3, 0x45, 0x6b, 0x08, 0x73,
+    0x68, 0xca, 0x9c, 0x5c, 0x08, 0x73, 0xa9, 0xc3, 0x0d, 0x0f, 0x08, 0x73,
+    0x60, 0xcb, 0x13, 0xfa, 0x08, 0x73, 0xa1, 0xc4, 0x0d, 0x0e, 0x08, 0x73,
+    0x58, 0xc9, 0x18, 0x05, 0x08, 0x73, 0x99, 0xc4, 0x18, 0x12, 0x08, 0x73,
+    0x50, 0x4d, 0x7e, 0xbd, 0xc2, 0x41, 0xb1, 0xcd, 0x7e, 0x21, 0x00, 0xb5,
+    0x00, 0x91, 0x00, 0xb7, 0x99, 0xce, 0x75, 0x12, 0x00, 0xb6, 0xf9, 0xc5,
+    0xd4, 0xac, 0x00, 0xb6, 0xa9, 0x90, 0x00, 0xb5, 0x81, 0x87, 0x00, 0xb5,
+    0x79, 0xc3, 0x05, 0x0d, 0x00, 0xb5, 0x48, 0x8a, 0x00, 0xb7, 0x93, 0x02,
+    0x41, 0xc7, 0xc3, 0x13, 0x00, 0x00, 0xb7, 0x29, 0xd6, 0x2e, 0x28, 0x00,
+    0xb6, 0x59, 0xc7, 0xc9, 0x5e, 0x00, 0xb6, 0x50, 0x43, 0x38, 0x85, 0x42,
+    0x41, 0xcd, 0xcb, 0x96, 0xc1, 0x00, 0xb7, 0x41, 0xc2, 0x00, 0xbf, 0x00,
+    0xb7, 0x09, 0xc2, 0x00, 0x75, 0x00, 0xb6, 0xeb, 0x02, 0x41, 0xd7, 0xc7,
+    0xc5, 0x2f, 0x00, 0xb6, 0x39, 0xcc, 0x84, 0xf9, 0x00, 0xb6, 0x08, 0x4b,
+    0x2e, 0x2e, 0xc2, 0x41, 0xdd, 0xd1, 0x55, 0xb8, 0x00, 0xb6, 0xd0, 0x07,
+    0xc2, 0x41, 0xfb, 0xc3, 0x67, 0x02, 0x00, 0xb7, 0x19, 0xc6, 0xce, 0xf9,
+    0x00, 0xb7, 0x10, 0xc2, 0x00, 0xb1, 0x00, 0xb7, 0x01, 0xc9, 0xaa, 0x0e,
+    0x00, 0xb6, 0xb1, 0xc2, 0x00, 0x75, 0x00, 0xb5, 0xb1, 0xc2, 0x00, 0x8e,
+    0x00, 0xb5, 0x38, 0xcb, 0x99, 0x97, 0x00, 0xb6, 0xf1, 0x46, 0xcb, 0xbd,
+    0x42, 0x42, 0x05, 0xce, 0x72, 0x56, 0x00, 0xb6, 0x79, 0xd3, 0x42, 0xda,
+    0x00, 0xb5, 0x30, 0xca, 0xa5, 0x08, 0x00, 0xb6, 0x49, 0xc3, 0x23, 0x1c,
+    0x00, 0xb5, 0x59, 0xc3, 0x15, 0x66, 0x00, 0xb5, 0x51, 0xc6, 0xcb, 0xc9,
+    0x00, 0xb5, 0x40, 0x07, 0xc2, 0x42, 0x11, 0xc2, 0x00, 0xb1, 0x00, 0xb5,
+    0xc0, 0xc5, 0xd9, 0x75, 0x00, 0xb5, 0xd9, 0xc6, 0xcf, 0xa1, 0x00, 0xb5,
+    0xd0, 0xcb, 0x95, 0x4b, 0x00, 0xb5, 0xc8, 0x94, 0x00, 0xb5, 0x18, 0x87,
+    0x05, 0x28, 0x03, 0x02, 0x42, 0x1b, 0x90, 0x05, 0x2f, 0x10, 0x87, 0x05,
+    0x2f, 0x23, 0x02, 0x42, 0x1f, 0x8b, 0x05, 0x29, 0x33, 0x02, 0x42, 0x27,
+    0x83, 0x05, 0x2a, 0x63, 0x02, 0x42, 0x2b, 0x91, 0x05, 0x2d, 0xeb, 0x02,
+    0x42, 0x2f, 0x97, 0x05, 0x2c, 0xba, 0x02, 0x42, 0x37, 0x87, 0x05, 0x2f,
+    0x33, 0x02, 0x42, 0x3b, 0x8b, 0x05, 0x29, 0x43, 0x02, 0x42, 0x46, 0x83,
+    0x05, 0x2a, 0x73, 0x02, 0x42, 0x4a, 0x91, 0x05, 0x2d, 0xfb, 0x02, 0x42,
+    0x4e, 0x97, 0x05, 0x2c, 0xca, 0x02, 0x42, 0x59, 0x87, 0x05, 0x2f, 0x43,
+    0x02, 0x42, 0x5d, 0x8b, 0x05, 0x29, 0x51, 0x83, 0x05, 0x2a, 0x81, 0x91,
+    0x05, 0x2e, 0x0b, 0x02, 0x42, 0x61, 0x97, 0x05, 0x2c, 0xd8, 0x0a, 0xc2,
+    0x42, 0x65, 0x87, 0x05, 0x2f, 0x53, 0x02, 0x42, 0x7f, 0x8b, 0x05, 0x29,
+    0x61, 0x83, 0x05, 0x2a, 0x91, 0x91, 0x05, 0x2e, 0x1b, 0x02, 0x42, 0x83,
+    0x97, 0x05, 0x2c, 0xe8, 0x04, 0xc2, 0x42, 0x87, 0x42, 0x1f, 0xad, 0xc2,
+    0x42, 0xa1, 0x87, 0x05, 0x30, 0x43, 0x02, 0x42, 0xbb, 0x8b, 0x05, 0x2a,
+    0x31, 0x83, 0x05, 0x2b, 0x71, 0x91, 0x05, 0x2e, 0xf3, 0x02, 0x42, 0xbf,
+    0x97, 0x05, 0x2d, 0xb8, 0x12, 0xc2, 0x42, 0xc3, 0x87, 0x05, 0x30, 0x1b,
+    0x02, 0x42, 0xe0, 0x8b, 0x05, 0x2a, 0x19, 0x83, 0x05, 0x2b, 0x53, 0x02,
+    0x42, 0xe4, 0x91, 0x05, 0x2e, 0xdb, 0x02, 0x42, 0xe8, 0x97, 0x05, 0x2d,
+    0xa0, 0x04, 0xc2, 0x42, 0xec, 0x87, 0x05, 0x30, 0x33, 0x02, 0x43, 0x06,
+    0x8b, 0x05, 0x2a, 0x29, 0x83, 0x05, 0x2b, 0x69, 0x91, 0x05, 0x2e, 0xeb,
+    0x02, 0x43, 0x0e, 0x97, 0x05, 0x2d, 0xb0, 0x87, 0x05, 0x2f, 0x8b, 0x02,
+    0x43, 0x12, 0x8b, 0x05, 0x29, 0x89, 0x83, 0x05, 0x2a, 0xc1, 0x91, 0x05,
+    0x2e, 0x4b, 0x02, 0x43, 0x16, 0x97, 0x05, 0x2d, 0x10, 0x87, 0x05, 0x2f,
+    0x93, 0x02, 0x43, 0x1a, 0x8b, 0x05, 0x29, 0x91, 0x83, 0x05, 0x2a, 0xc9,
+    0x91, 0x05, 0x2e, 0x53, 0x02, 0x43, 0x1e, 0x97, 0x05, 0x2d, 0x18, 0x87,
+    0x05, 0x2f, 0x9b, 0x02, 0x43, 0x22, 0x0a, 0xc2, 0x43, 0x26, 0x8b, 0x05,
+    0x29, 0x99, 0x83, 0x05, 0x2a, 0xd1, 0x91, 0x05, 0x2e, 0x5b, 0x02, 0x43,
+    0x40, 0x97, 0x05, 0x2d, 0x20, 0x0a, 0xc2, 0x43, 0x44, 0x87, 0x05, 0x2f,
+    0xcb, 0x02, 0x43, 0x62, 0x8b, 0x05, 0x29, 0xc9, 0x83, 0x05, 0x2b, 0x01,
+    0x91, 0x05, 0x2e, 0x8b, 0x02, 0x43, 0x66, 0x97, 0x05, 0x2d, 0x50, 0x87,
+    0x05, 0x2f, 0xbb, 0x02, 0x43, 0x6a, 0x8b, 0x05, 0x29, 0xb9, 0x83, 0x05,
+    0x2a, 0xf1, 0x91, 0x05, 0x2e, 0x7b, 0x02, 0x43, 0x74, 0x97, 0x05, 0x2d,
+    0x40, 0x87, 0x05, 0x2f, 0xc3, 0x02, 0x43, 0x78, 0x8b, 0x05, 0x29, 0xc1,
+    0x83, 0x05, 0x2a, 0xf9, 0x91, 0x05, 0x2e, 0x83, 0x02, 0x43, 0x7c, 0x97,
+    0x05, 0x2d, 0x48, 0x06, 0xc2, 0x43, 0x80, 0x0c, 0xc2, 0x43, 0x9a, 0x89,
+    0x05, 0x30, 0x5b, 0x02, 0x43, 0xb4, 0x87, 0x05, 0x30, 0x4b, 0x02, 0x43,
+    0xca, 0x1b, 0xc2, 0x43, 0xce, 0x8b, 0x05, 0x2a, 0x39, 0x83, 0x05, 0x2b,
+    0x79, 0x91, 0x05, 0x2e, 0xfb, 0x02, 0x43, 0xe8, 0x97, 0x05, 0x2d, 0xc0,
+    0x87, 0x05, 0x2f, 0xdb, 0x02, 0x43, 0xec, 0x0a, 0xc2, 0x43, 0xf0, 0x8b,
+    0x05, 0x29, 0xd9, 0x83, 0x05, 0x2b, 0x11, 0x91, 0x05, 0x2e, 0x9b, 0x02,
+    0x44, 0x0a, 0x97, 0x05, 0x2d, 0x60, 0x87, 0x05, 0x2f, 0xeb, 0x02, 0x44,
+    0x0e, 0x0a, 0xc2, 0x44, 0x12, 0x8b, 0x05, 0x29, 0xe9, 0x83, 0x05, 0x2b,
+    0x21, 0x91, 0x05, 0x2e, 0xab, 0x02, 0x44, 0x2c, 0x97, 0x05, 0x2d, 0x70,
+    0x87, 0x05, 0x2f, 0xfb, 0x02, 0x44, 0x30, 0x8b, 0x05, 0x29, 0xf9, 0x83,
+    0x05, 0x2b, 0x31, 0x91, 0x05, 0x2e, 0xbb, 0x02, 0x44, 0x34, 0x97, 0x05,
+    0x2d, 0x80, 0x87, 0x05, 0x30, 0x03, 0x02, 0x44, 0x38, 0x8b, 0x05, 0x2a,
+    0x01, 0x83, 0x05, 0x2b, 0x39, 0x91, 0x05, 0x2e, 0xc3, 0x02, 0x44, 0x3c,
+    0x97, 0x05, 0x2d, 0x88, 0x87, 0x05, 0x30, 0x13, 0x02, 0x44, 0x40, 0x8b,
+    0x05, 0x2a, 0x11, 0x83, 0x05, 0x2b, 0x49, 0x91, 0x05, 0x2e, 0xd3, 0x02,
+    0x44, 0x44, 0x97, 0x05, 0x2d, 0x98, 0x90, 0x05, 0x29, 0x28, 0x90, 0x05,
+    0x2a, 0x50, 0x91, 0x05, 0x2b, 0x8b, 0x02, 0x44, 0x48, 0x90, 0x05, 0x2d,
+    0xd8, 0x90, 0x05, 0x2c, 0xb0, 0xc4, 0xe2, 0xaf, 0x05, 0x30, 0x99, 0xc2,
+    0x04, 0xc6, 0x05, 0x30, 0xc0, 0xc4, 0xe2, 0xaf, 0x05, 0x30, 0xa1, 0xc3,
+    0x38, 0x86, 0x05, 0x30, 0xe0, 0xc3, 0x00, 0x74, 0x05, 0x30, 0xa9, 0xc2,
+    0x04, 0xc6, 0x05, 0x30, 0xc9, 0xc3, 0x08, 0x48, 0x05, 0x30, 0xe8, 0xc3,
+    0x01, 0x95, 0x05, 0x30, 0xd1, 0x11, 0x42, 0x44, 0x4c, 0xc9, 0x57, 0x36,
+    0x01, 0x1e, 0x81, 0x45, 0x00, 0x8c, 0x42, 0x44, 0x58, 0xc7, 0x33, 0xdf,
+    0x00, 0x00, 0x5b, 0x02, 0x44, 0x64, 0xc4, 0x3b, 0x19, 0x01, 0x5b, 0xf8,
+    0x00, 0x42, 0x44, 0x6a, 0xcb, 0x99, 0x1e, 0x01, 0x81, 0xa0, 0xcf, 0x15,
+    0x36, 0x0f, 0xbd, 0xf9, 0xd2, 0x22, 0x49, 0x0f, 0xbe, 0x80, 0xc6, 0x02,
+    0xd1, 0x0f, 0xbc, 0x41, 0xc6, 0x0b, 0x09, 0x0f, 0xbc, 0x90, 0xc6, 0x27,
+    0x5e, 0x0f, 0xb3, 0xe1, 0xc6, 0x13, 0x52, 0x0f, 0xbd, 0x69, 0xd2, 0x4d,
+    0x57, 0x0f, 0xbd, 0xc8, 0xce, 0x70, 0x5e, 0x00, 0xe7, 0x89, 0xcb, 0x95,
+    0x98, 0x00, 0xe7, 0x5b, 0x02, 0x44, 0x76, 0xcc, 0x88, 0xc5, 0x00, 0xe7,
+    0x51, 0xcc, 0x14, 0x41, 0x00, 0xe7, 0x48, 0xc8, 0x74, 0xc4, 0x00, 0xe7,
+    0x31, 0xc6, 0x74, 0xc6, 0x00, 0xe7, 0x20, 0xca, 0xa5, 0x12, 0x00, 0xe7,
+    0x40, 0xca, 0xa5, 0x12, 0x00, 0xe7, 0x38, 0xca, 0x9e, 0xe6, 0x00, 0xe7,
+    0xc9, 0xc7, 0x02, 0x40, 0x00, 0xe6, 0xd0, 0xe0, 0x02, 0x27, 0x00, 0xe7,
+    0x00, 0xca, 0xa4, 0x90, 0x00, 0xe6, 0xc8, 0x43, 0x00, 0x4b, 0xc2, 0x44,
+    0x7c, 0xcc, 0x8b, 0x11, 0x70, 0x01, 0xe0, 0x4f, 0x0b, 0x17, 0xc2, 0x44,
+    0x8e, 0x4d, 0x29, 0xb9, 0x42, 0x44, 0xf6, 0x42, 0x0a, 0x8c, 0xc2, 0x45,
+    0x5e, 0xc3, 0x0d, 0xe5, 0x70, 0x01, 0xd0, 0xce, 0x25, 0xad, 0x70, 0x02,
+    0xe9, 0xcb, 0x1a, 0x50, 0x70, 0x01, 0x49, 0xcd, 0x00, 0x32, 0x70, 0x03,
+    0xe8, 0xc4, 0x26, 0x78, 0x70, 0x01, 0xc9, 0xc5, 0x06, 0xdb, 0x70, 0x01,
+    0xc1, 0x15, 0xc2, 0x45, 0x68, 0x08, 0xc2, 0x45, 0x74, 0x16, 0xc2, 0x45,
+    0x80, 0xc3, 0x05, 0x14, 0x70, 0x01, 0x89, 0xc4, 0x15, 0xe7, 0x70, 0x01,
+    0x80, 0x83, 0x00, 0xbb, 0x41, 0xc2, 0x01, 0x30, 0x00, 0xbb, 0x28, 0xc9,
+    0xa9, 0xc6, 0x00, 0xb8, 0xf8, 0x83, 0x00, 0xb8, 0x41, 0xc2, 0x01, 0x30,
+    0x00, 0xb8, 0x28, 0x24, 0xc2, 0x45, 0x8c, 0x23, 0xc2, 0x45, 0xa8, 0x22,
+    0xc2, 0x45, 0xd0, 0x21, 0xc2, 0x45, 0xf8, 0x20, 0xc2, 0x46, 0x20, 0x1f,
+    0xc2, 0x46, 0x48, 0x1e, 0xc2, 0x46, 0x70, 0x1d, 0x42, 0x46, 0x98, 0xc4,
+    0x26, 0x78, 0x0b, 0x56, 0x49, 0xc5, 0x06, 0xdb, 0x0b, 0x56, 0x41, 0x15,
+    0xc2, 0x46, 0xc0, 0x08, 0xc2, 0x46, 0xcc, 0x16, 0xc2, 0x46, 0xd8, 0xc3,
+    0x05, 0x14, 0x0b, 0x56, 0x09, 0xc4, 0x15, 0xe7, 0x0b, 0x56, 0x00, 0xc2,
+    0x02, 0x1c, 0x0b, 0x55, 0xf1, 0x05, 0xc2, 0x46, 0xe4, 0x06, 0xc2, 0x46,
+    0xee, 0x08, 0xc2, 0x46, 0xf8, 0xc2, 0x8d, 0x8f, 0x0b, 0x55, 0xd1, 0x16,
+    0xc2, 0x47, 0x02, 0x0a, 0xc2, 0x47, 0x12, 0x09, 0xc2, 0x47, 0x1a, 0x15,
+    0xc2, 0x47, 0x24, 0x10, 0xc2, 0x47, 0x2c, 0xc2, 0x00, 0x39, 0x0b, 0x55,
+    0x91, 0x0e, 0xc2, 0x47, 0x42, 0x0f, 0xc2, 0x47, 0x4c, 0xc2, 0x01, 0x5d,
+    0x0b, 0x55, 0x51, 0x12, 0xc2, 0x47, 0x60, 0xc2, 0x01, 0x4a, 0x0b, 0x55,
+    0x31, 0xc2, 0x19, 0x2c, 0x0b, 0x55, 0x29, 0x0d, 0xc2, 0x47, 0x6a, 0x17,
+    0xc2, 0x47, 0x74, 0x03, 0xc2, 0x47, 0x8c, 0x0b, 0xc2, 0x47, 0xa0, 0x07,
+    0xc2, 0x47, 0xb0, 0x18, 0xc2, 0x47, 0xc0, 0x11, 0x42, 0x47, 0xd0, 0x18,
+    0xc2, 0x47, 0xe0, 0x42, 0x14, 0x48, 0xc2, 0x47, 0xee, 0x0d, 0xc2, 0x48,
+    0x00, 0x12, 0xc2, 0x48, 0x0a, 0xc7, 0xb4, 0xa5, 0x08, 0xfe, 0xc1, 0x03,
+    0xc2, 0x48, 0x14, 0xc6, 0xcd, 0xd9, 0x08, 0xfe, 0xb1, 0xc3, 0x1e, 0xe5,
+    0x08, 0xfe, 0xa8, 0xcb, 0x97, 0x9d, 0x08, 0xff, 0x49, 0xcb, 0x97, 0xa8,
+    0x08, 0xff, 0x40, 0x83, 0x00, 0x5c, 0x2b, 0x02, 0x48, 0x20, 0x8b, 0x00,
+    0x5c, 0x3b, 0x02, 0x48, 0x2c, 0x97, 0x00, 0x5c, 0x4b, 0x02, 0x48, 0x30,
+    0x87, 0x00, 0x5c, 0x73, 0x02, 0x48, 0x34, 0x91, 0x00, 0x5c, 0x93, 0x02,
+    0x48, 0x38, 0xc2, 0x02, 0x2b, 0x00, 0x5c, 0xa9, 0x10, 0xc2, 0x48, 0x3c,
+    0xc2, 0x00, 0x64, 0x00, 0x5c, 0xd1, 0xc2, 0x25, 0x3b, 0x00, 0x5c, 0xe1,
+    0x16, 0xc2, 0x48, 0x50, 0xc2, 0x00, 0xb0, 0x00, 0x5d, 0x51, 0xc2, 0x01,
+    0xc3, 0x00, 0x5d, 0x71, 0xc2, 0x19, 0x2c, 0x00, 0x5d, 0x79, 0x14, 0xc2,
+    0x48, 0x5a, 0x0e, 0xc2, 0x48, 0x64, 0xc2, 0x02, 0x41, 0x00, 0x5d, 0xa9,
+    0x15, 0xc2, 0x48, 0x6c, 0xc2, 0x00, 0xd0, 0x00, 0x5d, 0xc8, 0xc4, 0x15,
+    0xe7, 0x00, 0x5f, 0x31, 0xc3, 0x05, 0x14, 0x00, 0x5f, 0x39, 0x16, 0xc2,
+    0x48, 0x7c, 0x08, 0xc2, 0x48, 0x88, 0x15, 0xc2, 0x48, 0x94, 0xc5, 0x06,
+    0xdb, 0x00, 0x5f, 0x71, 0xc4, 0x26, 0x78, 0x00, 0x5f, 0x78, 0xc8, 0x08,
+    0x79, 0x08, 0xfe, 0x99, 0x44, 0x22, 0xcb, 0xc2, 0x48, 0xa0, 0xca, 0x1e,
+    0x15, 0x08, 0xfe, 0x69, 0xca, 0xa3, 0xfa, 0x08, 0xfe, 0x30, 0x45, 0x27,
+    0x7a, 0xc2, 0x48, 0xac, 0xc7, 0x08, 0x79, 0x08, 0xfe, 0x81, 0x08, 0xc2,
+    0x48, 0xb4, 0x45, 0x06, 0xdb, 0xc2, 0x48, 0xc0, 0x16, 0xc2, 0x48, 0xca,
+    0x44, 0x22, 0xcb, 0xc2, 0x48, 0xda, 0xd8, 0x22, 0xbb, 0x08, 0xfe, 0x08,
+    0x83, 0x00, 0x5d, 0xf1, 0x8b, 0x00, 0x5e, 0x41, 0x97, 0x00, 0x5e, 0x60,
+    0x8b, 0x00, 0x5e, 0x00, 0x97, 0x00, 0x5e, 0x10, 0x87, 0x00, 0x5e, 0x38,
+    0x91, 0x00, 0x5e, 0x58, 0xc7, 0x0d, 0x04, 0x00, 0x5f, 0x89, 0xc8, 0x4b,
+    0x94, 0x00, 0x5f, 0x90, 0xc4, 0x18, 0x10, 0x08, 0xb6, 0x39, 0xc2, 0x22,
+    0xcc, 0x08, 0xb6, 0x30, 0xc3, 0x0d, 0x14, 0x08, 0xb6, 0x29, 0xc3, 0x09,
+    0x9e, 0x08, 0xb6, 0x20, 0xc4, 0x02, 0xde, 0x08, 0xb6, 0x19, 0xc2, 0x02,
+    0xa0, 0x08, 0xb6, 0x10, 0xca, 0x9e, 0xaa, 0x08, 0xb5, 0xc1, 0x97, 0x08,
+    0xb4, 0x49, 0x8b, 0x08, 0xb4, 0x39, 0x83, 0x08, 0xb4, 0x08, 0xc2, 0x00,
+    0x39, 0x08, 0xb5, 0x51, 0x83, 0x08, 0xb5, 0x20, 0x83, 0x08, 0xb5, 0x41,
+    0xc2, 0x00, 0xd0, 0x08, 0xb5, 0x38, 0xc2, 0x00, 0xd0, 0x08, 0xb5, 0x09,
+    0x83, 0x08, 0xb5, 0x00, 0xc2, 0x00, 0xd0, 0x08, 0xb4, 0xf9, 0x83, 0x08,
+    0xb4, 0xf0, 0x83, 0x08, 0xb4, 0xe9, 0xc2, 0x00, 0xc1, 0x08, 0xb4, 0xc1,
+    0xc2, 0x19, 0x2c, 0x08, 0xb4, 0x99, 0xc2, 0x01, 0x30, 0x08, 0xb4, 0x70,
+    0xc2, 0x00, 0xd0, 0x08, 0xb4, 0xe1, 0x83, 0x08, 0xb4, 0xd9, 0x06, 0x42,
+    0x48, 0xe6, 0xc2, 0x00, 0xd0, 0x08, 0xb4, 0xd1, 0x83, 0x08, 0xb4, 0xc9,
+    0x16, 0x42, 0x48, 0xf0, 0xc2, 0x00, 0xd0, 0x08, 0xb4, 0x91, 0x83, 0x08,
+    0xb4, 0x88, 0xc2, 0x00, 0xd0, 0x08, 0xb4, 0x81, 0x83, 0x08, 0xb4, 0x78,
+    0xc2, 0x00, 0xd0, 0x08, 0xb4, 0x69, 0x83, 0x08, 0xb4, 0x60, 0xc2, 0x00,
+    0xd0, 0x08, 0xb4, 0x59, 0x83, 0x08, 0xb4, 0x50, 0x97, 0x08, 0xb4, 0x28,
+    0x8b, 0x08, 0xb4, 0x18, 0xc4, 0x1e, 0x97, 0x08, 0xb5, 0xb1, 0xc5, 0x40,
+    0xe7, 0x08, 0xb5, 0x60, 0x97, 0x08, 0xb5, 0xa9, 0x8b, 0x08, 0xb5, 0x99,
+    0x83, 0x08, 0xb5, 0x68, 0x97, 0x08, 0xb5, 0x88, 0x8b, 0x08, 0xb5, 0x78,
+    0xc3, 0x01, 0x95, 0x00, 0xd5, 0x61, 0xc2, 0x69, 0xa6, 0x00, 0xd5, 0x20,
+    0xc5, 0xd7, 0x04, 0x00, 0xd5, 0x53, 0x02, 0x48, 0xfa, 0xc3, 0x29, 0xf7,
+    0x00, 0xd5, 0x11, 0xc3, 0x1c, 0x9f, 0x00, 0xd3, 0x00, 0xc3, 0x04, 0xc6,
+    0x00, 0xd5, 0x43, 0x02, 0x49, 0x00, 0xc3, 0x3f, 0x6f, 0x00, 0xd5, 0x19,
+    0x44, 0xdf, 0xcf, 0x42, 0x49, 0x06, 0xc5, 0xd4, 0x98, 0x00, 0xd5, 0x39,
+    0xc3, 0x71, 0xe5, 0x00, 0xd3, 0xd9, 0xc4, 0xe0, 0xe3, 0x00, 0xd3, 0xa2,
+    0x02, 0x49, 0x12, 0xd4, 0x3c, 0x78, 0x00, 0xd5, 0x31, 0xc6, 0xd1, 0x81,
+    0x00, 0xd3, 0xd0, 0xc4, 0xde, 0xb7, 0x00, 0xd5, 0x08, 0x9f, 0x00, 0xd3,
+    0xb1, 0x9e, 0x00, 0xd3, 0xa8, 0xc4, 0x18, 0x10, 0x00, 0xd4, 0xb9, 0xc2,
+    0x22, 0xcc, 0x00, 0xd4, 0xb0, 0xc3, 0x0d, 0x14, 0x00, 0xd4, 0xa9, 0xc3,
+    0x09, 0x9e, 0x00, 0xd4, 0xa0, 0xc4, 0x02, 0xde, 0x00, 0xd4, 0x99, 0xc2,
+    0x02, 0xa0, 0x00, 0xd4, 0x90, 0xc4, 0x18, 0x10, 0x00, 0xd4, 0x39, 0xc2,
+    0x22, 0xcc, 0x00, 0xd4, 0x30, 0xc3, 0x0d, 0x14, 0x00, 0xd4, 0x29, 0xc3,
+    0x09, 0x9e, 0x00, 0xd4, 0x20, 0xc4, 0x02, 0xde, 0x00, 0xd4, 0x19, 0xc2,
+    0x02, 0xa0, 0x00, 0xd4, 0x10, 0xc2, 0x0d, 0xf6, 0x00, 0xd2, 0xf1, 0xc2,
+    0x01, 0x5d, 0x00, 0xd2, 0xe9, 0x0f, 0xc2, 0x49, 0x18, 0xd4, 0x3c, 0xf0,
+    0x00, 0xd2, 0xd9, 0x0e, 0xc2, 0x49, 0x22, 0xc9, 0xb4, 0x2e, 0x00, 0xd2,
+    0xc8, 0x42, 0x01, 0x31, 0xc2, 0x49, 0x2e, 0x91, 0x00, 0xd3, 0x81, 0x9b,
+    0x00, 0xd3, 0x68, 0xc6, 0xd2, 0xbf, 0x00, 0xd3, 0x91, 0xc6, 0xc6, 0xb8,
+    0x00, 0xd3, 0x20, 0x8b, 0x00, 0xd3, 0x89, 0x87, 0x00, 0xd3, 0x79, 0x83,
+    0x00, 0xd3, 0x18, 0x97, 0x00, 0xd3, 0x53, 0x02, 0x49, 0x3a, 0x87, 0x00,
+    0xd3, 0x38, 0x8b, 0x00, 0xd3, 0x30, 0x83, 0x00, 0xd2, 0x1b, 0x02, 0x49,
+    0x3e, 0x43, 0x02, 0x5f, 0xc2, 0x49, 0x42, 0xc2, 0x00, 0xdb, 0x00, 0xd2,
+    0x51, 0xc2, 0x0f, 0xe1, 0x00, 0xd2, 0x20, 0x97, 0x00, 0xd2, 0x80, 0x8b,
+    0x00, 0xd2, 0x70, 0xc2, 0x00, 0xd0, 0x00, 0xd2, 0x49, 0x15, 0xc2, 0x49,
+    0x70, 0xc2, 0x19, 0x2c, 0x00, 0xd2, 0x01, 0xc2, 0x00, 0x87, 0x00, 0xd1,
+    0xd1, 0x12, 0xc2, 0x49, 0x80, 0x16, 0xc2, 0x49, 0x8a, 0xc5, 0x3c, 0xf5,
+    0x00, 0xd1, 0x71, 0x05, 0xc2, 0x49, 0x94, 0x0d, 0x42, 0x49, 0x9e, 0xc2,
+    0x0f, 0xe1, 0x00, 0xd2, 0x11, 0x83, 0x00, 0xd2, 0x0a, 0x02, 0x49, 0xae,
+    0x83, 0x00, 0xd1, 0xb1, 0xc2, 0x19, 0x2c, 0x00, 0xd1, 0x61, 0xc2, 0x01,
+    0x30, 0x00, 0xd1, 0x30, 0xa3, 0x00, 0xcb, 0xa1, 0xa2, 0x00, 0xcb, 0x99,
+    0xa1, 0x00, 0xcb, 0x91, 0xa0, 0x00, 0xcb, 0x89, 0x9f, 0x00, 0xcb, 0x80,
+    0xc2, 0x00, 0xd0, 0x00, 0xcb, 0x09, 0x83, 0x00, 0xca, 0x98, 0xc5, 0xd8,
+    0x3f, 0x05, 0x56, 0xf9, 0x90, 0x05, 0x56, 0xd8, 0x8f, 0x05, 0x55, 0xf1,
+    0x90, 0x05, 0x55, 0xe9, 0x9b, 0x05, 0x55, 0xe1, 0xc2, 0x0f, 0xe1, 0x05,
+    0x55, 0xd9, 0x83, 0x05, 0x55, 0x88, 0x83, 0x05, 0x55, 0xd1, 0x87, 0x05,
+    0x55, 0x9a, 0x02, 0x49, 0xba, 0x83, 0x05, 0x55, 0xc0, 0x91, 0x05, 0x55,
+    0x79, 0xc2, 0x01, 0x23, 0x05, 0x55, 0x69, 0xc2, 0x17, 0xbd, 0x05, 0x55,
+    0x59, 0xc2, 0x01, 0xc8, 0x05, 0x55, 0x49, 0xc2, 0x00, 0x79, 0x05, 0x55,
+    0x39, 0xc2, 0x42, 0xcd, 0x05, 0x55, 0x29, 0xc2, 0x00, 0xa2, 0x05, 0x55,
+    0x19, 0xc2, 0x01, 0x03, 0x05, 0x55, 0x09, 0x12, 0xc2, 0x49, 0xbe, 0xc2,
+    0x00, 0x6b, 0x05, 0x54, 0xd9, 0x10, 0xc2, 0x49, 0xc8, 0x16, 0xc2, 0x49,
+    0xd8, 0xc2, 0x00, 0x58, 0x05, 0x54, 0x99, 0x05, 0xc2, 0x49, 0xe2, 0xc2,
+    0x0f, 0x7b, 0x05, 0x54, 0x39, 0x0d, 0xc2, 0x49, 0xec, 0xc2, 0x00, 0xfb,
+    0x05, 0x54, 0x78, 0x91, 0x05, 0x55, 0x71, 0xc2, 0x01, 0x23, 0x05, 0x55,
+    0x61, 0xc2, 0x17, 0xbd, 0x05, 0x55, 0x51, 0xc2, 0x01, 0xc8, 0x05, 0x55,
+    0x41, 0xc2, 0x00, 0x79, 0x05, 0x55, 0x31, 0xc2, 0x42, 0xcd, 0x05, 0x55,
+    0x21, 0xc2, 0x00, 0xa2, 0x05, 0x55, 0x11, 0xc2, 0x01, 0x03, 0x05, 0x55,
+    0x01, 0x12, 0xc2, 0x49, 0xf4, 0xc2, 0x00, 0x6b, 0x05, 0x54, 0xd1, 0x10,
+    0xc2, 0x49, 0xfe, 0x16, 0xc2, 0x4a, 0x0e, 0xc2, 0x00, 0x58, 0x05, 0x54,
+    0x91, 0x05, 0xc2, 0x4a, 0x18, 0xc2, 0x0f, 0x7b, 0x05, 0x54, 0x31, 0x0d,
+    0xc2, 0x4a, 0x22, 0xc2, 0x00, 0xfb, 0x05, 0x54, 0x70, 0xd2, 0x49, 0xe5,
+    0x0f, 0xb2, 0xb1, 0xd2, 0x47, 0x15, 0x0f, 0xb2, 0xa0, 0xc4, 0x02, 0xde,
+    0x01, 0x0c, 0x59, 0xc2, 0x02, 0xa0, 0x01, 0x0c, 0x50, 0x9b, 0x01, 0x0a,
+    0x21, 0x8e, 0x01, 0x0a, 0x11, 0x89, 0x01, 0x0a, 0x08, 0xd2, 0x49, 0xe5,
+    0x0f, 0xb2, 0xb9, 0xd2, 0x47, 0x15, 0x0f, 0xb2, 0xa8, 0xc4, 0x00, 0x49,
+    0x01, 0x34, 0xf9, 0xc5, 0x00, 0x2c, 0x01, 0x34, 0xf0, 0xc5, 0x00, 0x2c,
+    0x0f, 0xaf, 0x39, 0xc4, 0x00, 0x49, 0x0f, 0xaf, 0x31, 0xc5, 0x05, 0x02,
+    0x0f, 0xaf, 0x29, 0xc5, 0x00, 0xd4, 0x0f, 0xaf, 0x20, 0x4b, 0x03, 0x87,
+    0xc2, 0x4a, 0x2a, 0xdf, 0x0d, 0x7c, 0x01, 0x5c, 0xc0, 0xe0, 0x0b, 0xe7,
+    0x01, 0x5c, 0xc8, 0xe0, 0x07, 0xe7, 0x01, 0x3d, 0x18, 0xe0, 0x03, 0xc7,
+    0x01, 0x5c, 0xd8, 0xc6, 0x13, 0x52, 0x0f, 0xbd, 0x41, 0xc4, 0x40, 0x89,
+    0x01, 0x00, 0x48, 0xc5, 0xd6, 0x91, 0x00, 0x3d, 0x19, 0xc8, 0xb8, 0x1a,
+    0x00, 0x3c, 0x79, 0xc4, 0xd8, 0x3b, 0x00, 0x3c, 0x70, 0x91, 0x00, 0x3d,
+    0x01, 0xc7, 0xb4, 0xdb, 0x00, 0x3c, 0x99, 0xc3, 0x39, 0x6e, 0x00, 0x3c,
+    0x63, 0x02, 0x4a, 0x36, 0xc3, 0x04, 0xc5, 0x00, 0x3c, 0xc0, 0x03, 0xc2,
+    0x4a, 0x3c, 0xc5, 0xd7, 0x22, 0x00, 0x3c, 0x58, 0xc5, 0xd9, 0x20, 0x00,
+    0x3c, 0xf1, 0x0a, 0xc2, 0x4a, 0x48, 0xc4, 0xe2, 0xd7, 0x00, 0x3c, 0x80,
+    0xc3, 0x39, 0x6e, 0x00, 0x3c, 0xc9, 0xc2, 0x04, 0xc6, 0x00, 0x3c, 0x00,
+    0x03, 0xc2, 0x4a, 0x54, 0x91, 0x00, 0x3d, 0x08, 0xc4, 0xe1, 0xff, 0x00,
+    0x3c, 0x69, 0xc8, 0xb4, 0xda, 0x00, 0x3c, 0x28, 0xc4, 0xe1, 0x03, 0x00,
+    0x3c, 0x39, 0xc3, 0x16, 0xc3, 0x00, 0x3d, 0x10, 0xc4, 0xd8, 0x3b, 0x00,
+    0x3c, 0x31, 0xc3, 0x39, 0x6e, 0x00, 0x3c, 0xd0, 0xc4, 0x2b, 0xa7, 0x00,
+    0x3c, 0x11, 0xc2, 0x04, 0xc6, 0x00, 0x3d, 0x88, 0x0d, 0xc2, 0x4a, 0x5e,
+    0x10, 0xc2, 0x4a, 0x6a, 0x46, 0xcc, 0x6b, 0xc2, 0x4a, 0x7c, 0x15, 0xc2,
+    0x4a, 0x91, 0x1b, 0xc2, 0x4a, 0x9d, 0x43, 0x5d, 0x85, 0xc2, 0x4a, 0xa9,
+    0x16, 0xc2, 0x4a, 0xb5, 0xc9, 0xb4, 0x0a, 0x00, 0x70, 0xd1, 0x12, 0xc2,
+    0x4a, 0xbf, 0x42, 0x01, 0x03, 0xc2, 0x4a, 0xcf, 0x0f, 0xc2, 0x4a, 0xde,
+    0x14, 0xc2, 0x4a, 0xea, 0x0e, 0xc2, 0x4a, 0xf4, 0xc7, 0xc2, 0x5e, 0x00,
+    0x71, 0x39, 0x43, 0x60, 0xe8, 0xc2, 0x4b, 0x04, 0xc5, 0xd9, 0xd9, 0x00,
+    0x71, 0x69, 0xca, 0x9e, 0xbe, 0x00, 0x72, 0xd0, 0xc2, 0x02, 0xa0, 0x00,
+    0x72, 0x91, 0xc4, 0x02, 0xde, 0x00, 0x72, 0x98, 0xc3, 0x09, 0x9e, 0x00,
+    0x72, 0xa1, 0xc3, 0x0d, 0x14, 0x00, 0x72, 0xa8, 0xc2, 0x22, 0xcc, 0x00,
+    0x72, 0xb1, 0xc4, 0x18, 0x10, 0x00, 0x72, 0xb8, 0x87, 0x0f, 0x15, 0x58,
+    0x47, 0xc2, 0xe3, 0xc2, 0x4b, 0x10, 0x83, 0x0f, 0x14, 0x88, 0x91, 0x0f,
+    0x15, 0x40, 0x97, 0x0f, 0x15, 0x18, 0xc2, 0x01, 0x30, 0x0f, 0x14, 0xc1,
+    0x83, 0x0f, 0x14, 0xb8, 0xd0, 0x59, 0x72, 0x01, 0x4e, 0x69, 0xc8, 0x52,
+    0x09, 0x01, 0x4e, 0x59, 0xc9, 0x16, 0x14, 0x01, 0x4e, 0x51, 0xcf, 0x13,
+    0x5e, 0x0f, 0xb6, 0x30, 0xc4, 0x55, 0x73, 0x0e, 0x9a, 0x49, 0xc9, 0xaf,
+    0x15, 0x0e, 0x99, 0xe0, 0xc5, 0xba, 0x65, 0x0e, 0x9a, 0x91, 0xc5, 0x08,
+    0xe6, 0x0e, 0x9a, 0x70, 0xc6, 0xd0, 0x55, 0x0e, 0x99, 0xc1, 0x16, 0x42,
+    0x4b, 0x24, 0xc7, 0xc0, 0x58, 0x0e, 0x99, 0xe9, 0xc4, 0x1d, 0xa8, 0x0e,
+    0x99, 0x30, 0xc5, 0xd7, 0x63, 0x0e, 0x9a, 0x61, 0xc2, 0x00, 0x5f, 0x0e,
+    0x99, 0x88, 0xc5, 0xd7, 0x7c, 0x0e, 0x99, 0x71, 0x0b, 0x42, 0x4b, 0x36,
+    0xc5, 0x7c, 0xec, 0x01, 0x18, 0xa9, 0xc5, 0x36, 0xc0, 0x0f, 0xa6, 0xf2,
+    0x02, 0x4b, 0x42, 0x49, 0x29, 0x29, 0xc2, 0x4b, 0x48, 0xca, 0x1e, 0x8a,
+    0x00, 0x60, 0x08, 0xc7, 0x14, 0x39, 0x00, 0x60, 0x11, 0xc7, 0x7a, 0x7f,
+    0x00, 0x61, 0xe8, 0xc5, 0x40, 0xe7, 0x00, 0x60, 0x19, 0xc4, 0x1e, 0x97,
+    0x00, 0x62, 0x68, 0x83, 0x00, 0x60, 0x2b, 0x02, 0x4b, 0x54, 0x8b, 0x00,
+    0x60, 0x3b, 0x02, 0x4b, 0x60, 0x97, 0x00, 0x60, 0x4b, 0x02, 0x4b, 0x64,
+    0x18, 0xc2, 0x4b, 0x68, 0x87, 0x00, 0x60, 0x73, 0x02, 0x4b, 0x72, 0x91,
+    0x00, 0x60, 0x93, 0x02, 0x4b, 0x76, 0x0d, 0xc2, 0x4b, 0x7a, 0x09, 0xc2,
+    0x4b, 0x84, 0x10, 0xc2, 0x4b, 0x8e, 0x05, 0xc2, 0x4b, 0xa7, 0x0c, 0xc2,
+    0x4b, 0xb1, 0x16, 0xc2, 0x4b, 0xbb, 0x06, 0xc2, 0x4b, 0xcf, 0x12, 0xc2,
+    0x4b, 0xe3, 0x04, 0xc2, 0x4b, 0xed, 0xc2, 0x01, 0xc3, 0x00, 0x61, 0x71,
+    0xc2, 0x19, 0x2c, 0x00, 0x61, 0x79, 0x14, 0xc2, 0x4b, 0xf7, 0x0e, 0xc2,
+    0x4b, 0xff, 0x15, 0xc2, 0x4c, 0x07, 0xc2, 0x00, 0xd0, 0x00, 0x61, 0xc8,
+    0x83, 0x00, 0x61, 0xf1, 0x8b, 0x00, 0x62, 0x41, 0x97, 0x00, 0x62, 0x60,
+    0x8b, 0x00, 0x62, 0x00, 0x97, 0x00, 0x62, 0x10, 0x94, 0x00, 0x62, 0x1b,
+    0x02, 0x4c, 0x17, 0x8e, 0x00, 0x63, 0x12, 0x02, 0x4c, 0x1b, 0x87, 0x00,
+    0x62, 0x38, 0x91, 0x00, 0x62, 0x58, 0xc2, 0x02, 0xa0, 0x00, 0x63, 0x41,
+    0xc4, 0x02, 0xde, 0x00, 0x63, 0x48, 0xc3, 0x09, 0x9e, 0x00, 0x63, 0x51,
+    0xc3, 0x0d, 0x14, 0x00, 0x63, 0x58, 0xc2, 0x22, 0xcc, 0x00, 0x63, 0x61,
+    0xc4, 0x18, 0x10, 0x00, 0x63, 0x68, 0xd2, 0x15, 0xf0, 0x00, 0x63, 0xc9,
+    0xd3, 0x45, 0xbf, 0x00, 0x63, 0xe0, 0x47, 0xc3, 0x99, 0xc2, 0x4c, 0x1f,
+    0x49, 0xaa, 0x8c, 0x42, 0x4c, 0x2b, 0x46, 0x00, 0xd4, 0xc2, 0x4c, 0x37,
+    0x45, 0x00, 0x8c, 0x42, 0x4c, 0x43, 0xc5, 0x00, 0xd4, 0x01, 0x70, 0xf1,
+    0xc5, 0x05, 0x02, 0x01, 0x70, 0xf8, 0xc4, 0x18, 0x10, 0x08, 0xa6, 0xb9,
+    0xc2, 0x22, 0xcc, 0x08, 0xa6, 0xb0, 0xc3, 0x0d, 0x14, 0x08, 0xa6, 0xa9,
+    0xc3, 0x09, 0x9e, 0x08, 0xa6, 0xa0, 0xc4, 0x02, 0xde, 0x08, 0xa6, 0x99,
+    0xc2, 0x02, 0xa0, 0x08, 0xa6, 0x90, 0xc7, 0x7a, 0x7f, 0x08, 0xa6, 0x21,
+    0xc7, 0x14, 0x39, 0x08, 0xa6, 0x00, 0xc5, 0x40, 0xe7, 0x08, 0xa6, 0x09,
+    0xc4, 0x1e, 0x97, 0x08, 0xa6, 0x10, 0x97, 0x08, 0xa5, 0xf1, 0x8b, 0x08,
+    0xa5, 0xd9, 0x83, 0x08, 0xa5, 0x80, 0x91, 0x08, 0xa5, 0xe9, 0x87, 0x08,
+    0xa5, 0xd0, 0x8e, 0x08, 0xa5, 0xbb, 0x02, 0x4c, 0x4f, 0x94, 0x08, 0xa5,
+    0xaa, 0x02, 0x4c, 0x53, 0x97, 0x08, 0xa5, 0xa0, 0x8b, 0x08, 0xa5, 0x90,
+    0x83, 0x08, 0xa5, 0x71, 0xc2, 0x0d, 0xf6, 0x08, 0xa5, 0x69, 0xc2, 0x00,
+    0xd0, 0x08, 0xa5, 0x60, 0x83, 0x08, 0xa5, 0x59, 0x47, 0xb2, 0x2e, 0x42,
+    0x4c, 0x57, 0xc2, 0x00, 0xd0, 0x08, 0xa5, 0x31, 0x83, 0x08, 0xa5, 0x28,
+    0xc2, 0x00, 0xd0, 0x08, 0xa5, 0x21, 0x83, 0x08, 0xa5, 0x18, 0x83, 0x08,
+    0xa5, 0x11, 0xc2, 0x00, 0xc1, 0x08, 0xa4, 0xe9, 0xc2, 0x19, 0x2c, 0x08,
+    0xa4, 0xc1, 0xc2, 0x01, 0x30, 0x08, 0xa4, 0x98, 0xc2, 0x00, 0xd0, 0x08,
+    0xa5, 0x09, 0x83, 0x08, 0xa5, 0x01, 0x06, 0x42, 0x4c, 0x65, 0xc2, 0x00,
+    0xd0, 0x08, 0xa4, 0xf9, 0x83, 0x08, 0xa4, 0xf1, 0x16, 0x42, 0x4c, 0x6f,
+    0xc2, 0x00, 0xd0, 0x08, 0xa4, 0xb9, 0x83, 0x08, 0xa4, 0xb0, 0xc2, 0x00,
+    0xd0, 0x08, 0xa4, 0xa9, 0x83, 0x08, 0xa4, 0xa0, 0xc2, 0x00, 0xd0, 0x08,
+    0xa4, 0x91, 0x83, 0x08, 0xa4, 0x88, 0xc2, 0x00, 0xd0, 0x08, 0xa4, 0x81,
+    0x83, 0x08, 0xa4, 0x78, 0x97, 0x08, 0xa4, 0x71, 0x8b, 0x08, 0xa4, 0x61,
+    0x83, 0x08, 0xa4, 0x10, 0x97, 0x08, 0xa4, 0x30, 0x8b, 0x08, 0xa4, 0x20,
+    0xc7, 0xc2, 0xa4, 0x00, 0x7e, 0x21, 0xc7, 0xc4, 0xfe, 0x00, 0x7e, 0x2b,
+    0x02, 0x4c, 0x79, 0x12, 0xc2, 0x4c, 0x7f, 0xc6, 0xcc, 0x47, 0x00, 0x7e,
+    0x4a, 0x02, 0x4c, 0x8b, 0x44, 0xa9, 0xbe, 0xc2, 0x4c, 0x8f, 0xcd, 0x75,
+    0xf4, 0x00, 0x7b, 0xf1, 0xc8, 0x85, 0x06, 0x00, 0x7b, 0xf8, 0xc7, 0xbe,
+    0xe3, 0x00, 0x79, 0xf1, 0xc8, 0xb8, 0xd2, 0x00, 0x7c, 0x38, 0xc8, 0xbe,
+    0xe2, 0x00, 0x79, 0xf9, 0xc7, 0x4f, 0xa6, 0x00, 0x7c, 0x48, 0xc7, 0xc1,
+    0x3f, 0x00, 0x7c, 0x31, 0xc9, 0x8e, 0x8e, 0x00, 0x7c, 0x40, 0xcb, 0x95,
+    0xda, 0x00, 0x7c, 0x51, 0xcb, 0x99, 0x08, 0x00, 0x7c, 0x58, 0xcb, 0x8e,
+    0x8c, 0x00, 0x7c, 0x69, 0xc8, 0x4f, 0xa5, 0x00, 0x7c, 0x71, 0xd1, 0x4f,
+    0x9c, 0x00, 0x7c, 0x78, 0x0d, 0xc2, 0x4c, 0x9b, 0x09, 0xc2, 0x4c, 0xab,
+    0x10, 0xc2, 0x4c, 0xb5, 0x05, 0xc2, 0x4c, 0xcb, 0xc2, 0x25, 0x3b, 0x00,
+    0x7c, 0xb9, 0x16, 0xc2, 0x4c, 0xd5, 0x06, 0xc2, 0x4c, 0xe7, 0x12, 0xc2,
+    0x4c, 0xf9, 0x04, 0xc2, 0x4d, 0x03, 0xc2, 0x01, 0xc3, 0x00, 0x7d, 0x41,
+    0xc2, 0x01, 0x4a, 0x00, 0x7d, 0x69, 0x1c, 0xc2, 0x4d, 0x0d, 0xc2, 0x00,
+    0x02, 0x00, 0x7d, 0x81, 0xc2, 0x19, 0x2c, 0x00, 0x7d, 0x89, 0xc2, 0x00,
+    0x39, 0x00, 0x7d, 0x91, 0xc2, 0x00, 0xdb, 0x00, 0x7d, 0x99, 0x15, 0xc2,
+    0x4d, 0x17, 0xc2, 0x00, 0xd0, 0x00, 0x7d, 0xb9, 0x83, 0x00, 0x7d, 0xc1,
+    0x4b, 0x7f, 0xe8, 0x42, 0x4d, 0x27, 0x48, 0x16, 0x5f, 0xc2, 0x4d, 0x39,
+    0xc5, 0x32, 0x89, 0x00, 0x78, 0xa0, 0xc2, 0x00, 0x45, 0x00, 0x79, 0xd1,
+    0xc2, 0x02, 0x2c, 0x00, 0x79, 0xd8, 0xcf, 0x16, 0x5f, 0x00, 0x78, 0x21,
+    0xdb, 0x16, 0x53, 0x00, 0x7e, 0x98, 0xcf, 0x16, 0x7a, 0x00, 0x78, 0x29,
+    0xdb, 0x16, 0x6e, 0x00, 0x7e, 0xa0, 0xd4, 0x3f, 0x48, 0x00, 0x78, 0x31,
+    0x4c, 0x82, 0xad, 0x42, 0x4d, 0x45, 0x0d, 0xc2, 0x4d, 0x51, 0xc9, 0xb5,
+    0x0f, 0x00, 0x79, 0xa0, 0xc7, 0x16, 0x5f, 0x00, 0x78, 0x51, 0xcc, 0x2e,
+    0x06, 0x00, 0x7e, 0x80, 0xc4, 0x01, 0xe2, 0x00, 0x78, 0x71, 0xc5, 0x32,
+    0x89, 0x00, 0x7e, 0x92, 0x02, 0x4d, 0x5d, 0xc7, 0x70, 0x50, 0x00, 0x79,
+    0xa9, 0xca, 0xa3, 0xe6, 0x00, 0x79, 0xb8, 0xc8, 0x32, 0x8b, 0x00, 0x78,
+    0x79, 0xc7, 0xc1, 0x70, 0x00, 0x79, 0xc8, 0x83, 0x00, 0x7a, 0x01, 0xc2,
+    0x00, 0xd0, 0x00, 0x7a, 0x09, 0xc3, 0x1d, 0x35, 0x00, 0x7b, 0x49, 0xc2,
+    0x02, 0x2b, 0x00, 0x7b, 0x58, 0x83, 0x00, 0x7a, 0x11, 0xc2, 0x00, 0xd0,
+    0x00, 0x7a, 0x18, 0xc2, 0x01, 0x30, 0x00, 0x7a, 0x21, 0xc2, 0x19, 0x2c,
+    0x00, 0x7a, 0x49, 0xc2, 0x00, 0xc1, 0x00, 0x7a, 0x71, 0x83, 0x00, 0x7a,
+    0x98, 0x83, 0x00, 0x7a, 0x29, 0xc2, 0x00, 0xd0, 0x00, 0x7a, 0x30, 0x16,
+    0xc2, 0x4d, 0x63, 0x83, 0x00, 0x7a, 0x79, 0xc2, 0x00, 0xd0, 0x00, 0x7a,
+    0x81, 0x15, 0x42, 0x4d, 0x6d, 0x06, 0xc2, 0x4d, 0x77, 0x83, 0x00, 0x7a,
+    0x89, 0xc2, 0x00, 0xd0, 0x00, 0x7a, 0x91, 0x1c, 0x42, 0x4d, 0x81, 0x83,
+    0x00, 0x7a, 0xa1, 0xc2, 0x00, 0xd0, 0x00, 0x7a, 0xa8, 0x83, 0x00, 0x7a,
+    0xb1, 0xc2, 0x00, 0xd0, 0x00, 0x7a, 0xb8, 0xc2, 0x00, 0xd0, 0x00, 0x7a,
+    0xf1, 0x83, 0x00, 0x7a, 0xf8, 0x83, 0x00, 0x7b, 0x11, 0xc2, 0x00, 0x39,
+    0x00, 0x7b, 0x60, 0xc2, 0x00, 0xd0, 0x00, 0x7b, 0x21, 0xc2, 0x0d, 0xf6,
+    0x00, 0x7b, 0x29, 0x83, 0x00, 0x7b, 0x30, 0xc2, 0x02, 0xa0, 0x00, 0x79,
+    0x59, 0xc4, 0x02, 0xde, 0x00, 0x79, 0x60, 0xc3, 0x09, 0x9e, 0x00, 0x79,
+    0x69, 0xc3, 0x0d, 0x14, 0x00, 0x79, 0x70, 0xc2, 0x22, 0xcc, 0x00, 0x79,
+    0x79, 0xc4, 0x18, 0x10, 0x00, 0x79, 0x80, 0x94, 0x00, 0x7b, 0xb8, 0x8e,
+    0x00, 0x7b, 0xc8, 0x84, 0x01, 0x69, 0x8b, 0x02, 0x4d, 0x8b, 0x89, 0x01,
+    0x69, 0x9b, 0x02, 0x4d, 0x8f, 0x8c, 0x01, 0x69, 0xb1, 0x86, 0x01, 0x69,
+    0xbb, 0x02, 0x4d, 0x96, 0x88, 0x01, 0x69, 0xe1, 0x8d, 0x01, 0x69, 0xeb,
+    0x02, 0x4d, 0xa1, 0x8a, 0x01, 0x6a, 0x03, 0x02, 0x4d, 0xa8, 0x83, 0x01,
+    0x6a, 0x21, 0x93, 0x01, 0x6a, 0x39, 0x9c, 0x01, 0x6b, 0x1b, 0x02, 0x4d,
+    0xac, 0x8e, 0x01, 0x6a, 0x69, 0x8f, 0x01, 0x6a, 0x71, 0x90, 0x01, 0x6a,
+    0x79, 0x92, 0x01, 0x6a, 0x91, 0x94, 0x01, 0x6a, 0xa3, 0x02, 0x4d, 0xb4,
+    0x95, 0x01, 0x6a, 0xcb, 0x02, 0x4d, 0xb8, 0x96, 0x01, 0x6a, 0xe3, 0x02,
+    0x4d, 0xc0, 0xc2, 0x11, 0xee, 0x01, 0x6a, 0xf1, 0x98, 0x01, 0x6b, 0x01,
+    0x99, 0x01, 0x6b, 0x09, 0x9b, 0x01, 0x6b, 0x10, 0x9b, 0x01, 0x69, 0xd8,
+    0x8d, 0x01, 0x69, 0xf3, 0x02, 0x4d, 0xc8, 0x8a, 0x01, 0x6a, 0x11, 0x93,
+    0x01, 0x6a, 0x41, 0xc2, 0x25, 0xa1, 0x01, 0x6a, 0x61, 0x09, 0xc2, 0x4d,
+    0xcc, 0xc2, 0x00, 0x75, 0x01, 0x6a, 0x88, 0xcb, 0x05, 0x1c, 0x01, 0x02,
+    0xd1, 0xc6, 0x72, 0x26, 0x01, 0x01, 0x28, 0x0c, 0xc2, 0x4d, 0xd4, 0x0a,
+    0xc2, 0x4d, 0xe0, 0x15, 0xc2, 0x4d, 0xec, 0x4b, 0x92, 0x75, 0xc2, 0x4e,
+    0x00, 0x03, 0xc2, 0x4e, 0x18, 0x16, 0xc2, 0x4e, 0x2e, 0x49, 0xab, 0xf4,
+    0xc2, 0x4e, 0x3c, 0x4a, 0x60, 0x7b, 0xc2, 0x4e, 0x70, 0x0d, 0xc2, 0x4e,
+    0xa4, 0x49, 0x0d, 0xff, 0xc2, 0x4e, 0xb0, 0x13, 0xc2, 0x4e, 0xd2, 0x49,
+    0xb1, 0x0d, 0xc2, 0x4e, 0xdc, 0x04, 0xc2, 0x4f, 0x00, 0x14, 0xc2, 0x4f,
+    0x0c, 0x0f, 0xc2, 0x4f, 0x16, 0x4e, 0x74, 0x6a, 0xc2, 0x4f, 0x22, 0x49,
+    0xb2, 0x00, 0xc2, 0x4f, 0x2c, 0x56, 0x2b, 0xaa, 0xc2, 0x4f, 0x56, 0xd6,
+    0x30, 0xd2, 0x07, 0xef, 0xc0, 0x4d, 0x7f, 0x8d, 0xc2, 0x4f, 0x5c, 0x45,
+    0x02, 0x10, 0x42, 0x4f, 0x68, 0x4a, 0x9a, 0xea, 0xc2, 0x4f, 0xe9, 0xcc,
+    0x27, 0x7f, 0x00, 0x46, 0x88, 0xd4, 0x39, 0xf8, 0x00, 0x47, 0xf9, 0xcb,
+    0x3a, 0x01, 0x00, 0x32, 0xc0, 0xc7, 0xc3, 0xca, 0x00, 0x44, 0xe1, 0xc7,
+    0x2b, 0x4a, 0x00, 0x32, 0x98, 0x06, 0xc2, 0x4f, 0xfb, 0x03, 0xc2, 0x50,
+    0x03, 0xc3, 0x85, 0xf5, 0x0f, 0x70, 0x09, 0xc4, 0x30, 0xc1, 0x0f, 0x70,
+    0x11, 0xc3, 0x7e, 0x89, 0x0f, 0x70, 0x29, 0x42, 0x02, 0x1c, 0xc2, 0x50,
+    0x0f, 0xc3, 0x14, 0x4b, 0x0f, 0x70, 0x39, 0x16, 0xc2, 0x50, 0x19, 0xc3,
+    0x2b, 0xb9, 0x0f, 0x70, 0x49, 0x0d, 0xc2, 0x50, 0x27, 0x0e, 0xc2, 0x50,
+    0x33, 0xc4, 0x19, 0x60, 0x0f, 0x70, 0x61, 0xc4, 0x3a, 0x01, 0x0f, 0x70,
+    0x69, 0x15, 0xc2, 0x50, 0x3f, 0xc3, 0x0f, 0x9a, 0x0f, 0x70, 0x91, 0xc3,
+    0x72, 0xf0, 0x0f, 0x70, 0x99, 0x48, 0x10, 0xb4, 0xc2, 0x50, 0x57, 0x49,
+    0x18, 0x67, 0xc2, 0x50, 0xa9, 0xc3, 0xb1, 0x0d, 0x0f, 0x70, 0x81, 0xc5,
+    0x92, 0x75, 0x0f, 0x70, 0xd8, 0xc3, 0x0a, 0x8c, 0x00, 0x32, 0x7b, 0x02,
+    0x50, 0xb5, 0xcc, 0x85, 0x29, 0x00, 0x30, 0x68, 0xd6, 0x2f, 0x9e, 0x00,
+    0x47, 0xdb, 0x02, 0x50, 0xc2, 0xc7, 0xc0, 0x51, 0x00, 0x44, 0xf0, 0xc5,
+    0x00, 0xd4, 0x00, 0x47, 0xc3, 0x02, 0x50, 0xc8, 0xc5, 0x05, 0x02, 0x00,
+    0x47, 0xd0, 0xce, 0x71, 0x14, 0x00, 0x44, 0x41, 0x9b, 0x00, 0x30, 0x40,
+    0xe0, 0x08, 0xc7, 0x00, 0x37, 0x60, 0xce, 0x6d, 0xe8, 0x00, 0x47, 0xb1,
+    0xcd, 0x00, 0xfa, 0x07, 0xf3, 0xd1, 0xcb, 0x64, 0x7b, 0x07, 0xf3, 0xd8,
+    0xce, 0x00, 0xf9, 0x07, 0xf3, 0xa0, 0x00, 0xc2, 0x50, 0xce, 0xc3, 0x13,
+    0x00, 0x00, 0x32, 0x5a, 0x02, 0x50, 0xe0, 0x45, 0x08, 0xcb, 0xc2, 0x50,
+    0xe6, 0x44, 0x05, 0x36, 0xc2, 0x51, 0x3a, 0x42, 0x00, 0x87, 0xc2, 0x51,
+    0x50, 0xc3, 0x2b, 0xb9, 0x00, 0x37, 0x31, 0xc3, 0x7e, 0x89, 0x00, 0x37,
+    0x29, 0xc5, 0x4d, 0x40, 0x00, 0x30, 0xd1, 0xc5, 0x52, 0x4a, 0x00, 0x30,
+    0xc8, 0xc3, 0x2d, 0x2c, 0x00, 0x32, 0x93, 0x02, 0x51, 0x5c, 0xd8, 0x22,
+    0xeb, 0x00, 0x44, 0xe9, 0xcc, 0x86, 0x9d, 0x00, 0x32, 0xb0, 0x4a, 0xa3,
+    0xf0, 0xc2, 0x51, 0x60, 0xc4, 0x00, 0x9d, 0x07, 0xdd, 0xf9, 0x16, 0xc2,
+    0x51, 0x6c, 0x42, 0x00, 0x58, 0xc2, 0x51, 0x78, 0x4a, 0x3b, 0x79, 0xc2,
+    0x51, 0x84, 0xcb, 0x8f, 0x7e, 0x07, 0xde, 0x10, 0x15, 0xc2, 0x51, 0x90,
+    0xc9, 0xac, 0x0f, 0x00, 0x30, 0xa1, 0x42, 0x00, 0x39, 0xc2, 0x51, 0x9a,
+    0xcf, 0x6b, 0x70, 0x00, 0x30, 0x89, 0xc5, 0xda, 0xc4, 0x00, 0x30, 0x78,
+    0x00, 0x42, 0x51, 0xa6, 0x45, 0xd9, 0x57, 0xc2, 0x51, 0xb2, 0x49, 0x04,
+    0xf9, 0xc2, 0x51, 0xbe, 0x48, 0x05, 0x14, 0x42, 0x51, 0xca, 0xc5, 0x19,
+    0x75, 0x00, 0x32, 0x03, 0x02, 0x51, 0xd6, 0xcb, 0x92, 0xee, 0x07, 0xf3,
+    0x98, 0xc5, 0x4d, 0x40, 0x00, 0x47, 0x33, 0x02, 0x51, 0xdc, 0xc5, 0x52,
+    0x4a, 0x00, 0x47, 0x2b, 0x02, 0x51, 0xe2, 0xc5, 0x63, 0x73, 0x00, 0x47,
+    0x22, 0x02, 0x51, 0xe8, 0xc5, 0x00, 0xd4, 0x00, 0x32, 0xa1, 0xc5, 0x05,
+    0x02, 0x00, 0x32, 0xa8, 0xce, 0x74, 0x5c, 0x00, 0x44, 0x81, 0xcf, 0x65,
+    0xee, 0x00, 0x30, 0x70, 0xc9, 0x0e, 0x6e, 0x00, 0x32, 0xe1, 0xd6, 0x31,
+    0x6c, 0x00, 0x32, 0xd9, 0xcd, 0x31, 0x75, 0x00, 0x32, 0xd0, 0xc9, 0x08,
+    0xcb, 0x00, 0x37, 0x59, 0xc8, 0xb9, 0x12, 0x00, 0x37, 0x50, 0xc4, 0x44,
+    0x78, 0x00, 0x36, 0xe9, 0xc9, 0x5c, 0xe9, 0x00, 0x30, 0xe8, 0xc4, 0x18,
+    0x10, 0x00, 0x33, 0x39, 0xc2, 0x22, 0xcc, 0x00, 0x33, 0x30, 0xc3, 0x0d,
+    0x14, 0x00, 0x33, 0x29, 0xc3, 0x09, 0x9e, 0x00, 0x33, 0x20, 0xc4, 0x02,
+    0xde, 0x00, 0x33, 0x19, 0xc2, 0x02, 0xa0, 0x00, 0x33, 0x10, 0xc3, 0xe6,
+    0x1a, 0x07, 0xd8, 0xb9, 0xc3, 0x03, 0x0d, 0x07, 0xd8, 0xa9, 0xc3, 0x5f,
+    0x44, 0x07, 0xd8, 0xa1, 0xc3, 0x2a, 0x91, 0x07, 0xd8, 0x98, 0xcc, 0x23,
+    0x3f, 0x00, 0x2c, 0x41, 0xc2, 0x01, 0x48, 0x00, 0x2c, 0x10, 0x8a, 0x00,
+    0x2c, 0x21, 0x90, 0x00, 0x2b, 0x78, 0xc3, 0xe5, 0xc0, 0x00, 0x2c, 0x19,
+    0xc2, 0x16, 0x1c, 0x00, 0x2b, 0xd0, 0x91, 0x00, 0x2c, 0x09, 0x0a, 0xc2,
+    0x51, 0xee, 0x83, 0x00, 0x2b, 0x70, 0xc2, 0x16, 0x1c, 0x00, 0x2c, 0x01,
+    0x83, 0x00, 0x2b, 0xe0, 0xc3, 0xb8, 0x27, 0x00, 0x2b, 0xf9, 0x91, 0x00,
+    0x2b, 0x49, 0xc9, 0xb0, 0x47, 0x00, 0x2b, 0x00, 0xc2, 0x04, 0xe6, 0x00,
+    0x2b, 0xf1, 0x91, 0x00, 0x2b, 0xc0, 0xc2, 0x16, 0x1c, 0x00, 0x2b, 0xe9,
+    0xc2, 0x00, 0xd0, 0x00, 0x2b, 0xb8, 0xc3, 0x64, 0x77, 0x00, 0x2b, 0xd9,
+    0x83, 0x00, 0x2b, 0x88, 0xc3, 0x01, 0xe3, 0x00, 0x2b, 0x91, 0xc2, 0x03,
+    0x4e, 0x00, 0x2b, 0x18, 0xc2, 0x01, 0x7f, 0x00, 0x2b, 0x51, 0x83, 0x00,
+    0x2b, 0x30, 0x96, 0x00, 0x2b, 0x41, 0x8a, 0x00, 0x2b, 0x39, 0xc2, 0x11,
+    0xee, 0x00, 0x2b, 0x28, 0x8a, 0x00, 0x2a, 0xa1, 0x90, 0x00, 0x29, 0xf8,
+    0xc3, 0xe5, 0xc0, 0x00, 0x2a, 0x99, 0xc2, 0x16, 0x1c, 0x00, 0x2a, 0x50,
+    0xc2, 0x01, 0x48, 0x00, 0x2a, 0x90, 0x91, 0x00, 0x2a, 0x89, 0x0a, 0xc2,
+    0x51, 0xf8, 0x83, 0x00, 0x29, 0xf0, 0xc2, 0x16, 0x1c, 0x00, 0x2a, 0x81,
+    0x83, 0x00, 0x2a, 0x60, 0xc3, 0xb8, 0x27, 0x00, 0x2a, 0x79, 0x91, 0x00,
+    0x29, 0xc8, 0xc2, 0x04, 0xe6, 0x00, 0x2a, 0x71, 0x91, 0x00, 0x2a, 0x40,
+    0xc2, 0x16, 0x1c, 0x00, 0x2a, 0x69, 0xc2, 0x00, 0xd0, 0x00, 0x2a, 0x38,
+    0xc3, 0x64, 0x77, 0x00, 0x2a, 0x59, 0x83, 0x00, 0x2a, 0x08, 0xc3, 0x01,
+    0xe3, 0x00, 0x2a, 0x11, 0xc2, 0x03, 0x4e, 0x00, 0x29, 0x98, 0xc2, 0x01,
+    0x7f, 0x00, 0x29, 0xd1, 0x83, 0x00, 0x29, 0xb0, 0x96, 0x00, 0x29, 0xc1,
+    0x8a, 0x00, 0x29, 0xb9, 0xc2, 0x11, 0xee, 0x00, 0x29, 0xa8, 0xc4, 0x14,
+    0x74, 0x0f, 0x48, 0x09, 0xc2, 0x00, 0xd0, 0x0f, 0x48, 0x68, 0x83, 0x0f,
+    0x48, 0x21, 0xc2, 0x01, 0x7f, 0x0f, 0x48, 0x38, 0xc9, 0xaf, 0x27, 0x0f,
+    0x48, 0x29, 0xc2, 0x00, 0xd0, 0x0f, 0x49, 0x08, 0xc2, 0x01, 0x7f, 0x0f,
+    0x48, 0x71, 0x83, 0x0f, 0x48, 0x90, 0xc2, 0x05, 0x1d, 0x0f, 0x48, 0x81,
+    0xc2, 0x19, 0x2c, 0x0f, 0x48, 0xc9, 0xc2, 0x00, 0xd0, 0x0f, 0x48, 0xd8,
+    0xc2, 0x0f, 0x9b, 0x0f, 0x48, 0x89, 0xc2, 0x00, 0xd0, 0x0f, 0x48, 0xe9,
+    0xc2, 0x01, 0x53, 0x0f, 0x49, 0x00, 0x83, 0x0f, 0x48, 0xc1, 0xc2, 0x00,
+    0x51, 0x0f, 0x48, 0xf0, 0x9f, 0x0f, 0xba, 0x19, 0xa0, 0x0f, 0xba, 0x20,
+    0x02, 0x42, 0x52, 0x02, 0xc4, 0x1a, 0x05, 0x0f, 0xb8, 0xf1, 0xc6, 0x4c,
+    0x49, 0x0f, 0xb9, 0x1a, 0x02, 0x52, 0x12, 0xc2, 0xe5, 0xfd, 0x0f, 0xbb,
+    0x10, 0xc8, 0xb8, 0x5a, 0x0f, 0xba, 0xd0, 0x02, 0xc2, 0x52, 0x18, 0x44,
+    0x00, 0x54, 0x42, 0x52, 0x24, 0xc2, 0xe5, 0xfd, 0x0f, 0xb9, 0xe0, 0xcc,
+    0x8c, 0x85, 0x0f, 0xb9, 0x79, 0x02, 0x42, 0x52, 0x33, 0xc2, 0xe5, 0xfd,
+    0x0f, 0xb8, 0xb8, 0x45, 0x3c, 0x54, 0xc2, 0x52, 0x3b, 0xc3, 0x00, 0x44,
+    0x0f, 0xba, 0xf0, 0x44, 0x00, 0x54, 0x42, 0x52, 0x4d, 0xc2, 0xe5, 0xfd,
+    0x0f, 0xba, 0xe8, 0xc5, 0xdd, 0x80, 0x0f, 0xb8, 0x43, 0x02, 0x52, 0x59,
+    0xc5, 0xd7, 0x09, 0x0f, 0xb8, 0x32, 0x02, 0x52, 0x5f, 0xc2, 0xe5, 0xfd,
+    0x0f, 0xb9, 0xb8, 0xa0, 0x0f, 0xb8, 0x91, 0x9f, 0x0f, 0xb8, 0x88, 0x9f,
+    0x0a, 0x21, 0xd1, 0x9e, 0x0a, 0x21, 0xc9, 0x9d, 0x0a, 0x21, 0xc1, 0xa0,
+    0x0a, 0x21, 0xd9, 0xa1, 0x0a, 0x21, 0xe1, 0xa2, 0x0a, 0x21, 0xe9, 0xa3,
+    0x0a, 0x21, 0xf1, 0xa4, 0x0a, 0x21, 0xf9, 0xa5, 0x0a, 0x22, 0x01, 0xa6,
+    0x0a, 0x22, 0x08, 0xa6, 0x0a, 0x21, 0xb9, 0xa5, 0x0a, 0x21, 0xb1, 0xa4,
+    0x0a, 0x21, 0xa9, 0xa3, 0x0a, 0x21, 0x93, 0x02, 0x52, 0x65, 0xa2, 0x0a,
+    0x21, 0x83, 0x02, 0x52, 0x6d, 0xa1, 0x0a, 0x21, 0x79, 0xa0, 0x0a, 0x21,
+    0x71, 0x9f, 0x0a, 0x21, 0x69, 0x9e, 0x0a, 0x21, 0x5b, 0x02, 0x52, 0x71,
+    0x9d, 0x0a, 0x21, 0x50, 0xa6, 0x0a, 0x21, 0x43, 0x02, 0x52, 0x75, 0xa5,
+    0x0a, 0x21, 0x39, 0xa4, 0x0a, 0x21, 0x31, 0xa3, 0x0a, 0x21, 0x29, 0xa2,
+    0x0a, 0x21, 0x21, 0xa1, 0x0a, 0x21, 0x19, 0xa0, 0x0a, 0x21, 0x11, 0x9f,
+    0x0a, 0x21, 0x09, 0x9e, 0x0a, 0x21, 0x01, 0x9d, 0x0a, 0x20, 0xf8, 0xa6,
+    0x0a, 0x20, 0xf1, 0xa5, 0x0a, 0x20, 0xe9, 0xa4, 0x0a, 0x20, 0xe1, 0xa3,
+    0x0a, 0x20, 0xd3, 0x02, 0x52, 0x79, 0xa2, 0x0a, 0x20, 0xc9, 0xa1, 0x0a,
+    0x20, 0xc1, 0xa0, 0x0a, 0x20, 0xb9, 0x9f, 0x0a, 0x20, 0xb1, 0x9e, 0x0a,
+    0x20, 0xa9, 0x9d, 0x0a, 0x20, 0xa0, 0xa6, 0x0a, 0x20, 0x99, 0xa5, 0x0a,
+    0x20, 0x91, 0xa4, 0x0a, 0x20, 0x89, 0xa3, 0x0a, 0x20, 0x81, 0xa2, 0x0a,
+    0x20, 0x79, 0xa1, 0x0a, 0x20, 0x71, 0xa0, 0x0a, 0x20, 0x69, 0x9f, 0x0a,
+    0x20, 0x61, 0x9e, 0x0a, 0x20, 0x59, 0x9d, 0x0a, 0x20, 0x4a, 0x02, 0x52,
+    0x7d, 0xa6, 0x0a, 0x20, 0x41, 0xa5, 0x0a, 0x20, 0x39, 0xa4, 0x0a, 0x20,
+    0x31, 0xa3, 0x0a, 0x20, 0x29, 0xa2, 0x0a, 0x20, 0x21, 0xa1, 0x0a, 0x20,
+    0x19, 0xa0, 0x0a, 0x20, 0x11, 0x9f, 0x0a, 0x20, 0x09, 0x9e, 0x0a, 0x20,
+    0x00, 0x9d, 0x0a, 0x22, 0x11, 0x9e, 0x0a, 0x22, 0x19, 0x9f, 0x0a, 0x22,
+    0x21, 0xa0, 0x0a, 0x22, 0x29, 0xa1, 0x0a, 0x22, 0x31, 0xa2, 0x0a, 0x22,
+    0x39, 0xa3, 0x0a, 0x22, 0x43, 0x02, 0x52, 0x81, 0xa4, 0x0a, 0x22, 0x61,
+    0xa5, 0x0a, 0x22, 0x69, 0xa6, 0x0a, 0x22, 0x70, 0x9d, 0x0a, 0x22, 0x79,
+    0x9e, 0x0a, 0x22, 0x81, 0x9f, 0x0a, 0x22, 0x89, 0xa0, 0x0a, 0x22, 0x91,
+    0xa1, 0x0a, 0x22, 0x99, 0xa2, 0x0a, 0x22, 0xa1, 0xa3, 0x0a, 0x22, 0xa9,
+    0xa4, 0x0a, 0x22, 0xb1, 0xa5, 0x0a, 0x22, 0xb9, 0xa6, 0x0a, 0x22, 0xc0,
+    0x9d, 0x0a, 0x22, 0xc9, 0x9e, 0x0a, 0x22, 0xd1, 0x9f, 0x0a, 0x22, 0xd9,
+    0xa0, 0x0a, 0x22, 0xe1, 0xa1, 0x0a, 0x22, 0xe9, 0xa2, 0x0a, 0x22, 0xf1,
+    0xa3, 0x0a, 0x22, 0xf9, 0xa4, 0x0a, 0x23, 0x01, 0xa5, 0x0a, 0x23, 0x09,
+    0xa6, 0x0a, 0x23, 0x10, 0x9d, 0x0a, 0x23, 0x19, 0x9e, 0x0a, 0x23, 0x21,
+    0x9f, 0x0a, 0x23, 0x29, 0xa0, 0x0a, 0x23, 0x31, 0xa1, 0x0a, 0x23, 0x39,
+    0xa2, 0x0a, 0x23, 0x41, 0xa3, 0x0a, 0x23, 0x49, 0xa4, 0x0a, 0x23, 0x53,
+    0x02, 0x52, 0x8d, 0xa5, 0x0a, 0x23, 0x63, 0x02, 0x52, 0x91, 0xa6, 0x0a,
+    0x23, 0x70, 0x9d, 0x0a, 0x23, 0x7b, 0x02, 0x52, 0x95, 0x9e, 0x0a, 0x23,
+    0x8b, 0x02, 0x52, 0x99, 0x9f, 0x0a, 0x23, 0x9b, 0x02, 0x52, 0x9d, 0xa0,
+    0x0a, 0x23, 0xa9, 0xa1, 0x0a, 0x23, 0xb3, 0x02, 0x52, 0xa1, 0xa2, 0x0a,
+    0x23, 0xd3, 0x02, 0x52, 0xad, 0xa3, 0x0a, 0x23, 0xe9, 0xa4, 0x0a, 0x23,
+    0xf3, 0x02, 0x52, 0xb5, 0xa5, 0x0a, 0x24, 0x11, 0xa6, 0x0a, 0x24, 0x18,
+    0x9d, 0x0a, 0x24, 0x23, 0x02, 0x52, 0xc1, 0x9e, 0x0a, 0x24, 0x39, 0x9f,
+    0x0a, 0x24, 0x41, 0xa0, 0x0a, 0x24, 0x49, 0xa1, 0x0a, 0x24, 0x51, 0xa2,
+    0x0a, 0x24, 0x5b, 0x02, 0x52, 0xc9, 0xa3, 0x0a, 0x24, 0x69, 0xa4, 0x0a,
+    0x24, 0x71, 0xa5, 0x0a, 0x24, 0x79, 0xa6, 0x0a, 0x24, 0x80, 0x9d, 0x0a,
+    0x24, 0x89, 0x9e, 0x0a, 0x24, 0x91, 0x9f, 0x0a, 0x24, 0x99, 0xa0, 0x0a,
+    0x24, 0xa1, 0xa1, 0x0a, 0x24, 0xa9, 0xa2, 0x0a, 0x24, 0xb3, 0x02, 0x52,
+    0xcd, 0xa3, 0x0a, 0x24, 0xc1, 0xa4, 0x0a, 0x24, 0xc9, 0xa5, 0x0a, 0x24,
+    0xd1, 0xa6, 0x0a, 0x24, 0xd8, 0x9d, 0x0a, 0x24, 0xe1, 0x9e, 0x0a, 0x24,
+    0xe9, 0x9f, 0x0a, 0x24, 0xf1, 0xa0, 0x0a, 0x24, 0xf9, 0xa1, 0x0a, 0x25,
+    0x01, 0xa2, 0x0a, 0x25, 0x0b, 0x02, 0x52, 0xd1, 0xa3, 0x0a, 0x25, 0x19,
+    0xa4, 0x0a, 0x25, 0x21, 0xa5, 0x0a, 0x25, 0x29, 0xa6, 0x0a, 0x25, 0x30,
+    0x9d, 0x0a, 0x25, 0x39, 0x9e, 0x0a, 0x25, 0x41, 0x9f, 0x0a, 0x25, 0x49,
+    0xa0, 0x0a, 0x25, 0x51, 0xa1, 0x0a, 0x25, 0x59, 0xa2, 0x0a, 0x25, 0x61,
+    0xa3, 0x0a, 0x25, 0x69, 0xa4, 0x0a, 0x25, 0x71, 0xa5, 0x0a, 0x25, 0x79,
+    0xa6, 0x0a, 0x25, 0x80, 0x9d, 0x0a, 0x25, 0x89, 0x9e, 0x0a, 0x25, 0x91,
+    0x9f, 0x0a, 0x25, 0x99, 0xa0, 0x0a, 0x25, 0xa1, 0xa1, 0x0a, 0x25, 0xa9,
+    0xa2, 0x0a, 0x25, 0xb1, 0xa3, 0x0a, 0x25, 0xb9, 0xa4, 0x0a, 0x25, 0xc1,
+    0xa5, 0x0a, 0x25, 0xc9, 0xa6, 0x0a, 0x25, 0xd0, 0x9d, 0x0a, 0x25, 0xd9,
+    0x9e, 0x0a, 0x25, 0xe1, 0x9f, 0x0a, 0x25, 0xe9, 0xa0, 0x0a, 0x25, 0xf1,
+    0xa1, 0x0a, 0x25, 0xf9, 0xa2, 0x0a, 0x26, 0x01, 0xa3, 0x0a, 0x26, 0x09,
+    0xa4, 0x0a, 0x26, 0x11, 0xa5, 0x0a, 0x26, 0x19, 0xa6, 0x0a, 0x26, 0x20,
+    0x9d, 0x0a, 0x26, 0x29, 0x9e, 0x0a, 0x26, 0x31, 0x9f, 0x0a, 0x26, 0x39,
+    0xa0, 0x0a, 0x26, 0x41, 0xa1, 0x0a, 0x26, 0x49, 0xa2, 0x0a, 0x26, 0x51,
+    0xa3, 0x0a, 0x26, 0x59, 0xa4, 0x0a, 0x26, 0x61, 0xa5, 0x0a, 0x26, 0x69,
+    0xa6, 0x0a, 0x26, 0x70, 0x9d, 0x0a, 0x26, 0x79, 0x9e, 0x0a, 0x26, 0x81,
+    0x9f, 0x0a, 0x26, 0x89, 0xa0, 0x0a, 0x26, 0x91, 0xa1, 0x0a, 0x26, 0x99,
+    0xa2, 0x0a, 0x26, 0xa1, 0xa3, 0x0a, 0x26, 0xa9, 0xa4, 0x0a, 0x26, 0xb1,
+    0xa5, 0x0a, 0x26, 0xb9, 0xa6, 0x0a, 0x26, 0xc0, 0x9d, 0x0a, 0x26, 0xc9,
+    0x9e, 0x0a, 0x26, 0xd1, 0x9f, 0x0a, 0x26, 0xd9, 0xa0, 0x0a, 0x26, 0xe1,
+    0xa1, 0x0a, 0x26, 0xe9, 0xa2, 0x0a, 0x26, 0xf1, 0xa3, 0x0a, 0x26, 0xf9,
+    0xa4, 0x0a, 0x27, 0x01, 0xa5, 0x0a, 0x27, 0x09, 0xa6, 0x0a, 0x27, 0x10,
+    0x9d, 0x0a, 0x27, 0x19, 0x9e, 0x0a, 0x27, 0x21, 0x9f, 0x0a, 0x27, 0x2b,
+    0x02, 0x52, 0xd5, 0xa0, 0x0a, 0x27, 0x41, 0xa1, 0x0a, 0x27, 0x49, 0xa2,
+    0x0a, 0x27, 0x51, 0xa3, 0x0a, 0x27, 0x59, 0xa4, 0x0a, 0x27, 0x63, 0x02,
+    0x52, 0xdd, 0xa5, 0x0a, 0x27, 0x71, 0xa6, 0x0a, 0x27, 0x7a, 0x02, 0x52,
+    0xe1, 0x9d, 0x0a, 0x27, 0x89, 0x9e, 0x0a, 0x27, 0x91, 0x9f, 0x0a, 0x27,
+    0x99, 0xa0, 0x0a, 0x27, 0xa1, 0xa1, 0x0a, 0x27, 0xa9, 0xa2, 0x0a, 0x27,
+    0xb3, 0x02, 0x52, 0xe5, 0xa3, 0x0a, 0x27, 0xc3, 0x02, 0x52, 0xe9, 0xa4,
+    0x0a, 0x27, 0xd1, 0xa5, 0x0a, 0x27, 0xd9, 0xa6, 0x0a, 0x27, 0xe0, 0x9d,
+    0x0a, 0x27, 0xe9, 0x9e, 0x0a, 0x27, 0xf1, 0x9f, 0x0a, 0x27, 0xf9, 0xa0,
+    0x0a, 0x28, 0x01, 0xa1, 0x0a, 0x28, 0x09, 0xa2, 0x0a, 0x28, 0x11, 0xa3,
+    0x0a, 0x28, 0x19, 0xa4, 0x0a, 0x28, 0x23, 0x02, 0x52, 0xed, 0xa5, 0x0a,
+    0x28, 0x31, 0xa6, 0x0a, 0x28, 0x38, 0x9d, 0x0a, 0x28, 0x41, 0x9e, 0x0a,
+    0x28, 0x49, 0x9f, 0x0a, 0x28, 0x51, 0xa0, 0x0a, 0x28, 0x59, 0xa1, 0x0a,
+    0x28, 0x61, 0xa2, 0x0a, 0x28, 0x69, 0xa3, 0x0a, 0x28, 0x71, 0xa4, 0x0a,
+    0x28, 0x79, 0xa5, 0x0a, 0x28, 0x81, 0xa6, 0x0a, 0x28, 0x88, 0x9d, 0x0a,
+    0x28, 0x91, 0x9e, 0x0a, 0x28, 0x99, 0x9f, 0x0a, 0x28, 0xa1, 0xa0, 0x0a,
+    0x28, 0xa9, 0xa1, 0x0a, 0x28, 0xb1, 0xa2, 0x0a, 0x28, 0xb9, 0xa3, 0x0a,
+    0x28, 0xc1, 0xa4, 0x0a, 0x28, 0xc9, 0xa5, 0x0a, 0x28, 0xd1, 0xa6, 0x0a,
+    0x28, 0xd8, 0x9d, 0x0a, 0x28, 0xe1, 0x9e, 0x0a, 0x28, 0xe9, 0x9f, 0x0a,
+    0x28, 0xf1, 0xa0, 0x0a, 0x28, 0xf9, 0xa1, 0x0a, 0x29, 0x01, 0xa2, 0x0a,
+    0x29, 0x09, 0xa3, 0x0a, 0x29, 0x11, 0xa4, 0x0a, 0x29, 0x19, 0xa5, 0x0a,
+    0x29, 0x21, 0xa6, 0x0a, 0x29, 0x28, 0x9d, 0x0a, 0x29, 0x31, 0x9e, 0x0a,
+    0x29, 0x39, 0x9f, 0x0a, 0x29, 0x41, 0xa0, 0x0a, 0x29, 0x49, 0xa1, 0x0a,
+    0x29, 0x51, 0xa2, 0x0a, 0x29, 0x59, 0xa3, 0x0a, 0x29, 0x61, 0xa4, 0x0a,
+    0x29, 0x6b, 0x02, 0x52, 0xf1, 0xa5, 0x0a, 0x29, 0x79, 0xa6, 0x0a, 0x29,
+    0x80, 0x9d, 0x0a, 0x29, 0x89, 0x9e, 0x0a, 0x29, 0x91, 0x9f, 0x0a, 0x29,
+    0x99, 0xa0, 0x0a, 0x29, 0xa1, 0xa1, 0x0a, 0x29, 0xa9, 0xa2, 0x0a, 0x29,
+    0xb1, 0xa3, 0x0a, 0x29, 0xb9, 0xa4, 0x0a, 0x29, 0xc1, 0xa5, 0x0a, 0x29,
+    0xc9, 0xa6, 0x0a, 0x29, 0xd0, 0x9d, 0x0a, 0x29, 0xd9, 0x9e, 0x0a, 0x29,
+    0xe1, 0x9f, 0x0a, 0x29, 0xe9, 0xa0, 0x0a, 0x29, 0xf1, 0xa1, 0x0a, 0x29,
+    0xf9, 0xa2, 0x0a, 0x2a, 0x01, 0xa3, 0x0a, 0x2a, 0x09, 0xa4, 0x0a, 0x2a,
+    0x11, 0xa5, 0x0a, 0x2a, 0x19, 0xa6, 0x0a, 0x2a, 0x22, 0x02, 0x52, 0xf5,
+    0x9d, 0x0a, 0x2a, 0x31, 0x9e, 0x0a, 0x2a, 0x39, 0x9f, 0x0a, 0x2a, 0x41,
+    0xa0, 0x0a, 0x2a, 0x49, 0xa1, 0x0a, 0x2a, 0x53, 0x02, 0x52, 0xf9, 0xa2,
+    0x0a, 0x2a, 0x61, 0xa3, 0x0a, 0x2a, 0x69, 0xa4, 0x0a, 0x2a, 0x71, 0xa5,
+    0x0a, 0x2a, 0x79, 0xa6, 0x0a, 0x2a, 0x82, 0x02, 0x52, 0xfd, 0x9d, 0x0a,
+    0x2a, 0x91, 0x9e, 0x0a, 0x2a, 0x99, 0x9f, 0x0a, 0x2a, 0xa1, 0xa0, 0x0a,
+    0x2a, 0xa9, 0xa1, 0x0a, 0x2a, 0xb1, 0xa2, 0x0a, 0x2a, 0xb9, 0xa3, 0x0a,
+    0x2a, 0xc1, 0xa4, 0x0a, 0x2a, 0xc9, 0xa5, 0x0a, 0x2a, 0xd1, 0xa6, 0x0a,
+    0x2a, 0xda, 0x02, 0x53, 0x01, 0x9d, 0x0a, 0x2a, 0xe9, 0x9e, 0x0a, 0x2a,
+    0xf1, 0x9f, 0x0a, 0x2a, 0xf9, 0xa0, 0x0a, 0x2b, 0x01, 0xa1, 0x0a, 0x2b,
+    0x09, 0xa2, 0x0a, 0x2b, 0x11, 0xa3, 0x0a, 0x2b, 0x19, 0xa4, 0x0a, 0x2b,
+    0x21, 0xa5, 0x0a, 0x2b, 0x29, 0xa6, 0x0a, 0x2b, 0x30, 0x9d, 0x0a, 0x2b,
+    0x39, 0x9e, 0x0a, 0x2b, 0x41, 0x9f, 0x0a, 0x2b, 0x49, 0xa0, 0x0a, 0x2b,
+    0x51, 0xa1, 0x0a, 0x2b, 0x59, 0xa2, 0x0a, 0x2b, 0x61, 0xa3, 0x0a, 0x2b,
+    0x69, 0xa4, 0x0a, 0x2b, 0x71, 0xa5, 0x0a, 0x2b, 0x79, 0xa6, 0x0a, 0x2b,
+    0x82, 0x02, 0x53, 0x05, 0x9d, 0x0a, 0x2b, 0x91, 0x9e, 0x0a, 0x2b, 0x99,
+    0x1f, 0xc2, 0x53, 0x09, 0xa0, 0x0a, 0x2b, 0xb9, 0xa1, 0x0a, 0x2b, 0xc1,
+    0xa2, 0x0a, 0x2b, 0xc9, 0xa3, 0x0a, 0x2b, 0xd3, 0x02, 0x53, 0x15, 0xa4,
+    0x0a, 0x2b, 0xf1, 0xa5, 0x0a, 0x2b, 0xf9, 0xa6, 0x0a, 0x2c, 0x00, 0x9d,
+    0x0a, 0x2c, 0x09, 0x9e, 0x0a, 0x2c, 0x11, 0x9f, 0x0a, 0x2c, 0x19, 0xa0,
+    0x0a, 0x2c, 0x21, 0xa1, 0x0a, 0x2c, 0x29, 0xa2, 0x0a, 0x2c, 0x31, 0xa3,
+    0x0a, 0x2c, 0x39, 0xa4, 0x0a, 0x2c, 0x41, 0xa5, 0x0a, 0x2c, 0x49, 0xa6,
+    0x0a, 0x2c, 0x50, 0x9d, 0x0a, 0x2c, 0x59, 0x9e, 0x0a, 0x2c, 0x61, 0x9f,
+    0x0a, 0x2c, 0x69, 0xa0, 0x0a, 0x2c, 0x71, 0xa1, 0x0a, 0x2c, 0x79, 0xa2,
+    0x0a, 0x2c, 0x81, 0xa3, 0x0a, 0x2c, 0x89, 0xa4, 0x0a, 0x2c, 0x91, 0xa5,
+    0x0a, 0x2c, 0x99, 0xa6, 0x0a, 0x2c, 0xa2, 0x02, 0x53, 0x21, 0x9d, 0x0a,
+    0x2c, 0xb1, 0x9e, 0x0a, 0x2c, 0xb9, 0x9f, 0x0a, 0x2c, 0xc1, 0xa0, 0x0a,
+    0x2c, 0xc9, 0xa1, 0x0a, 0x2c, 0xd3, 0x02, 0x53, 0x25, 0xa2, 0x0a, 0x2c,
+    0xe1, 0xa3, 0x0a, 0x2c, 0xe9, 0xa4, 0x0a, 0x2c, 0xf1, 0xa5, 0x0a, 0x2c,
+    0xfb, 0x02, 0x53, 0x29, 0xa6, 0x0a, 0x2d, 0x08, 0x9d, 0x0a, 0x2d, 0x11,
+    0x9e, 0x0a, 0x2d, 0x1b, 0x02, 0x53, 0x2d, 0x9f, 0x0a, 0x2d, 0x29, 0xa0,
+    0x0a, 0x2d, 0x31, 0xa1, 0x0a, 0x2d, 0x39, 0xa2, 0x0a, 0x2d, 0x41, 0xa3,
+    0x0a, 0x2d, 0x49, 0xa4, 0x0a, 0x2d, 0x51, 0xa5, 0x0a, 0x2d, 0x59, 0xa6,
+    0x0a, 0x2d, 0x60, 0x9d, 0x0a, 0x2d, 0x69, 0x9e, 0x0a, 0x2d, 0x73, 0x02,
+    0x53, 0x31, 0x9f, 0x0a, 0x2d, 0x81, 0x20, 0xc2, 0x53, 0x35, 0xa1, 0x0a,
+    0x2d, 0x99, 0xa2, 0x0a, 0x2d, 0xa1, 0xa3, 0x0a, 0x2d, 0xab, 0x02, 0x53,
+    0x3f, 0xa4, 0x0a, 0x2d, 0xb9, 0xa5, 0x0a, 0x2d, 0xc1, 0xa6, 0x0a, 0x2d,
+    0xc8, 0x9d, 0x0a, 0x2d, 0xd1, 0x9e, 0x0a, 0x2d, 0xd9, 0x9f, 0x0a, 0x2d,
+    0xe1, 0xc7, 0xc6, 0xa9, 0x0a, 0x2d, 0xe9, 0xa1, 0x0a, 0x2d, 0xf1, 0xa2,
+    0x0a, 0x2d, 0xf9, 0xa3, 0x0a, 0x2e, 0x01, 0xa4, 0x0a, 0x2e, 0x09, 0xa5,
+    0x0a, 0x2e, 0x11, 0xa6, 0x0a, 0x2e, 0x18, 0x9d, 0x0a, 0x2e, 0x21, 0x9e,
+    0x0a, 0x2e, 0x29, 0x9f, 0x0a, 0x2e, 0x31, 0xa0, 0x0a, 0x2e, 0x39, 0xa1,
+    0x0a, 0x2e, 0x41, 0xa2, 0x0a, 0x2e, 0x49, 0xa3, 0x0a, 0x2e, 0x51, 0xa4,
+    0x0a, 0x2e, 0x59, 0xa5, 0x0a, 0x2e, 0x61, 0xa6, 0x0a, 0x2e, 0x68, 0x1d,
+    0xc2, 0x53, 0x43, 0x9e, 0x0a, 0x2e, 0x81, 0x9f, 0x0a, 0x2e, 0x89, 0xa0,
+    0x0a, 0x2e, 0x91, 0xa1, 0x0a, 0x2e, 0x99, 0xa2, 0x0a, 0x2e, 0xa1, 0xa3,
+    0x0a, 0x2e, 0xa9, 0xa4, 0x0a, 0x2e, 0xb1, 0xa5, 0x0a, 0x2e, 0xb9, 0xa6,
+    0x0a, 0x2e, 0xc0, 0x9d, 0x0a, 0x2e, 0xc9, 0x9e, 0x0a, 0x2e, 0xd1, 0x9f,
+    0x0a, 0x2e, 0xd9, 0xa0, 0x0a, 0x2e, 0xe1, 0xa1, 0x0a, 0x2e, 0xe9, 0xa2,
+    0x0a, 0x2e, 0xf1, 0xa3, 0x0a, 0x2e, 0xf9, 0xa4, 0x0a, 0x2f, 0x01, 0xa5,
+    0x0a, 0x2f, 0x09, 0xa6, 0x0a, 0x2f, 0x10, 0x9d, 0x0a, 0x2f, 0x19, 0x9e,
+    0x0a, 0x2f, 0x21, 0x9f, 0x0a, 0x2f, 0x29, 0xa0, 0x0a, 0x2f, 0x31, 0xa1,
+    0x0a, 0x2f, 0x39, 0xa2, 0x0a, 0x2f, 0x41, 0xa3, 0x0a, 0x2f, 0x49, 0xa4,
+    0x0a, 0x2f, 0x51, 0xa5, 0x0a, 0x2f, 0x59, 0xa6, 0x0a, 0x2f, 0x60, 0x9d,
+    0x0a, 0x2f, 0x69, 0x9e, 0x0a, 0x2f, 0x71, 0x9f, 0x0a, 0x2f, 0x79, 0xa0,
+    0x0a, 0x2f, 0x81, 0xa1, 0x0a, 0x2f, 0x89, 0xa2, 0x0a, 0x2f, 0x91, 0xa3,
+    0x0a, 0x2f, 0x99, 0xa4, 0x0a, 0x2f, 0xa1, 0xa5, 0x0a, 0x2f, 0xa9, 0xa6,
+    0x0a, 0x2f, 0xb0, 0x9d, 0x0a, 0x2f, 0xbb, 0x02, 0x53, 0x4f, 0x9e, 0x0a,
+    0x2f, 0xc9, 0x9f, 0x0a, 0x2f, 0xd1, 0xa0, 0x0a, 0x2f, 0xd9, 0xa1, 0x0a,
+    0x2f, 0xe1, 0xa2, 0x0a, 0x2f, 0xe9, 0xa3, 0x0a, 0x2f, 0xf1, 0xa4, 0x0a,
+    0x2f, 0xfb, 0x02, 0x53, 0x53, 0xa5, 0x0a, 0x30, 0x09, 0xa6, 0x0a, 0x30,
+    0x10, 0x9d, 0x0a, 0x30, 0x19, 0x9e, 0x0a, 0x30, 0x21, 0x9f, 0x0a, 0x30,
+    0x29, 0xa0, 0x0a, 0x30, 0x31, 0xa1, 0x0a, 0x30, 0x39, 0xa2, 0x0a, 0x30,
+    0x41, 0xa3, 0x0a, 0x30, 0x49, 0xa4, 0x0a, 0x30, 0x51, 0xa5, 0x0a, 0x30,
+    0x59, 0xa6, 0x0a, 0x30, 0x60, 0x9d, 0x0a, 0x30, 0x69, 0x9e, 0x0a, 0x30,
+    0x71, 0x9f, 0x0a, 0x30, 0x79, 0xa0, 0x0a, 0x30, 0x81, 0xa1, 0x0a, 0x30,
+    0x89, 0xa2, 0x0a, 0x30, 0x91, 0xa3, 0x0a, 0x30, 0x99, 0xa4, 0x0a, 0x30,
+    0xa1, 0xa5, 0x0a, 0x30, 0xa9, 0xa6, 0x0a, 0x30, 0xb0, 0x9d, 0x0a, 0x30,
+    0xb9, 0x9e, 0x0a, 0x30, 0xc1, 0x9f, 0x0a, 0x30, 0xc9, 0xa0, 0x0a, 0x30,
+    0xd1, 0xa1, 0x0a, 0x30, 0xd9, 0xa2, 0x0a, 0x30, 0xe1, 0xa3, 0x0a, 0x30,
+    0xe9, 0xa4, 0x0a, 0x30, 0xf1, 0xa5, 0x0a, 0x30, 0xf9, 0xa6, 0x0a, 0x31,
+    0x00, 0x9d, 0x0a, 0x31, 0x09, 0x9e, 0x0a, 0x31, 0x11, 0x9f, 0x0a, 0x31,
+    0x19, 0xa0, 0x0a, 0x31, 0x21, 0xa1, 0x0a, 0x31, 0x29, 0xa2, 0x0a, 0x31,
+    0x31, 0xa3, 0x0a, 0x31, 0x39, 0xa4, 0x0a, 0x31, 0x40, 0x9e, 0x0a, 0x31,
+    0x49, 0x9f, 0x0a, 0x31, 0x51, 0xa0, 0x0a, 0x31, 0x59, 0xa1, 0x0a, 0x31,
+    0x61, 0xa2, 0x0a, 0x31, 0x69, 0xa3, 0x0a, 0x31, 0x71, 0xa4, 0x0a, 0x31,
+    0x79, 0xa5, 0x0a, 0x31, 0x81, 0xa6, 0x0a, 0x31, 0x88, 0x9d, 0x0a, 0x31,
+    0x91, 0x9e, 0x0a, 0x31, 0x99, 0x9f, 0x0a, 0x31, 0xa1, 0xa0, 0x0a, 0x31,
+    0xa9, 0xa1, 0x0a, 0x31, 0xb1, 0xa2, 0x0a, 0x31, 0xb9, 0xa3, 0x0a, 0x31,
+    0xc1, 0xa4, 0x0a, 0x31, 0xc9, 0xa5, 0x0a, 0x31, 0xd1, 0xa6, 0x0a, 0x31,
+    0xd8, 0x9d, 0x0a, 0x31, 0xe1, 0x9e, 0x0a, 0x31, 0xe9, 0x9f, 0x0a, 0x31,
+    0xf1, 0xa0, 0x0a, 0x31, 0xf9, 0xa1, 0x0a, 0x32, 0x01, 0xa2, 0x0a, 0x32,
+    0x09, 0xa3, 0x0a, 0x32, 0x11, 0xa4, 0x0a, 0x32, 0x19, 0xa5, 0x0a, 0x32,
+    0x21, 0xa6, 0x0a, 0x32, 0x28, 0xd1, 0x05, 0x75, 0x01, 0x5b, 0x79, 0xd4,
+    0x3e, 0x1c, 0x01, 0x5c, 0x61, 0xd5, 0x36, 0x9b, 0x01, 0x5c, 0x69, 0xd3,
+    0x44, 0xa2, 0x01, 0x5c, 0x71, 0xd2, 0x47, 0x93, 0x01, 0x5c, 0x78, 0xc8,
+    0x2c, 0xb2, 0x01, 0x1b, 0x81, 0xc9, 0x24, 0x47, 0x01, 0x1b, 0x79, 0x05,
+    0xc2, 0x53, 0x57, 0x06, 0xc2, 0x53, 0x63, 0x42, 0x02, 0xae, 0xc2, 0x53,
+    0x76, 0xd0, 0x03, 0xb7, 0x01, 0x1a, 0x41, 0x42, 0x00, 0x49, 0xc2, 0x53,
+    0x82, 0xcc, 0x07, 0xc7, 0x01, 0x1a, 0x21, 0xc9, 0x02, 0xfe, 0x01, 0x1a,
+    0x11, 0xc5, 0x03, 0x02, 0x01, 0x1a, 0x09, 0xc3, 0xba, 0x27, 0x01, 0x19,
+    0xd9, 0xc5, 0x00, 0xe2, 0x01, 0x19, 0xc0, 0xc9, 0x20, 0xa8, 0x01, 0x1b,
+    0x09, 0xc3, 0xba, 0x27, 0x01, 0x1a, 0xa9, 0xc7, 0x80, 0x70, 0x01, 0x1a,
+    0x88, 0xcb, 0x95, 0xf0, 0x01, 0x1b, 0x89, 0xca, 0x94, 0xf4, 0x01, 0x1b,
+    0x31, 0x45, 0x9a, 0x3d, 0x42, 0x53, 0x8e, 0xc5, 0x1e, 0xc8, 0x01, 0x1b,
+    0x59, 0xc9, 0x20, 0xa8, 0x01, 0x1b, 0x11, 0xc5, 0x05, 0xa2, 0x01, 0x1a,
+    0x90, 0xc8, 0x52, 0x09, 0x01, 0x1a, 0xc9, 0xc5, 0x05, 0xa2, 0x01, 0x1a,
+    0x58, 0xc2, 0x00, 0xb1, 0x01, 0x1a, 0xf9, 0xc3, 0x05, 0xa4, 0x01, 0x19,
+    0xe8, 0xc2, 0x00, 0xf1, 0x01, 0x12, 0x2b, 0x02, 0x53, 0x9a, 0xcb, 0x23,
+    0xa0, 0x01, 0x53, 0x80, 0xc2, 0x0c, 0x43, 0x08, 0x59, 0x99, 0x87, 0x08,
+    0x59, 0x88, 0xc2, 0x00, 0x5f, 0x08, 0x59, 0x21, 0xc2, 0x0c, 0x43, 0x08,
+    0x59, 0x19, 0x87, 0x08, 0x59, 0x10, 0x87, 0x08, 0x58, 0x38, 0x90, 0x08,
+    0x58, 0x29, 0x91, 0x08, 0x58, 0x18, 0xc7, 0x0d, 0x04, 0x08, 0x08, 0xc9,
+    0xc8, 0x4b, 0x94, 0x08, 0x09, 0x10, 0xc3, 0x02, 0xdf, 0x08, 0x08, 0x4b,
+    0x02, 0x53, 0xa0, 0xc4, 0x0d, 0x0e, 0x08, 0x08, 0x92, 0x02, 0x53, 0xa4,
+    0xc9, 0x57, 0x20, 0x08, 0x09, 0x58, 0xc4, 0x18, 0x12, 0x08, 0x08, 0x8b,
+    0x02, 0x53, 0xaa, 0x91, 0x08, 0x08, 0x42, 0x02, 0x53, 0xb0, 0xc2, 0x00,
+    0x5f, 0x08, 0x08, 0x5b, 0x02, 0x53, 0xb4, 0xc3, 0x45, 0x6b, 0x08, 0x08,
+    0xa2, 0x02, 0x53, 0xb8, 0xc2, 0x00, 0x33, 0x08, 0x08, 0x53, 0x02, 0x53,
+    0xbe, 0xc3, 0x0d, 0x0f, 0x08, 0x08, 0x9a, 0x02, 0x53, 0xc2, 0x00, 0xc2,
+    0x53, 0xc8, 0xc2, 0x0d, 0x10, 0x08, 0x08, 0xaa, 0x02, 0x53, 0xd4, 0x00,
+    0xc2, 0x53, 0xda, 0xc2, 0x0d, 0x10, 0x08, 0x08, 0xb2, 0x02, 0x53, 0xe6,
+    0xc7, 0x0d, 0x04, 0x08, 0x09, 0x01, 0xc8, 0x4b, 0x94, 0x08, 0x09, 0x48,
+    0xc9, 0x57, 0x20, 0x08, 0x09, 0x90, 0xc7, 0x0d, 0x04, 0x08, 0x09, 0x09,
+    0xc8, 0x4b, 0x94, 0x08, 0x09, 0x50, 0xc9, 0x57, 0x20, 0x08, 0x09, 0x98,
+    0xcc, 0x14, 0xcd, 0x08, 0x09, 0xc1, 0xcd, 0x7e, 0xb0, 0x08, 0x09, 0xd8,
+    0xca, 0x01, 0x68, 0x01, 0x28, 0x03, 0x02, 0x53, 0xec, 0x06, 0xc2, 0x53,
+    0xf2, 0xc2, 0x02, 0xae, 0x01, 0x2b, 0xab, 0x02, 0x53, 0xfc, 0xc4, 0x00,
+    0x49, 0x01, 0x2b, 0xa3, 0x02, 0x54, 0x02, 0xc5, 0x00, 0x2c, 0x01, 0x2b,
+    0xb1, 0x44, 0x13, 0x1d, 0xc2, 0x54, 0x08, 0xc8, 0x00, 0x5f, 0x01, 0x28,
+    0x13, 0x02, 0x54, 0x14, 0x4f, 0x61, 0x5c, 0xc2, 0x54, 0x1a, 0x4c, 0x52,
+    0xbb, 0x42, 0x54, 0x26, 0x50, 0x5c, 0x42, 0xc2, 0x54, 0x32, 0xdd, 0x11,
+    0x34, 0x01, 0x2a, 0x29, 0xdd, 0x11, 0xff, 0x01, 0x2a, 0x19, 0x50, 0x11,
+    0x39, 0x42, 0x54, 0x44, 0x45, 0x02, 0x9a, 0x42, 0x54, 0x56, 0xd0, 0x5e,
+    0x62, 0x01, 0x2b, 0xf0, 0xc2, 0x01, 0x48, 0x01, 0x2b, 0xdb, 0x02, 0x54,
+    0x66, 0x4a, 0xa2, 0xa6, 0x42, 0x54, 0x6c, 0x45, 0x02, 0x9a, 0x42, 0x54,
+    0x78, 0xc8, 0x00, 0x5f, 0x01, 0x28, 0x59, 0xca, 0x01, 0x68, 0x01, 0x28,
+    0x48, 0xc8, 0x00, 0x5f, 0x01, 0x28, 0x39, 0xca, 0x01, 0x68, 0x01, 0x28,
+    0x28, 0xc8, 0x00, 0x5f, 0x01, 0x2a, 0x8b, 0x02, 0x54, 0x8a, 0x47, 0x54,
+    0x42, 0xc2, 0x54, 0x90, 0x49, 0x45, 0xd2, 0xc2, 0x54, 0xa2, 0xca, 0x01,
+    0x68, 0x01, 0x2a, 0x80, 0x4b, 0x99, 0xb8, 0xc2, 0x54, 0xb4, 0x4b, 0x8e,
+    0x76, 0xc2, 0x54, 0xc6, 0x4a, 0x5c, 0x42, 0xc2, 0x54, 0xd8, 0x4a, 0x11,
+    0x39, 0x42, 0x54, 0xf0, 0xd1, 0x53, 0x43, 0x01, 0x2b, 0x59, 0xcb, 0x8d,
+    0x84, 0x01, 0x2b, 0x11, 0xcc, 0x89, 0xd9, 0x01, 0x2a, 0xf8, 0xd1, 0x53,
+    0x32, 0x01, 0x2b, 0x51, 0xcb, 0x8e, 0xce, 0x01, 0x2b, 0x09, 0xcc, 0x87,
+    0xa5, 0x01, 0x2a, 0xf0, 0xd0, 0x32, 0x47, 0x01, 0x2a, 0x11, 0xca, 0xa2,
+    0xce, 0x01, 0x29, 0x41, 0xcb, 0x98, 0xe7, 0x01, 0x29, 0x00, 0xd0, 0x32,
+    0x71, 0x01, 0x29, 0xf9, 0xca, 0xa2, 0xe2, 0x01, 0x29, 0x29, 0xcb, 0x98,
+    0xdc, 0x01, 0x28, 0xe8, 0xd1, 0x53, 0x43, 0x01, 0x2b, 0x41, 0xcb, 0x8d,
+    0x84, 0x01, 0x2a, 0xe1, 0xcc, 0x89, 0xd9, 0x01, 0x2a, 0xc8, 0xd1, 0x53,
+    0x32, 0x01, 0x2b, 0x39, 0xcb, 0x8e, 0xce, 0x01, 0x2a, 0xd9, 0xcc, 0x87,
+    0xa5, 0x01, 0x2a, 0xc0, 0xd5, 0x32, 0x6c, 0x01, 0x2a, 0x41, 0xd0, 0x32,
+    0x71, 0x01, 0x29, 0xb9, 0x45, 0x00, 0x49, 0xc2, 0x55, 0x08, 0x46, 0x00,
+    0x2c, 0x42, 0x55, 0x14, 0xd5, 0x32, 0x42, 0x01, 0x2a, 0x01, 0xd0, 0x32,
+    0x47, 0x01, 0x29, 0xc1, 0x45, 0x00, 0x49, 0xc2, 0x55, 0x20, 0x46, 0x00,
+    0x2c, 0x42, 0x55, 0x2c, 0xce, 0x72, 0xaa, 0x01, 0x2a, 0x49, 0xc8, 0x11,
+    0xff, 0x01, 0x29, 0xc9, 0xca, 0x11, 0x34, 0x01, 0x29, 0x88, 0xce, 0x73,
+    0x44, 0x01, 0x29, 0xf1, 0xc8, 0x11, 0x49, 0x01, 0x29, 0xb1, 0xca, 0x12,
+    0x12, 0x01, 0x29, 0x70, 0xc5, 0x13, 0x67, 0x01, 0x18, 0xf9, 0xc3, 0x0a,
+    0xea, 0x01, 0x18, 0x60, 0xc5, 0x13, 0x67, 0x01, 0x18, 0xf1, 0xc3, 0x0a,
+    0xea, 0x01, 0x18, 0x68, 0x89, 0x01, 0x8d, 0x68, 0xc2, 0x1b, 0x88, 0x01,
+    0x8d, 0x70, 0xc2, 0x1b, 0x88, 0x01, 0x8d, 0x78, 0x89, 0x01, 0x89, 0x21,
+    0x90, 0x01, 0x8d, 0x48, 0x90, 0x01, 0x8d, 0x39, 0x89, 0x01, 0x8d, 0x90,
+    0x89, 0x01, 0x89, 0x29, 0x90, 0x01, 0x8d, 0x28, 0x90, 0x01, 0x8d, 0x98,
+    0xa2, 0x0f, 0xd8, 0xbb, 0x02, 0x55, 0x38, 0xa3, 0x0f, 0xd9, 0x38, 0xa0,
+    0x0f, 0xd8, 0x33, 0x02, 0x55, 0x3c, 0xa2, 0x0f, 0xd8, 0x93, 0x02, 0x55,
+    0x4e, 0xa1, 0x0f, 0xd8, 0x53, 0x02, 0x55, 0x52, 0xa3, 0x0f, 0xd9, 0x08,
+    0xa3, 0x0f, 0xd9, 0x70, 0xa1, 0x0f, 0xd8, 0x63, 0x02, 0x55, 0x5d, 0xa3,
+    0x0f, 0xd9, 0x19, 0xc2, 0x00, 0x22, 0x0f, 0xd9, 0x90, 0xa3, 0x0f, 0xd9,
+    0x88, 0xa3, 0x0f, 0xd9, 0x49, 0xa2, 0x0f, 0xd8, 0xd2, 0x02, 0x55, 0x68,
+    0xa3, 0x0f, 0xd9, 0x78, 0xa1, 0x0f, 0xd8, 0x6b, 0x02, 0x55, 0x6c, 0xa3,
+    0x0f, 0xd9, 0x21, 0xa2, 0x0f, 0xd8, 0xa2, 0x02, 0x55, 0x77, 0xa2, 0x0f,
+    0xd8, 0xc2, 0x02, 0x55, 0x7b, 0xa3, 0x0f, 0xd9, 0xa8, 0x45, 0xa6, 0x50,
+    0xc2, 0x55, 0x7f, 0x46, 0x3b, 0x9d, 0xc2, 0x55, 0xb6, 0xd0, 0x5d, 0x02,
+    0x01, 0x39, 0x61, 0xce, 0x71, 0x4c, 0x01, 0x37, 0x41, 0xc5, 0x02, 0xd2,
+    0x01, 0x2e, 0x7b, 0x02, 0x55, 0xce, 0xc8, 0xb8, 0x3a, 0x01, 0x33, 0x18,
+    0x4e, 0x70, 0xce, 0xc2, 0x55, 0xd2, 0xc7, 0x37, 0x27, 0x01, 0x38, 0x11,
+    0xce, 0x73, 0xa6, 0x01, 0x38, 0x01, 0xc6, 0xcb, 0xcf, 0x01, 0x36, 0x39,
+    0xc9, 0xb0, 0x1a, 0x01, 0x33, 0x01, 0x0f, 0xc2, 0x55, 0xde, 0xca, 0x50,
+    0x80, 0x01, 0x30, 0xb9, 0xc3, 0x0e, 0x6b, 0x01, 0x30, 0x29, 0xcc, 0x83,
+    0x01, 0x01, 0x30, 0x01, 0xc5, 0x0b, 0x0a, 0x01, 0x2d, 0x03, 0x02, 0x55,
+    0xea, 0xd3, 0x40, 0x08, 0x0f, 0xab, 0x88, 0x44, 0xe1, 0x27, 0xc2, 0x55,
+    0xee, 0xc4, 0x73, 0x5b, 0x01, 0x36, 0xf9, 0xd7, 0x28, 0x5a, 0x01, 0x36,
+    0xb1, 0xc8, 0x36, 0xb4, 0x01, 0x30, 0x71, 0xd2, 0x49, 0xaf, 0x0f, 0xab,
+    0xf8, 0x43, 0x01, 0x47, 0xc2, 0x56, 0x00, 0xc6, 0x3a, 0x1a, 0x01, 0x2e,
+    0x33, 0x02, 0x56, 0x12, 0x14, 0x42, 0x56, 0x16, 0x44, 0x00, 0x2d, 0xc2,
+    0x56, 0x22, 0xc8, 0x46, 0x71, 0x01, 0x2d, 0x61, 0xc6, 0xcd, 0x67, 0x0f,
+    0x9f, 0xb0, 0x43, 0x00, 0x4a, 0xc2, 0x56, 0x34, 0x11, 0xc2, 0x56, 0x44,
+    0x45, 0x17, 0x15, 0x42, 0x56, 0x50, 0x0e, 0xc2, 0x56, 0x5c, 0x11, 0x42,
+    0x56, 0x68, 0xca, 0x9c, 0x20, 0x01, 0x35, 0xc1, 0x46, 0x01, 0xdc, 0x42,
+    0x56, 0x74, 0xd9, 0x1f, 0x31, 0x01, 0x33, 0xd9, 0x12, 0x42, 0x56, 0x92,
+    0x07, 0xc2, 0x56, 0xaa, 0xd5, 0x31, 0xc4, 0x0f, 0xad, 0x51, 0x11, 0x42,
+    0x56, 0xb9, 0xcc, 0x88, 0x59, 0x01, 0x2d, 0x81, 0xc6, 0xc1, 0x01, 0x0f,
+    0xac, 0x41, 0x42, 0x00, 0xc4, 0x42, 0x56, 0xc5, 0x46, 0x05, 0x87, 0xc2,
+    0x56, 0xd1, 0x48, 0x4a, 0x54, 0x42, 0x56, 0xdd, 0xd0, 0x20, 0x66, 0x01,
+    0x3d, 0xb1, 0xd0, 0x03, 0xb7, 0x01, 0x3d, 0xa9, 0xd0, 0x3c, 0x90, 0x01,
+    0x3d, 0xa0, 0x85, 0x01, 0x09, 0x69, 0x9c, 0x01, 0x09, 0x41, 0x94, 0x01,
+    0x08, 0xe1, 0x8b, 0x01, 0x08, 0x89, 0x8a, 0x01, 0x08, 0x60, 0xd0, 0x15,
+    0x35, 0x01, 0x3a, 0x48, 0x9a, 0x01, 0x38, 0xb9, 0x42, 0x00, 0x6b, 0xc2,
+    0x56, 0xef, 0xc8, 0x8e, 0xa5, 0x0f, 0xaf, 0xa0, 0xc3, 0x45, 0xa1, 0x00,
+    0xda, 0xdb, 0x02, 0x56, 0xfc, 0xc5, 0xda, 0x3d, 0x00, 0xdb, 0x00, 0xc8,
+    0xb6, 0xb2, 0x00, 0xdb, 0xe8, 0x46, 0xce, 0x2d, 0xc2, 0x57, 0x02, 0x49,
+    0xb3, 0x7a, 0x42, 0x57, 0x14, 0x48, 0xb5, 0xf2, 0xc2, 0x57, 0x20, 0x46,
+    0xce, 0x33, 0x42, 0x57, 0x2c, 0xc4, 0x8f, 0x44, 0x00, 0xdb, 0x99, 0xc5,
+    0xd7, 0x4a, 0x00, 0xdb, 0x91, 0x44, 0xac, 0xc3, 0xc2, 0x57, 0x38, 0xc7,
+    0x7c, 0x94, 0x00, 0xdb, 0x79, 0xc5, 0xdb, 0xc8, 0x00, 0xdb, 0x61, 0xc5,
+    0xd7, 0xd1, 0x00, 0xdb, 0x58, 0x03, 0xc2, 0x57, 0x4a, 0x07, 0xc2, 0x57,
+    0x5f, 0xc3, 0x00, 0x74, 0x00, 0xdb, 0x31, 0xc3, 0x38, 0x86, 0x00, 0xdb,
+    0x19, 0xc3, 0x08, 0x48, 0x00, 0xdb, 0x08, 0xc5, 0x60, 0xcc, 0x00, 0xda,
+    0xf9, 0xc7, 0xc2, 0x65, 0x00, 0xda, 0xe8, 0xc4, 0x18, 0x10, 0x00, 0xda,
+    0xb9, 0xc2, 0x22, 0xcc, 0x00, 0xda, 0xb0, 0xc3, 0x0d, 0x14, 0x00, 0xda,
+    0xa9, 0xc3, 0x09, 0x9e, 0x00, 0xda, 0xa0, 0xc4, 0x02, 0xde, 0x00, 0xda,
+    0x99, 0xc2, 0x02, 0xa0, 0x00, 0xda, 0x90, 0xcb, 0x98, 0x37, 0x00, 0xda,
+    0x61, 0xcb, 0x91, 0x6d, 0x00, 0xda, 0x59, 0xc5, 0xd7, 0xbd, 0x00, 0xd8,
+    0x81, 0xc4, 0xa2, 0x33, 0x00, 0xd8, 0x2a, 0x02, 0x57, 0x6b, 0xc7, 0xc7,
+    0x20, 0x00, 0xda, 0x41, 0xc4, 0xa2, 0x33, 0x00, 0xd8, 0x78, 0xc9, 0xae,
+    0x61, 0x00, 0xda, 0x39, 0x83, 0x00, 0xd9, 0x12, 0x02, 0x57, 0x71, 0xc9,
+    0xa9, 0x5a, 0x00, 0xda, 0x31, 0x83, 0x00, 0xd8, 0x9a, 0x02, 0x57, 0x75,
+    0x43, 0x20, 0x27, 0x42, 0x57, 0x81, 0xc6, 0xb5, 0xac, 0x00, 0xd8, 0x6a,
+    0x02, 0x57, 0x8d, 0xc5, 0xc4, 0x7b, 0x00, 0xd8, 0x5a, 0x02, 0x57, 0x93,
+    0xc8, 0xbf, 0xaa, 0x00, 0xd9, 0x50, 0xc6, 0xcb, 0x93, 0x00, 0xd9, 0x40,
+    0x83, 0x00, 0xd9, 0x33, 0x02, 0x57, 0x99, 0xc2, 0x19, 0x2c, 0x00, 0xd8,
+    0xe1, 0xc2, 0x01, 0x30, 0x00, 0xd8, 0xb8, 0x42, 0x00, 0x4d, 0x42, 0x57,
+    0x9f, 0xc5, 0xd4, 0xa2, 0x00, 0xd8, 0xd8, 0xc5, 0xd4, 0x48, 0x00, 0xd8,
+    0xc8, 0xc5, 0xd7, 0x4f, 0x00, 0xd8, 0xb0, 0xc7, 0xc2, 0x6c, 0x00, 0xd8,
+    0x90, 0xc7, 0xc2, 0x6c, 0x00, 0xd8, 0x50, 0xc7, 0xc2, 0x6c, 0x00, 0xd8,
+    0x40, 0xc7, 0xc2, 0x6c, 0x00, 0xda, 0x18, 0xc5, 0x25, 0x91, 0x00, 0xd9,
+    0xf3, 0x02, 0x57, 0xab, 0xc5, 0xc2, 0x6e, 0x00, 0xd9, 0xa8, 0xc7, 0xc2,
+    0x6c, 0x00, 0xd9, 0xe8, 0xc7, 0xc2, 0x6c, 0x00, 0xd9, 0xd8, 0xc5, 0xd7,
+    0xcc, 0x00, 0xd9, 0xc8, 0xc5, 0xd9, 0x70, 0x00, 0xd9, 0xb8, 0xc6, 0x1e,
+    0x89, 0x00, 0xd8, 0x09, 0xc5, 0xd6, 0xaa, 0x00, 0xd8, 0x00, 0xc9, 0xae,
+    0xfa, 0x0b, 0x57, 0xa1, 0xc5, 0x28, 0xb0, 0x0b, 0x57, 0x80, 0xc9, 0xaf,
+    0x81, 0x0b, 0x57, 0x99, 0xc5, 0x28, 0xb0, 0x0b, 0x57, 0x88, 0x87, 0x0b,
+    0x57, 0x59, 0xc3, 0x1b, 0x88, 0x0b, 0x56, 0x80, 0xc2, 0x14, 0x68, 0x0b,
+    0x57, 0x00, 0x91, 0x0b, 0x57, 0x48, 0xc3, 0x2d, 0x2f, 0x0b, 0x57, 0x30,
+    0xc3, 0x26, 0x76, 0x0b, 0x57, 0x21, 0xc2, 0x02, 0x0a, 0x0b, 0x56, 0xa8,
+    0x91, 0x0b, 0x56, 0xf1, 0xc3, 0xdf, 0xb7, 0x0b, 0x56, 0xb8, 0xc2, 0x02,
+    0xaa, 0x0b, 0x56, 0xe9, 0xc2, 0x02, 0x98, 0x0b, 0x56, 0xb0, 0xc3, 0x62,
+    0x26, 0x0b, 0x56, 0xc1, 0x83, 0x0b, 0x56, 0x88, 0x42, 0x00, 0x56, 0xc2,
+    0x57, 0xaf, 0x42, 0x00, 0x5d, 0xc2, 0x57, 0xf0, 0x42, 0x00, 0xa9, 0xc2,
+    0x58, 0x30, 0x42, 0x00, 0xee, 0xc2, 0x58, 0x65, 0x42, 0x01, 0x60, 0xc2,
+    0x58, 0xa5, 0x42, 0x01, 0x31, 0x42, 0x58, 0xdd, 0xc2, 0xd0, 0x00, 0x05,
+    0x36, 0x29, 0x87, 0x05, 0x36, 0x50, 0x87, 0x05, 0x36, 0x41, 0xc2, 0x10,
+    0x11, 0x05, 0x36, 0xb8, 0x96, 0x05, 0x35, 0xd9, 0xc2, 0xd0, 0x00, 0x05,
+    0x36, 0x21, 0x90, 0x05, 0x36, 0x90, 0xc3, 0xe5, 0xab, 0x05, 0x37, 0x71,
+    0xc4, 0xe0, 0xa3, 0x05, 0x37, 0x78, 0x87, 0x05, 0x35, 0x29, 0xc2, 0xd0,
+    0x00, 0x05, 0x36, 0x81, 0x90, 0x05, 0x37, 0x08, 0x8b, 0x05, 0x35, 0x61,
+    0xc2, 0x02, 0xe0, 0x05, 0x35, 0x68, 0x87, 0x05, 0x35, 0x31, 0x83, 0x05,
+    0x35, 0x80, 0x96, 0x05, 0x37, 0x41, 0x90, 0x05, 0x37, 0x50, 0xc3, 0x7c,
+    0x57, 0x05, 0x35, 0x91, 0xc3, 0x8b, 0xa9, 0x05, 0x35, 0xf1, 0xc2, 0x02,
+    0xe0, 0x05, 0x36, 0x30, 0xc2, 0x10, 0x11, 0x05, 0x35, 0xe0, 0xc2, 0x02,
+    0xe0, 0x05, 0x36, 0x39, 0xc2, 0x5d, 0xa1, 0x05, 0x37, 0x58, 0xc5, 0xde,
+    0x75, 0x05, 0x36, 0x99, 0xc2, 0x01, 0x30, 0x05, 0x36, 0xa1, 0x83, 0x05,
+    0x36, 0xa8, 0xc3, 0xd0, 0xd7, 0x05, 0x35, 0x79, 0x90, 0x05, 0x37, 0x10,
+    0xc2, 0x00, 0xc4, 0x05, 0x37, 0x01, 0xc2, 0x04, 0xc6, 0x05, 0x37, 0x38,
+    0xc2, 0x25, 0x9f, 0x05, 0x35, 0xb1, 0xc3, 0xd7, 0xe2, 0x05, 0x35, 0xc1,
+    0x97, 0x05, 0x36, 0x01, 0x91, 0x05, 0x36, 0xb0, 0xc7, 0xc8, 0xd2, 0x05,
+    0x37, 0x81, 0xc9, 0xb1, 0x16, 0x05, 0x37, 0x88, 0xc9, 0xab, 0x88, 0x01,
+    0x5a, 0xd9, 0xcd, 0x7d, 0x2a, 0x01, 0x5a, 0xe8, 0x12, 0xc2, 0x59, 0x13,
+    0xc5, 0xdd, 0x67, 0x00, 0xdf, 0xf1, 0xc8, 0xb8, 0x82, 0x00, 0xdf, 0xe0,
+    0xd2, 0x48, 0x7d, 0x00, 0xdf, 0x78, 0x91, 0x00, 0xdf, 0x69, 0x8b, 0x00,
+    0xdf, 0x58, 0x87, 0x00, 0xdf, 0x48, 0xc2, 0x01, 0x5d, 0x00, 0xdf, 0x19,
+    0x83, 0x00, 0xde, 0xa2, 0x02, 0x59, 0x1f, 0xc2, 0x0e, 0x9a, 0x00, 0xdf,
+    0x11, 0xc2, 0x19, 0x2c, 0x00, 0xdf, 0x01, 0xc2, 0x01, 0x30, 0x00, 0xde,
+    0xe9, 0xca, 0x9d, 0x60, 0x00, 0xde, 0xb9, 0x83, 0x00, 0xde, 0x48, 0x4a,
+    0x48, 0x83, 0xc2, 0x59, 0x25, 0x83, 0x00, 0xde, 0xc1, 0xca, 0x9b, 0x94,
+    0x00, 0xde, 0xb0, 0xc7, 0xc8, 0xaf, 0x00, 0xde, 0x68, 0xc2, 0x00, 0xd0,
+    0x00, 0x4c, 0xb3, 0x02, 0x59, 0x5f, 0x83, 0x00, 0x4c, 0xa8, 0x83, 0x00,
+    0x4d, 0xc1, 0xc2, 0x0d, 0xf6, 0x00, 0x4d, 0xb9, 0xc2, 0x00, 0xd0, 0x00,
+    0x4d, 0xb0, 0x83, 0x00, 0x4d, 0x83, 0x02, 0x59, 0x65, 0xc2, 0x00, 0x39,
+    0x00, 0x4e, 0xe1, 0xc2, 0x00, 0xd0, 0x00, 0x4e, 0xe8, 0x83, 0x00, 0x4d,
+    0x79, 0xc2, 0x19, 0x2c, 0x00, 0x4e, 0xf8, 0xc2, 0x00, 0xd0, 0x00, 0x4d,
+    0x69, 0x83, 0x00, 0x4d, 0x60, 0xc2, 0x00, 0xd0, 0x00, 0x4d, 0x59, 0x83,
+    0x00, 0x4d, 0x50, 0x83, 0x00, 0x4d, 0x41, 0xc2, 0x00, 0xc1, 0x00, 0x4d,
+    0x19, 0xc2, 0x19, 0x2c, 0x00, 0x4c, 0xf1, 0xc2, 0x01, 0x30, 0x00, 0x4c,
+    0xc8, 0xc2, 0x00, 0xd0, 0x00, 0x4d, 0x39, 0x83, 0x00, 0x4d, 0x31, 0x06,
+    0x42, 0x59, 0x6b, 0xc2, 0x00, 0xd0, 0x00, 0x4d, 0x29, 0x83, 0x00, 0x4d,
+    0x21, 0x16, 0x42, 0x59, 0x75, 0xc2, 0x00, 0xd0, 0x00, 0x4c, 0xe9, 0x83,
+    0x00, 0x4c, 0xe0, 0xc2, 0x00, 0xd0, 0x00, 0x4c, 0xd9, 0x83, 0x00, 0x4c,
+    0xd0, 0xc2, 0x00, 0xd0, 0x00, 0x4c, 0xc1, 0x83, 0x00, 0x4c, 0xb8, 0x97,
+    0x00, 0x4c, 0xa1, 0x8b, 0x00, 0x4c, 0x81, 0x83, 0x00, 0x4c, 0x30, 0x8b,
+    0x00, 0x4c, 0x40, 0x97, 0x00, 0x4c, 0x50, 0x47, 0xb2, 0x2e, 0xc2, 0x59,
+    0x7f, 0xcd, 0x80, 0x36, 0x00, 0x4f, 0xe0, 0x42, 0x07, 0xb2, 0xc2, 0x59,
+    0x8d, 0x03, 0xc2, 0x59, 0x99, 0xc5, 0x33, 0x5d, 0x00, 0x4d, 0xe1, 0xcb,
+    0x1e, 0x89, 0x00, 0x4c, 0x08, 0x97, 0x00, 0x4e, 0x61, 0x8b, 0x00, 0x4e,
+    0x41, 0x83, 0x00, 0x4d, 0xf0, 0x94, 0x00, 0x4e, 0x1b, 0x02, 0x59, 0xa5,
+    0x8e, 0x00, 0x4f, 0x12, 0x02, 0x59, 0xa9, 0x97, 0x00, 0x4e, 0x10, 0x8b,
+    0x00, 0x4e, 0x00, 0xc2, 0x02, 0xa0, 0x00, 0x4f, 0x41, 0xc4, 0x02, 0xde,
+    0x00, 0x4f, 0x48, 0xc3, 0x09, 0x9e, 0x00, 0x4f, 0x51, 0xc3, 0x0d, 0x14,
+    0x00, 0x4f, 0x58, 0xc2, 0x22, 0xcc, 0x00, 0x4f, 0x61, 0xc4, 0x18, 0x10,
+    0x00, 0x4f, 0x68, 0xc3, 0x05, 0x14, 0x00, 0x4f, 0xa3, 0x02, 0x59, 0xad,
+    0x16, 0xc2, 0x59, 0xb3, 0xc4, 0x09, 0x9d, 0x00, 0x4f, 0xb8, 0x1b, 0xc2,
+    0x59, 0xbf, 0xc2, 0x00, 0x39, 0x00, 0xd0, 0x59, 0x83, 0x00, 0xd0, 0x51,
+    0x09, 0x42, 0x59, 0xc9, 0xc2, 0x00, 0xb0, 0x00, 0xd0, 0x39, 0x83, 0x00,
+    0xd0, 0x30, 0xa4, 0x01, 0x42, 0x03, 0x02, 0x59, 0xd3, 0x9e, 0x01, 0x40,
+    0x0b, 0x02, 0x59, 0xd7, 0x9f, 0x01, 0x40, 0x13, 0x02, 0x5a, 0x05, 0xa0,
+    0x01, 0x40, 0x23, 0x02, 0x5a, 0x2c, 0xa1, 0x01, 0x40, 0x43, 0x02, 0x5a,
+    0x4c, 0xa2, 0x01, 0x40, 0x83, 0x02, 0x5a, 0x65, 0xa3, 0x01, 0x41, 0x03,
+    0x02, 0x5a, 0x77, 0xa5, 0x01, 0x44, 0x00, 0x00, 0x42, 0x5a, 0x82, 0xc2,
+    0x0d, 0x10, 0x08, 0x83, 0x18, 0x9b, 0x08, 0x83, 0x10, 0xc4, 0x18, 0x10,
+    0x08, 0x82, 0xc3, 0x02, 0x5a, 0x8e, 0xc2, 0x22, 0xcc, 0x08, 0x82, 0xba,
+    0x02, 0x5a, 0x94, 0x0b, 0xc2, 0x5a, 0x9a, 0x11, 0x42, 0x5a, 0xa6, 0x0a,
+    0xc2, 0x5a, 0xb2, 0x19, 0xc2, 0x5a, 0xbe, 0xc2, 0x00, 0xc4, 0x08, 0x82,
+    0xd8, 0x49, 0x5c, 0x83, 0x42, 0x5a, 0xc8, 0xc2, 0x00, 0xdb, 0x08, 0x81,
+    0xa1, 0x83, 0x08, 0x81, 0x70, 0xc2, 0x00, 0xd0, 0x08, 0x81, 0x51, 0x83,
+    0x08, 0x81, 0x48, 0xc2, 0x00, 0xd0, 0x08, 0x81, 0x41, 0x83, 0x08, 0x81,
+    0x38, 0x83, 0x08, 0x81, 0x31, 0xc2, 0x00, 0xc1, 0x08, 0x81, 0x09, 0xc2,
+    0x19, 0x2c, 0x08, 0x80, 0xe1, 0xc2, 0x01, 0x30, 0x08, 0x80, 0xb8, 0xc2,
+    0x00, 0xd0, 0x08, 0x81, 0x29, 0x83, 0x08, 0x81, 0x21, 0x06, 0x42, 0x5a,
+    0xe0, 0xc2, 0x00, 0xd0, 0x08, 0x81, 0x19, 0x83, 0x08, 0x81, 0x11, 0x16,
+    0x42, 0x5a, 0xea, 0xc2, 0x00, 0xd0, 0x08, 0x80, 0xd9, 0x83, 0x08, 0x80,
+    0xd0, 0xc2, 0x00, 0xd0, 0x08, 0x80, 0xc9, 0x83, 0x08, 0x80, 0xc0, 0xc2,
+    0x00, 0xd0, 0x08, 0x80, 0xb1, 0x83, 0x08, 0x80, 0xa8, 0xc2, 0x00, 0xd0,
+    0x08, 0x80, 0xa1, 0x83, 0x08, 0x80, 0x98, 0x97, 0x08, 0x80, 0x91, 0x8b,
+    0x08, 0x80, 0x81, 0x83, 0x08, 0x80, 0x30, 0x47, 0xb2, 0x2e, 0xc2, 0x5a,
+    0xf4, 0x83, 0x08, 0x81, 0x78, 0x97, 0x08, 0x80, 0x50, 0x8b, 0x08, 0x80,
+    0x40, 0xc2, 0x00, 0xd0, 0x08, 0x81, 0x81, 0xc2, 0x0d, 0xf6, 0x08, 0x81,
+    0x89, 0x83, 0x08, 0x81, 0x90, 0x91, 0x08, 0x82, 0x23, 0x02, 0x5b, 0x02,
+    0x03, 0xc2, 0x5b, 0x08, 0x87, 0x08, 0x82, 0x11, 0x48, 0xb2, 0x2d, 0xc2,
+    0x5b, 0x14, 0x97, 0x08, 0x81, 0xe3, 0x02, 0x5b, 0x22, 0x8b, 0x08, 0x81,
+    0xd3, 0x02, 0x5b, 0x26, 0xce, 0x6e, 0x2e, 0x08, 0x81, 0xc8, 0xc4, 0x26,
+    0x78, 0x08, 0x83, 0x79, 0xc5, 0x06, 0xdb, 0x08, 0x83, 0x71, 0x15, 0xc2,
+    0x5b, 0x2a, 0x08, 0xc2, 0x5b, 0x36, 0x16, 0xc2, 0x5b, 0x42, 0xc3, 0x05,
+    0x14, 0x08, 0x83, 0x39, 0xc4, 0x15, 0xe7, 0x08, 0x83, 0x30, 0xc4, 0x6e,
+    0x13, 0x08, 0x82, 0x69, 0xc3, 0x02, 0x6e, 0x08, 0x82, 0x58, 0xc8, 0x3a,
+    0x36, 0x08, 0x82, 0x51, 0x96, 0x08, 0x82, 0x48, 0x42, 0x00, 0xbd, 0xc2,
+    0x5b, 0x4e, 0xc9, 0x79, 0x79, 0x0e, 0x83, 0x90, 0xc7, 0xc3, 0x1b, 0x0e,
+    0x85, 0xa9, 0xc6, 0xc5, 0x06, 0x0e, 0x85, 0xa0, 0xc4, 0x99, 0xff, 0x0e,
+    0x87, 0xa1, 0xc3, 0x2e, 0xd7, 0x0e, 0x83, 0xf8, 0x44, 0xe3, 0xbb, 0xc2,
+    0x5b, 0x60, 0xc8, 0x9c, 0xe0, 0x0e, 0x80, 0xd8, 0x00, 0x42, 0x5b, 0x72,
+    0xc5, 0xd6, 0xa5, 0x0e, 0x82, 0x10, 0x03, 0xc2, 0x5b, 0x7e, 0x11, 0x42,
+    0x5b, 0x88, 0xc3, 0x03, 0x13, 0x0e, 0x83, 0xd1, 0xc9, 0xaa, 0x68, 0x0e,
+    0x81, 0xb8, 0xc2, 0x00, 0xec, 0x0e, 0x87, 0x79, 0xc2, 0x01, 0x6c, 0x0e,
+    0x87, 0x71, 0xc2, 0x00, 0x3c, 0x0e, 0x87, 0x69, 0xc2, 0x01, 0xdd, 0x0e,
+    0x87, 0x61, 0xc2, 0x01, 0x30, 0x0e, 0x87, 0x59, 0xc3, 0x29, 0x6f, 0x0e,
+    0x87, 0x51, 0xc2, 0x00, 0xb0, 0x0e, 0x87, 0x48, 0x90, 0x0e, 0x84, 0xb9,
+    0xc9, 0x79, 0x79, 0x0e, 0x83, 0x98, 0x46, 0xce, 0xab, 0xc2, 0x5b, 0x94,
+    0x46, 0xcb, 0x03, 0xc2, 0x5b, 0xa1, 0xc5, 0x4c, 0x93, 0x0e, 0x81, 0x18,
+    0xc6, 0xd0, 0x01, 0x0e, 0x81, 0x99, 0xca, 0x6d, 0x0c, 0x0e, 0x80, 0x68,
+    0xc5, 0xd6, 0x0a, 0x0e, 0x85, 0x09, 0xc4, 0xe1, 0x7f, 0x0e, 0x84, 0xd0,
+    0xc5, 0xda, 0x42, 0x0e, 0x85, 0x01, 0x8b, 0x0e, 0x84, 0xf8, 0xc2, 0x00,
+    0xba, 0x0e, 0x84, 0xf1, 0xc4, 0x01, 0x92, 0x0e, 0x84, 0xe8, 0x8b, 0x0e,
+    0x84, 0xe1, 0xc5, 0xda, 0x42, 0x0e, 0x84, 0xd8, 0xc7, 0xc8, 0x93, 0x0e,
+    0x83, 0x11, 0xc2, 0x01, 0xc3, 0x0e, 0x82, 0xe0, 0xc9, 0xa9, 0xe1, 0x0e,
+    0x80, 0xf8, 0x00, 0x42, 0x5b, 0xad, 0x00, 0x42, 0x5b, 0xb7, 0xc4, 0xcf,
+    0x8b, 0x0e, 0x80, 0x40, 0x45, 0xda, 0xe2, 0xc2, 0x5b, 0xc1, 0xc4, 0xc8,
+    0x2c, 0x0e, 0x80, 0x98, 0xc8, 0xbe, 0x2a, 0x0e, 0x87, 0x31, 0xc5, 0xcf,
+    0x3c, 0x0e, 0x84, 0x92, 0x02, 0x5b, 0xd3, 0x46, 0xd0, 0x07, 0xc2, 0x5b,
+    0xd9, 0xc4, 0xc2, 0xa0, 0x0e, 0x84, 0xc8, 0x16, 0xc2, 0x5b, 0xeb, 0xd5,
+    0x35, 0x4b, 0x0e, 0x86, 0x91, 0xdc, 0x13, 0x35, 0x0e, 0x86, 0x89, 0xd1,
+    0x4f, 0x58, 0x0e, 0x86, 0x80, 0xc9, 0x9c, 0xdf, 0x0e, 0x84, 0x00, 0x43,
+    0x01, 0x92, 0xc2, 0x5b, 0xf7, 0xd5, 0x35, 0x4b, 0x0e, 0x86, 0xb1, 0xdc,
+    0x13, 0x35, 0x0e, 0x86, 0xa9, 0xd1, 0x4f, 0x58, 0x0e, 0x86, 0xa0, 0xc3,
+    0x2e, 0xd7, 0x0e, 0x83, 0xe9, 0xc4, 0x99, 0xff, 0x0e, 0x83, 0xe0, 0xc4,
+    0xde, 0x8f, 0x0e, 0x82, 0x99, 0xc6, 0xd0, 0x19, 0x0e, 0x80, 0x52, 0x02,
+    0x5c, 0x03, 0xc5, 0xda, 0x1a, 0x0e, 0x86, 0x39, 0xc9, 0xb1, 0x9d, 0x0e,
+    0x85, 0xe0, 0x47, 0x1a, 0x0a, 0xc2, 0x5c, 0x09, 0xcb, 0x98, 0xbb, 0x0e,
+    0x85, 0xf0, 0xca, 0xa2, 0xec, 0x0e, 0x86, 0x21, 0xc8, 0xba, 0x3a, 0x0e,
+    0x86, 0x18, 0x10, 0xc2, 0x5c, 0x15, 0xc2, 0x01, 0x6c, 0x0e, 0x86, 0x01,
+    0xc2, 0x00, 0x3c, 0x0e, 0x85, 0xf9, 0xc2, 0x01, 0xdd, 0x0e, 0x85, 0xe9,
+    0xc2, 0x00, 0xb0, 0x0e, 0x85, 0xd0, 0xcf, 0x6b, 0x07, 0x0e, 0x85, 0xc8,
+    0x44, 0x3b, 0xaf, 0xc2, 0x5c, 0x21, 0xc4, 0x65, 0xea, 0x0e, 0x85, 0xb8,
+    0xc3, 0x63, 0x2b, 0x0e, 0x82, 0x31, 0xc8, 0x9c, 0xe0, 0x0e, 0x80, 0xd0,
+    0x47, 0xc9, 0x11, 0xc2, 0x5c, 0x2b, 0x44, 0x89, 0x3e, 0x42, 0x5c, 0x37,
+    0x48, 0x6d, 0x79, 0xc2, 0x5c, 0x43, 0x42, 0x00, 0x2c, 0x42, 0x5c, 0x4f,
+    0xce, 0x6d, 0x5c, 0x0e, 0x85, 0x29, 0xcc, 0x89, 0x3d, 0x0e, 0x85, 0x18,
+    0xc6, 0xcf, 0x3b, 0x0e, 0x84, 0xb1, 0xc3, 0x1f, 0x1d, 0x0e, 0x84, 0x39,
+    0x83, 0x0e, 0x81, 0x80, 0xc7, 0xc8, 0x31, 0x0e, 0x83, 0x81, 0x12, 0xc2,
+    0x5c, 0x5b, 0xc7, 0xc4, 0xaa, 0x0e, 0x83, 0x69, 0x42, 0x00, 0xbd, 0x42,
+    0x5c, 0x67, 0xcd, 0x78, 0xe6, 0x0e, 0x83, 0xc9, 0xc2, 0x01, 0xc3, 0x0e,
+    0x81, 0x6a, 0x02, 0x5c, 0x71, 0xcf, 0x68, 0x0a, 0x0e, 0x84, 0x71, 0x16,
+    0xc2, 0x5c, 0x7d, 0xcb, 0x8f, 0x52, 0x0e, 0x84, 0x59, 0xcc, 0x80, 0xd9,
+    0x0e, 0x84, 0x50, 0xc3, 0x63, 0x2b, 0x0e, 0x82, 0x41, 0xc5, 0xcc, 0xcc,
+    0x0e, 0x80, 0x21, 0xcb, 0x6d, 0x0b, 0x0e, 0x80, 0x18, 0xc7, 0xc8, 0x31,
+    0x0e, 0x83, 0x89, 0xcb, 0x94, 0x17, 0x0e, 0x83, 0x79, 0xc7, 0xc4, 0xaa,
+    0x0e, 0x83, 0x61, 0x90, 0x0e, 0x81, 0xca, 0x02, 0x5c, 0x89, 0xc2, 0x00,
+    0x45, 0x0e, 0x80, 0xb9, 0x8b, 0x0e, 0x80, 0x00, 0x47, 0xc1, 0xee, 0xc2,
+    0x5c, 0x8f, 0xc6, 0xcf, 0x89, 0x0e, 0x80, 0x4a, 0x02, 0x5c, 0x9b, 0xc4,
+    0x77, 0x35, 0x0e, 0x82, 0x68, 0x16, 0xc2, 0x5c, 0x9f, 0xc2, 0x01, 0xc3,
+    0x0e, 0x82, 0x08, 0xc3, 0x63, 0x2b, 0x0e, 0x82, 0xc1, 0xc5, 0xcc, 0xcc,
+    0x0e, 0x80, 0x31, 0xcb, 0x6d, 0x0b, 0x0e, 0x80, 0x28, 0x94, 0x08, 0xe0,
+    0x38, 0xd1, 0x51, 0xbc, 0x0f, 0xdc, 0xf9, 0xc2, 0x00, 0x49, 0x01, 0x2f,
+    0xd0, 0x4e, 0x60, 0x6d, 0xc2, 0x5c, 0xa9, 0xcc, 0x80, 0xf1, 0x0f, 0xac,
+    0x50, 0xc9, 0xb4, 0xac, 0x0f, 0xac, 0x61, 0xc5, 0xcd, 0x8c, 0x0f, 0xac,
+    0x48, 0xd1, 0x51, 0xbc, 0x0f, 0xdc, 0xf1, 0xc2, 0x00, 0x49, 0x01, 0x2f,
+    0xf8, 0x4e, 0x01, 0xf4, 0xc2, 0x5c, 0xb5, 0xdb, 0x17, 0x61, 0x01, 0x49,
+    0xf0, 0x5b, 0x16, 0xa4, 0xc2, 0x5c, 0xc1, 0x46, 0x01, 0xc8, 0x42, 0x5c,
+    0xcd, 0xce, 0x08, 0x79, 0x01, 0x2c, 0x31, 0xcd, 0x3f, 0xe8, 0x01, 0x2c,
+    0x18, 0xc9, 0xae, 0xbb, 0x01, 0x3f, 0xf0, 0xc9, 0xae, 0xbb, 0x01, 0x3f,
+    0xe0, 0xc9, 0xae, 0xbb, 0x01, 0x3f, 0xe8, 0xc9, 0xae, 0xbb, 0x01, 0x3f,
+    0xd8, 0xcc, 0x82, 0x35, 0x01, 0x3f, 0xd1, 0xc5, 0x01, 0xa2, 0x01, 0x3f,
+    0xb8, 0xcf, 0x64, 0xd1, 0x01, 0x52, 0xe9, 0xcb, 0x98, 0x42, 0x01, 0x52,
+    0xd9, 0x42, 0x00, 0x58, 0x42, 0x5c, 0xdf, 0xc7, 0x16, 0x16, 0x01, 0x52,
+    0x89, 0x45, 0x00, 0x5a, 0x42, 0x5c, 0xeb, 0x42, 0x00, 0xa9, 0xc2, 0x5c,
+    0xf7, 0x09, 0x42, 0x5d, 0x09, 0xd3, 0x16, 0x91, 0x01, 0x4c, 0x99, 0x49,
+    0x05, 0xcb, 0x42, 0x5d, 0x18, 0x49, 0x01, 0xd3, 0xc2, 0x5d, 0x24, 0xcc,
+    0x01, 0xdb, 0x0f, 0xdc, 0x61, 0xc6, 0x02, 0xd1, 0x0f, 0xc8, 0x3b, 0x02,
+    0x5d, 0x2a, 0x42, 0x00, 0x5b, 0xc2, 0x5d, 0x30, 0xcb, 0x96, 0x7f, 0x0f,
+    0xdd, 0x91, 0xc6, 0x9e, 0xf4, 0x0f, 0xdd, 0xc8, 0xd0, 0x5b, 0xc2, 0x0f,
+    0xc2, 0xc1, 0xd1, 0x55, 0x30, 0x01, 0x0f, 0xf9, 0xc5, 0x01, 0xa2, 0x01,
+    0x0c, 0xa3, 0x02, 0x5d, 0x3c, 0xcc, 0x82, 0x35, 0x01, 0x0e, 0xa3, 0x02,
+    0x5d, 0x40, 0x19, 0xc2, 0x5d, 0x46, 0xcb, 0x94, 0x22, 0x01, 0x58, 0x61,
+    0xd5, 0x01, 0x92, 0x01, 0x5b, 0x20, 0xcc, 0x06, 0xdb, 0x01, 0x2c, 0x79,
+    0xcd, 0x15, 0x02, 0x01, 0x2c, 0x70, 0xd1, 0x3f, 0xe4, 0x01, 0x2c, 0x49,
+    0xd0, 0x05, 0xb7, 0x01, 0x16, 0x58, 0x00, 0x42, 0x5d, 0x52, 0xd3, 0x01,
+    0xb4, 0x01, 0x00, 0xc1, 0xd0, 0x58, 0xd2, 0x01, 0x71, 0x30, 0x00, 0x42,
+    0x5d, 0x6a, 0x44, 0x02, 0xdf, 0xc2, 0x5d, 0x7c, 0xcc, 0x86, 0xcd, 0x0f,
+    0xaf, 0x61, 0xde, 0x06, 0x69, 0x0f, 0xde, 0x08, 0x44, 0x01, 0x94, 0xc2,
+    0x5d, 0x88, 0xd3, 0x41, 0xf6, 0x01, 0x70, 0x48, 0xd0, 0x4a, 0x77, 0x01,
+    0x2c, 0x59, 0xc7, 0xb2, 0xec, 0x01, 0x4b, 0xe0, 0xca, 0xa2, 0x74, 0x01,
+    0x1c, 0xe9, 0xc9, 0x57, 0x36, 0x01, 0x1c, 0xe1, 0xca, 0xa3, 0x5a, 0x01,
+    0x1c, 0xd8, 0xce, 0x01, 0xb9, 0x01, 0x00, 0xe1, 0xcc, 0x8a, 0x09, 0x01,
+    0x4e, 0xd1, 0xcb, 0x1a, 0x50, 0x01, 0x71, 0x41, 0xcd, 0x0b, 0x91, 0x01,
+    0x80, 0x50, 0xcb, 0x1a, 0x50, 0x01, 0x4c, 0x29, 0x05, 0xc2, 0x5d, 0x94,
+    0xd2, 0x21, 0x89, 0x01, 0x80, 0xb1, 0xd6, 0x08, 0x88, 0x01, 0x80, 0xc1,
+    0xce, 0x25, 0xad, 0x01, 0x80, 0xd0, 0xd6, 0x08, 0x88, 0x01, 0x4c, 0xb9,
+    0xd2, 0x21, 0x89, 0x01, 0x80, 0x80, 0x50, 0x58, 0xb2, 0xc2, 0x5d, 0xa0,
+    0x4e, 0x6c, 0x36, 0x42, 0x5d, 0xac, 0xda, 0x1b, 0xd0, 0x0f, 0xc4, 0xa0,
+    0x45, 0x01, 0x95, 0xc2, 0x5d, 0xb8, 0x44, 0x0b, 0x26, 0x42, 0x5d, 0xc4,
+    0xcd, 0x7e, 0x3b, 0x01, 0x0c, 0xf1, 0x48, 0x01, 0x9a, 0x42, 0x5d, 0xd0,
+    0x45, 0x00, 0x8c, 0xc2, 0x5d, 0xdc, 0x16, 0xc2, 0x5e, 0x12, 0xd5, 0x10,
+    0x87, 0x01, 0x0e, 0x31, 0xc8, 0xae, 0xbc, 0x01, 0x0d, 0x23, 0x02, 0x5e,
+    0x1e, 0x03, 0x42, 0x5e, 0x24, 0xc5, 0x01, 0xa2, 0x01, 0x0e, 0x83, 0x02,
+    0x5e, 0x30, 0xca, 0x52, 0xc2, 0x01, 0x48, 0x60, 0xcb, 0x6f, 0xff, 0x01,
+    0x0e, 0xe1, 0xca, 0x88, 0xdf, 0x0f, 0xc1, 0xc0, 0x46, 0x01, 0x52, 0xc2,
+    0x5e, 0x3a, 0xc2, 0x02, 0x35, 0x0f, 0xd7, 0x90, 0xd0, 0x58, 0x62, 0x0f,
+    0xc2, 0x01, 0xc5, 0x01, 0xa2, 0x0f, 0xc2, 0x20, 0xc5, 0x01, 0xa2, 0x01,
+    0x58, 0x29, 0xd3, 0x43, 0xe4, 0x01, 0x5c, 0x40, 0xca, 0x50, 0x5e, 0x00,
+    0x7e, 0xc0, 0xca, 0x37, 0x4e, 0x01, 0x13, 0x91, 0xc5, 0x07, 0x62, 0x01,
+    0x13, 0x20, 0x4a, 0x33, 0xad, 0x42, 0x5e, 0x46, 0xe0, 0x09, 0xc7, 0x01,
+    0x54, 0x58, 0x47, 0xc7, 0x35, 0xc2, 0x5e, 0x55, 0x53, 0x40, 0x1b, 0x42,
+    0x5e, 0x61, 0xe0, 0x07, 0x07, 0x01, 0x54, 0x88, 0xc2, 0x00, 0xd0, 0x00,
+    0xe2, 0x71, 0x83, 0x00, 0xe2, 0x68, 0xc2, 0x00, 0xd0, 0x00, 0xe0, 0xc1,
+    0x83, 0x00, 0xe0, 0xb8, 0xc7, 0xc0, 0x97, 0x00, 0xe1, 0xf0, 0xd2, 0x4d,
+    0x57, 0x0f, 0xbd, 0xa9, 0xc6, 0x13, 0x52, 0x0f, 0xbd, 0x49, 0xc4, 0x01,
+    0xe3, 0x01, 0x2c, 0x88, 0x44, 0x00, 0x2d, 0xc2, 0x5e, 0x67, 0xc3, 0x14,
+    0xa7, 0x0f, 0xb4, 0x40, 0xe0, 0x08, 0x87, 0x01, 0x3b, 0x90, 0x52, 0x11,
+    0x92, 0xc2, 0x5e, 0x6d, 0x44, 0x0d, 0x14, 0x42, 0x5e, 0x79, 0xd7, 0x2a,
+    0xb0, 0x0f, 0xbe, 0x01, 0xd8, 0x22, 0x43, 0x0f, 0xbe, 0x90, 0xc7, 0x6f,
+    0xbc, 0x0f, 0xaf, 0x88, 0x83, 0x05, 0x26, 0xe9, 0xc2, 0x00, 0xd0, 0x05,
+    0x26, 0xf0, 0x44, 0x5d, 0xb5, 0xc2, 0x5e, 0x85, 0xc5, 0xdb, 0x87, 0x05,
+    0x27, 0xc8, 0xc4, 0xb2, 0xf8, 0x00, 0x04, 0x50, 0xd6, 0x2e, 0xd8, 0x01,
+    0x50, 0xa1, 0x45, 0x00, 0x8c, 0x42, 0x5e, 0xa3, 0x24, 0xc2, 0x5e, 0xaf,
+    0x23, 0xc2, 0x5e, 0xc3, 0x42, 0xe5, 0x28, 0xc2, 0x5e, 0xdf, 0x04, 0xc2,
+    0x5e, 0xff, 0xc4, 0xe4, 0xb7, 0x08, 0x30, 0xd9, 0x1e, 0xc2, 0x5f, 0x07,
+    0x20, 0xc2, 0x5f, 0x19, 0x21, 0xc2, 0x5f, 0x39, 0x22, 0x42, 0x5f, 0x41,
+    0x42, 0x00, 0x91, 0xc2, 0x5f, 0x69, 0x49, 0xa8, 0xca, 0xc2, 0x5f, 0x75,
+    0x4a, 0xa2, 0xd8, 0x42, 0x5f, 0x7f, 0xc4, 0x18, 0x10, 0x00, 0xca, 0x69,
+    0xc2, 0x22, 0xcc, 0x00, 0xca, 0x60, 0xc3, 0x0d, 0x14, 0x00, 0xca, 0x59,
+    0xc3, 0x09, 0x9e, 0x00, 0xca, 0x50, 0xc4, 0x02, 0xde, 0x00, 0xca, 0x49,
+    0xc2, 0x02, 0xa0, 0x00, 0xca, 0x40, 0xc3, 0x15, 0x31, 0x00, 0xca, 0x01,
+    0xc4, 0xdf, 0x0f, 0x00, 0xc9, 0xd9, 0xc9, 0xac, 0xc3, 0x00, 0xc9, 0xd1,
+    0xc9, 0xa9, 0x87, 0x00, 0xc9, 0xc8, 0xc2, 0x00, 0xdb, 0x00, 0xc9, 0xc1,
+    0xc2, 0x00, 0x39, 0x00, 0xc9, 0xb9, 0xc2, 0x01, 0xc3, 0x00, 0xc9, 0xb1,
+    0xc2, 0x00, 0xb0, 0x00, 0xc9, 0xa9, 0x10, 0xc2, 0x5f, 0x89, 0xc2, 0x01,
+    0x6f, 0x00, 0xc9, 0x99, 0xc8, 0x14, 0x38, 0x00, 0xc9, 0x91, 0xc2, 0x02,
+    0x2b, 0x00, 0xc9, 0x80, 0xc2, 0x01, 0x4a, 0x00, 0xc9, 0x59, 0xc2, 0x00,
+    0x39, 0x00, 0xc9, 0x51, 0xc2, 0x19, 0x2c, 0x00, 0xc9, 0x48, 0x91, 0x00,
+    0xc9, 0x43, 0x02, 0x5f, 0x93, 0x87, 0x00, 0xc9, 0x3b, 0x02, 0x5f, 0x97,
+    0x83, 0x00, 0xc9, 0x03, 0x02, 0x5f, 0x9b, 0x97, 0x00, 0xc9, 0x11, 0x8b,
+    0x00, 0xc9, 0x08, 0xc2, 0x00, 0x39, 0x00, 0xc8, 0xf1, 0xc2, 0x00, 0xd0,
+    0x00, 0xc8, 0x61, 0x83, 0x00, 0xc8, 0x58, 0xc3, 0x2e, 0x0f, 0x00, 0xc8,
+    0xe9, 0xc2, 0x00, 0xd0, 0x00, 0xc8, 0x21, 0x83, 0x00, 0xc8, 0x18, 0x83,
+    0x00, 0xc8, 0xd9, 0xc2, 0x0d, 0xf6, 0x00, 0xc8, 0xd1, 0xc2, 0x00, 0xd0,
+    0x00, 0xc8, 0xc8, 0x90, 0x00, 0xc8, 0x50, 0xc2, 0x00, 0xd0, 0x00, 0xc8,
+    0x99, 0x83, 0x00, 0xc8, 0x90, 0xc2, 0x00, 0xd0, 0x00, 0xc8, 0x89, 0x83,
+    0x00, 0xc8, 0x80, 0x83, 0x00, 0xc8, 0x79, 0xc2, 0x01, 0x30, 0x00, 0xc8,
+    0x28, 0xc2, 0x00, 0xd0, 0x00, 0xc8, 0x71, 0x83, 0x00, 0xc8, 0x68, 0xc2,
+    0x00, 0xd0, 0x00, 0xc8, 0x49, 0x83, 0x00, 0xc8, 0x40, 0xc2, 0x00, 0xd0,
+    0x00, 0xc8, 0x39, 0x83, 0x00, 0xc8, 0x30, 0xc2, 0x00, 0xd0, 0x00, 0xc8,
+    0x11, 0x83, 0x00, 0xc8, 0x08, 0x45, 0xdc, 0x72, 0xc2, 0x5f, 0xa3, 0x44,
+    0x87, 0x22, 0x42, 0x5f, 0xaf, 0xc6, 0x0b, 0x09, 0x0f, 0xbf, 0x29, 0xc6,
+    0x02, 0xd1, 0x0f, 0xa9, 0xa0, 0xc6, 0x02, 0xd1, 0x0f, 0xbf, 0x11, 0xc6,
+    0x0b, 0x09, 0x0f, 0xbf, 0x48, 0x43, 0x02, 0x6f, 0xc2, 0x5f, 0xc1, 0x46,
+    0x19, 0x02, 0x42, 0x5f, 0xcd, 0x43, 0x02, 0xa0, 0xc2, 0x5f, 0xdf, 0xdb,
+    0x18, 0x54, 0x01, 0x57, 0xe0, 0xc6, 0x02, 0xd1, 0x0f, 0xbf, 0x09, 0xc6,
+    0x0b, 0x09, 0x0f, 0xbf, 0x40, 0xc6, 0x02, 0xd1, 0x0f, 0xbf, 0x19, 0xc6,
+    0x0b, 0x09, 0x0f, 0xbf, 0x50, 0x46, 0x02, 0x0f, 0xc2, 0x5f, 0xeb, 0x48,
+    0x19, 0x9b, 0x42, 0x60, 0xa1, 0xcd, 0x78, 0x57, 0x00, 0xeb, 0xf1, 0xcd,
+    0x7b, 0x63, 0x00, 0xeb, 0xd8, 0xc4, 0x74, 0x82, 0x01, 0x04, 0xa0, 0x96,
+    0x00, 0xe8, 0xdb, 0x02, 0x60, 0xbd, 0x8e, 0x00, 0x14, 0xfb, 0x02, 0x60,
+    0xc3, 0x87, 0x00, 0xe8, 0x3b, 0x02, 0x60, 0xc9, 0x9c, 0x00, 0xe9, 0x11,
+    0x99, 0x00, 0xe9, 0x09, 0x98, 0x00, 0xe9, 0x01, 0x97, 0x00, 0xe8, 0xe1,
+    0x94, 0x00, 0x14, 0x03, 0x02, 0x60, 0xd5, 0x92, 0x00, 0xe8, 0xc1, 0x91,
+    0x00, 0xe8, 0x7b, 0x02, 0x60, 0xe7, 0x8f, 0x00, 0xe8, 0x69, 0x8d, 0x00,
+    0xe8, 0x59, 0x8c, 0x00, 0xe8, 0x51, 0x86, 0x00, 0xe8, 0x29, 0x85, 0x00,
+    0xe8, 0x21, 0x84, 0x00, 0x14, 0xcb, 0x02, 0x60, 0xf5, 0x83, 0x00, 0xe8,
+    0x03, 0x02, 0x60, 0xfb, 0x89, 0x00, 0x13, 0x13, 0x02, 0x60, 0xff, 0x8b,
+    0x00, 0x13, 0x53, 0x02, 0x61, 0x05, 0x90, 0x00, 0x13, 0xa1, 0x9b, 0x00,
+    0x14, 0x79, 0x8a, 0x00, 0x14, 0xe1, 0x88, 0x05, 0x39, 0x81, 0x95, 0x05,
+    0x39, 0x89, 0x93, 0x05, 0x3d, 0x78, 0xca, 0x45, 0x1d, 0x0e, 0xf8, 0x78,
+    0xc4, 0x00, 0x32, 0x0e, 0xf8, 0x71, 0xc6, 0x01, 0x73, 0x00, 0x0d, 0xf0,
+    0xd4, 0x01, 0x13, 0x0e, 0xf8, 0x50, 0xd8, 0x23, 0x33, 0x00, 0x15, 0x11,
+    0xc8, 0xba, 0xda, 0x00, 0x0d, 0x50, 0xc5, 0x01, 0x0e, 0x00, 0x14, 0xc1,
+    0xca, 0x54, 0x9e, 0x00, 0x15, 0x60, 0x9b, 0x00, 0x02, 0xcb, 0x02, 0x61,
+    0x0b, 0x8f, 0x00, 0x02, 0x6b, 0x02, 0x61, 0x17, 0x97, 0x00, 0x02, 0xab,
+    0x02, 0x61, 0x23, 0x91, 0x00, 0x02, 0x7b, 0x02, 0x61, 0x2d, 0x8b, 0x00,
+    0x02, 0x4b, 0x02, 0x61, 0x51, 0x87, 0x00, 0x02, 0x2b, 0x02, 0x61, 0x67,
+    0x83, 0x00, 0x02, 0x0b, 0x02, 0x61, 0x8f, 0x95, 0x00, 0x02, 0x9b, 0x02,
+    0x61, 0xc5, 0x9c, 0x00, 0x02, 0xd3, 0x02, 0x61, 0xe7, 0x9a, 0x00, 0x02,
+    0xc3, 0x02, 0x61, 0xed, 0x99, 0x00, 0x02, 0xbb, 0x02, 0x61, 0xf3, 0x98,
+    0x00, 0x02, 0xb3, 0x02, 0x61, 0xff, 0x96, 0x00, 0x02, 0xa3, 0x02, 0x62,
+    0x1b, 0x94, 0x00, 0x02, 0x93, 0x02, 0x62, 0x40, 0x92, 0x00, 0x02, 0x83,
+    0x02, 0x62, 0x50, 0x90, 0x00, 0x02, 0x73, 0x02, 0x62, 0x56, 0x8e, 0x00,
+    0x02, 0x63, 0x02, 0x62, 0x60, 0x8d, 0x00, 0x02, 0x5b, 0x02, 0x62, 0x6a,
+    0x8a, 0x00, 0x02, 0x43, 0x02, 0x62, 0x70, 0x89, 0x00, 0x02, 0x3b, 0x02,
+    0x62, 0x88, 0x88, 0x00, 0x02, 0x33, 0x02, 0x62, 0xa0, 0x86, 0x00, 0x02,
+    0x23, 0x02, 0x62, 0xa6, 0x85, 0x00, 0x02, 0x1b, 0x02, 0x62, 0xb3, 0x84,
+    0x00, 0x02, 0x13, 0x02, 0x62, 0xd4, 0x8c, 0x00, 0x02, 0x53, 0x02, 0x62,
+    0xe6, 0x93, 0x00, 0x02, 0x8a, 0x02, 0x62, 0xec, 0xc2, 0x00, 0x0b, 0x00,
+    0x09, 0x91, 0xc2, 0x49, 0x0c, 0x00, 0x0a, 0x90, 0x42, 0x01, 0x7c, 0xc2,
+    0x62, 0xf2, 0x43, 0xe5, 0xc3, 0x42, 0x62, 0xfe, 0xc3, 0x91, 0x00, 0x00,
+    0x74, 0x31, 0xc3, 0x1c, 0x63, 0x00, 0x74, 0x49, 0xc3, 0xe5, 0xf0, 0x00,
+    0x74, 0x61, 0x10, 0xc2, 0x63, 0x0a, 0x42, 0x02, 0x10, 0xc2, 0x63, 0x16,
+    0x06, 0xc2, 0x63, 0x20, 0xc3, 0x39, 0x6d, 0x00, 0x75, 0x01, 0xc3, 0x12,
+    0xad, 0x00, 0x75, 0x60, 0xc4, 0xdf, 0x43, 0x00, 0x74, 0xe1, 0xc3, 0x02,
+    0x45, 0x00, 0x74, 0xf0, 0xc3, 0x02, 0x45, 0x00, 0x74, 0x51, 0xc4, 0xdf,
+    0x43, 0x00, 0x75, 0x50, 0xc2, 0x00, 0xd0, 0x00, 0x75, 0x41, 0xc2, 0x0d,
+    0xf6, 0x00, 0x75, 0x48, 0xc4, 0xdf, 0x43, 0x00, 0x74, 0xb1, 0xc3, 0x02,
+    0x45, 0x00, 0x74, 0xb8, 0xc2, 0x00, 0x45, 0x00, 0x74, 0xe9, 0xc2, 0x0c,
+    0x42, 0x00, 0x74, 0xf8, 0xc3, 0x00, 0x74, 0x00, 0x75, 0x19, 0xc3, 0x65,
+    0xba, 0x00, 0x75, 0x28, 0xd1, 0x51, 0xbc, 0x0f, 0xdc, 0xe9, 0xc2, 0x00,
+    0x49, 0x01, 0x2f, 0xc8, 0x55, 0x0a, 0x4c, 0xc2, 0x63, 0x2a, 0x48, 0x0a,
+    0x53, 0xc2, 0x63, 0x3c, 0x4a, 0x13, 0xe3, 0x42, 0x63, 0x48, 0xc6, 0x04,
+    0xe1, 0x0f, 0xda, 0x91, 0xc5, 0x00, 0x2c, 0x0f, 0xda, 0x98, 0xd1, 0x51,
+    0xbc, 0x0f, 0xdc, 0xe1, 0xc2, 0x00, 0x49, 0x01, 0x2f, 0xc0, 0xc6, 0x04,
+    0xe1, 0x0f, 0xda, 0xb9, 0xc5, 0x00, 0x2c, 0x0f, 0xda, 0xc0, 0x55, 0x16,
+    0xaa, 0xc2, 0x63, 0x54, 0x48, 0x0a, 0x53, 0xc2, 0x63, 0x66, 0x4a, 0x13,
+    0xe3, 0x42, 0x63, 0x72, 0xd5, 0x35, 0x60, 0x0f, 0xdc, 0xd1, 0xd0, 0x06,
+    0xd7, 0x0f, 0xdc, 0x00, 0xe0, 0x08, 0x67, 0x0f, 0xdb, 0x50, 0xe0, 0x0a,
+    0x27, 0x0f, 0xdc, 0x90, 0xe0, 0x01, 0xc7, 0x0f, 0xdc, 0x88, 0xd9, 0x1b,
+    0xd1, 0x0f, 0xc4, 0xa9, 0xcb, 0x8a, 0x46, 0x01, 0x0f, 0x5b, 0x02, 0x63,
+    0x7e, 0xc8, 0xae, 0xbc, 0x01, 0x0f, 0x52, 0x02, 0x63, 0x84, 0xca, 0x03,
+    0xdd, 0x0f, 0xc4, 0x89, 0x48, 0x01, 0x9a, 0x42, 0x63, 0x8a, 0xd1, 0x53,
+    0x98, 0x01, 0x4a, 0x49, 0xd8, 0x05, 0xcf, 0x01, 0x5f, 0x68, 0x45, 0x00,
+    0x8c, 0xc2, 0x63, 0x9f, 0xdc, 0x14, 0x15, 0x01, 0x0e, 0x29, 0xc8, 0xae,
+    0xbc, 0x01, 0x0d, 0x29, 0xc6, 0x10, 0x9d, 0x01, 0x48, 0x91, 0xda, 0x1c,
+    0x1e, 0x0f, 0xdd, 0xc0, 0xc5, 0x01, 0x4a, 0x01, 0x0d, 0xf9, 0x00, 0x42,
+    0x63, 0xcf, 0xc5, 0x01, 0x4a, 0x01, 0x0d, 0xf1, 0x00, 0x42, 0x63, 0xe1,
+    0xdb, 0x15, 0xb1, 0x01, 0x19, 0x21, 0xd2, 0x46, 0x6b, 0x01, 0x5d, 0xc8,
+    0xd6, 0x31, 0x98, 0x01, 0x52, 0x41, 0xcc, 0x06, 0xbb, 0x01, 0x52, 0x30,
+    0xca, 0xa4, 0xcc, 0x01, 0x52, 0x29, 0xc7, 0x80, 0x70, 0x01, 0x52, 0x11,
+    0xca, 0x8d, 0xb1, 0x01, 0x52, 0x08, 0xcf, 0x15, 0x36, 0x0f, 0xbd, 0xf1,
+    0x42, 0x00, 0xac, 0xc2, 0x63, 0xed, 0x48, 0x0a, 0xa9, 0x42, 0x63, 0xf3,
+    0xc8, 0x00, 0xbf, 0x01, 0x3b, 0x11, 0xc6, 0x00, 0x91, 0x01, 0x3a, 0xb8,
+    0xc6, 0x02, 0xd1, 0x0f, 0xbc, 0x39, 0xd6, 0x2e, 0xac, 0x01, 0x36, 0xd9,
+    0xc6, 0x0b, 0x09, 0x0f, 0xbc, 0x88, 0xdd, 0x10, 0xc0, 0x0f, 0xb3, 0xd9,
+    0xc5, 0x13, 0x53, 0x0f, 0xbd, 0x60, 0x4e, 0x47, 0x15, 0xc2, 0x64, 0x05,
+    0x45, 0x20, 0x6c, 0x42, 0x64, 0x11, 0x45, 0x01, 0xb4, 0xc2, 0x64, 0x1d,
+    0x42, 0x01, 0x0c, 0x42, 0x64, 0x29, 0x49, 0x01, 0xaa, 0xc2, 0x64, 0x35,
+    0xc5, 0x01, 0xa2, 0x01, 0x3c, 0xd0, 0xc3, 0xe5, 0x8a, 0x0f, 0xb3, 0x21,
+    0xc9, 0xb4, 0x91, 0x0f, 0xb2, 0xe0, 0xc9, 0x8e, 0x0a, 0x0f, 0xaa, 0x39,
+    0xca, 0x9c, 0x48, 0x01, 0x5a, 0xa8, 0x48, 0x00, 0x29, 0xc2, 0x64, 0x41,
+    0x00, 0x42, 0x64, 0x47, 0x50, 0x01, 0xa9, 0xc2, 0x64, 0x53, 0x51, 0x08,
+    0xa9, 0x42, 0x64, 0x5f, 0xd7, 0x28, 0x88, 0x01, 0x3d, 0xd9, 0x46, 0x0a,
+    0xef, 0x42, 0x64, 0x6b, 0xca, 0x22, 0x51, 0x0f, 0xbe, 0x99, 0xcd, 0x0e,
+    0x61, 0x0f, 0xbe, 0xa0, 0x4b, 0x14, 0xd9, 0xc2, 0x64, 0x77, 0x00, 0x42,
+    0x64, 0x89, 0xe0, 0x0c, 0x07, 0x01, 0x3d, 0x70, 0xd5, 0x03, 0xd2, 0x0f,
+    0xc0, 0xc9, 0xdb, 0x17, 0x46, 0x0f, 0xc0, 0xe8, 0xe0, 0x0a, 0xa7, 0x01,
+    0x3d, 0x40, 0xce, 0x6c, 0x60, 0x01, 0x3a, 0x31, 0xc7, 0xa7, 0xc7, 0x01,
+    0x38, 0xa0, 0x46, 0x00, 0x8b, 0xc2, 0x64, 0x95, 0xc9, 0xb2, 0x48, 0x01,
+    0x5a, 0xc8, 0xe0, 0x03, 0xa7, 0x01, 0x3d, 0x00, 0x45, 0x00, 0x5a, 0xc2,
+    0x64, 0xa1, 0xc9, 0x99, 0x62, 0x0f, 0xa5, 0x91, 0x53, 0x08, 0xa7, 0x42,
+    0x64, 0xad, 0xcb, 0x03, 0xbc, 0x01, 0x3c, 0xcb, 0x02, 0x64, 0xb9, 0x50,
+    0x01, 0xa9, 0x42, 0x64, 0xbf, 0xc3, 0x05, 0x14, 0x0f, 0xc4, 0xe3, 0x02,
+    0x64, 0xcb, 0xca, 0x9d, 0x2e, 0x0f, 0xc4, 0xe8, 0xcf, 0x15, 0x36, 0x0f,
+    0xbd, 0x91, 0xd2, 0x22, 0x49, 0x0f, 0xbe, 0x50, 0xc6, 0x7c, 0x7b, 0x0f,
+    0xa4, 0xe9, 0xc5, 0x01, 0xa2, 0x0f, 0xa4, 0xc1, 0xcf, 0x64, 0x68, 0x0f,
+    0x9c, 0xa0, 0x9e, 0x0d, 0x85, 0x41, 0x9d, 0x0d, 0x85, 0x38, 0x9e, 0x0d,
+    0x81, 0x09, 0x9d, 0x0d, 0x81, 0x00, 0xcd, 0x79, 0xb6, 0x07, 0xd8, 0xf9,
+    0x47, 0x00, 0x58, 0xc2, 0x64, 0xcf, 0xc7, 0xc1, 0xaf, 0x00, 0x2f, 0x88,
+    0x46, 0x00, 0x8b, 0x42, 0x64, 0xdb, 0x46, 0x00, 0x8b, 0x42, 0x64, 0xe7,
+    0x46, 0x00, 0x8b, 0x42, 0x64, 0xf3, 0x46, 0x00, 0x8b, 0x42, 0x64, 0xff,
+    0xc2, 0x04, 0xad, 0x00, 0x2f, 0x53, 0x02, 0x65, 0x0b, 0xc4, 0xd4, 0xda,
+    0x00, 0x2f, 0x33, 0x02, 0x65, 0x11, 0xc2, 0x00, 0x3d, 0x00, 0x2e, 0xc2,
+    0x02, 0x65, 0x17, 0xc3, 0x11, 0xef, 0x00, 0x2f, 0x4b, 0x02, 0x65, 0x1d,
+    0xc5, 0xdc, 0x2c, 0x00, 0x2f, 0x0a, 0x02, 0x65, 0x23, 0xcc, 0x84, 0x75,
+    0x07, 0xda, 0x40, 0xcc, 0x84, 0x75, 0x07, 0xda, 0x38, 0xc2, 0x00, 0x67,
+    0x00, 0x2f, 0x1b, 0x02, 0x65, 0x29, 0xc3, 0xba, 0x37, 0x00, 0x2e, 0xd3,
+    0x02, 0x65, 0x2f, 0xc5, 0xd4, 0xd9, 0x00, 0x2f, 0x29, 0xc3, 0x20, 0x18,
+    0x00, 0x2e, 0xf9, 0xc3, 0x00, 0x4e, 0x00, 0x2e, 0xe8, 0xcc, 0x84, 0x75,
+    0x07, 0xda, 0x00, 0xcc, 0x84, 0x75, 0x07, 0xd9, 0xf0, 0xcc, 0x84, 0x75,
+    0x07, 0xd9, 0xe0, 0x46, 0x00, 0x8b, 0x42, 0x65, 0x35, 0xcc, 0x84, 0x75,
+    0x07, 0xd9, 0xb0, 0xcb, 0x91, 0xa4, 0x07, 0xd9, 0xa1, 0x96, 0x00, 0x2e,
+    0xb8, 0xcc, 0x84, 0x75, 0x07, 0xd9, 0x98, 0xcc, 0x84, 0x75, 0x07, 0xd9,
+    0x90, 0x0e, 0xc2, 0x65, 0x41, 0xc3, 0x16, 0x5a, 0x00, 0x2f, 0x10, 0xc3,
+    0x22, 0x14, 0x07, 0xd9, 0x41, 0xc4, 0x5d, 0xe2, 0x07, 0xd9, 0x39, 0xc9,
+    0xb4, 0xb5, 0x07, 0xd9, 0x31, 0xc5, 0xa2, 0x83, 0x07, 0xd9, 0x29, 0xc3,
+    0xba, 0x37, 0x07, 0xd9, 0x21, 0xc2, 0x01, 0x7f, 0x07, 0xd9, 0x19, 0xc5,
+    0x40, 0x9a, 0x07, 0xd9, 0x11, 0xc4, 0x06, 0x5a, 0x07, 0xd9, 0x08, 0xc5,
+    0xcc, 0xe4, 0x00, 0x2d, 0xc3, 0x02, 0x65, 0x50, 0xc5, 0xd8, 0xfd, 0x00,
+    0x2d, 0xd8, 0xc6, 0x44, 0x50, 0x00, 0x2e, 0x11, 0x0a, 0xc2, 0x65, 0x56,
+    0xc4, 0xa0, 0x89, 0x00, 0x2d, 0xb0, 0xc4, 0xd5, 0xa7, 0x00, 0x2d, 0xcb,
+    0x02, 0x65, 0x62, 0xc4, 0xd5, 0x84, 0x00, 0x2d, 0xa1, 0x45, 0xd5, 0xb5,
+    0x42, 0x65, 0x68, 0xc6, 0xcb, 0x63, 0x00, 0x2f, 0xa1, 0xc3, 0x26, 0x1a,
+    0x00, 0x2f, 0x98, 0xc3, 0x0f, 0x99, 0x00, 0x2c, 0xc1, 0x44, 0xe3, 0xeb,
+    0x42, 0x65, 0x7a, 0x46, 0xcf, 0x7d, 0xc2, 0x65, 0x86, 0xc3, 0x1e, 0x95,
+    0x00, 0x2c, 0xd8, 0xc7, 0xc5, 0xad, 0x00, 0x2c, 0xe8, 0xc7, 0xc5, 0xfa,
+    0x00, 0x2d, 0x30, 0xce, 0x73, 0xc2, 0x02, 0x6e, 0x01, 0xcc, 0x83, 0x31,
+    0x02, 0x6e, 0xe9, 0xc7, 0xc4, 0x8e, 0x02, 0x6f, 0x88, 0x14, 0xc2, 0x65,
+    0x92, 0xcc, 0x8b, 0xf5, 0x02, 0x6e, 0xe0, 0xc3, 0x08, 0x93, 0x02, 0x6f,
+    0x79, 0xc7, 0xc8, 0xf5, 0x02, 0x6f, 0xb8, 0x12, 0xc2, 0x65, 0x9e, 0xc6,
+    0xd3, 0x37, 0x02, 0x6e, 0xc8, 0xc7, 0xc9, 0x3b, 0x01, 0x5e, 0x19, 0xc7,
+    0xc2, 0xc0, 0x01, 0x59, 0x18, 0xc7, 0x33, 0xdf, 0x00, 0x00, 0x4b, 0x02,
+    0x65, 0xa8, 0xc4, 0x3b, 0x19, 0x01, 0x5b, 0xf0, 0x95, 0x0f, 0x9e, 0xc0,
+    0xc4, 0x18, 0x10, 0x08, 0x69, 0xb9, 0xc2, 0x22, 0xcc, 0x08, 0x69, 0xb0,
+    0xc3, 0x0d, 0x14, 0x08, 0x69, 0xa9, 0xc3, 0x09, 0x9e, 0x08, 0x69, 0xa0,
+    0xc4, 0x02, 0xde, 0x08, 0x69, 0x99, 0xc2, 0x02, 0xa0, 0x08, 0x69, 0x90,
+    0xc3, 0x0d, 0x23, 0x08, 0x69, 0x39, 0xc2, 0x00, 0xc1, 0x08, 0x69, 0x31,
+    0xc4, 0x75, 0x13, 0x08, 0x69, 0x28, 0xc2, 0x19, 0x2c, 0x08, 0x68, 0xd9,
+    0xc2, 0x01, 0x30, 0x08, 0x68, 0xd1, 0x83, 0x08, 0x68, 0xa8, 0x45, 0xd4,
+    0x11, 0xc2, 0x65, 0xac, 0x83, 0x08, 0x68, 0x89, 0xc2, 0x00, 0xd0, 0x08,
+    0x68, 0x40, 0xc2, 0x00, 0x39, 0x08, 0x68, 0x69, 0x83, 0x08, 0x68, 0x60,
+    0xc2, 0x0e, 0x9a, 0x08, 0x68, 0x59, 0x83, 0x08, 0x68, 0x50, 0xc2, 0x01,
+    0x6f, 0x08, 0x68, 0x21, 0x83, 0x08, 0x68, 0x18, 0x83, 0x08, 0x68, 0x79,
+    0xc2, 0x00, 0xd0, 0x08, 0x68, 0x80, 0x83, 0x00, 0xb9, 0x41, 0xc2, 0x01,
+    0x30, 0x00, 0xb9, 0x28, 0xc5, 0xd6, 0x8c, 0x00, 0x88, 0x2b, 0x02, 0x65,
+    0xb8, 0x15, 0xc2, 0x65, 0xbc, 0xc5, 0x90, 0xe4, 0x00, 0x88, 0x93, 0x02,
+    0x65, 0xcb, 0x12, 0xc2, 0x65, 0xd1, 0xc5, 0xb7, 0x9d, 0x00, 0x88, 0x5b,
+    0x02, 0x65, 0xe9, 0xc5, 0xda, 0xe7, 0x00, 0x88, 0x33, 0x02, 0x65, 0xed,
+    0x16, 0xc2, 0x65, 0xf1, 0x0d, 0xc2, 0x66, 0x00, 0xc5, 0xd9, 0x61, 0x00,
+    0x88, 0x13, 0x02, 0x66, 0x15, 0x05, 0xc2, 0x66, 0x19, 0x42, 0x0c, 0x43,
+    0xc2, 0x66, 0x2e, 0xc6, 0x92, 0x0c, 0x00, 0x8a, 0xf8, 0x49, 0xb4, 0x76,
+    0xc2, 0x66, 0x3a, 0x49, 0xad, 0x02, 0x42, 0x66, 0x71, 0x0d, 0xc2, 0x66,
+    0xb8, 0x15, 0xc2, 0x66, 0xcd, 0xc5, 0xd9, 0x61, 0x01, 0x89, 0xa3, 0x02,
+    0x66, 0xdc, 0x16, 0xc2, 0x66, 0xe0, 0xc5, 0xd6, 0x8c, 0x01, 0x89, 0xcb,
+    0x02, 0x66, 0xec, 0xc5, 0xda, 0xe7, 0x01, 0x8a, 0x0b, 0x02, 0x66, 0xf0,
+    0x12, 0xc2, 0x66, 0xf4, 0x8b, 0x01, 0x8b, 0x1b, 0x02, 0x67, 0x09, 0x05,
+    0xc2, 0x67, 0x0f, 0xc5, 0x90, 0xe4, 0x01, 0x8a, 0x71, 0x83, 0x01, 0x8a,
+    0x7b, 0x02, 0x67, 0x1b, 0x1b, 0xc2, 0x67, 0x28, 0x87, 0x01, 0x8a, 0xa3,
+    0x02, 0x67, 0x48, 0x91, 0x01, 0x8a, 0xbb, 0x02, 0x67, 0x50, 0x19, 0xc2,
+    0x67, 0x54, 0x97, 0x01, 0x8a, 0xe0, 0x19, 0xc2, 0x67, 0x66, 0x0a, 0xc2,
+    0x67, 0x70, 0xc2, 0x00, 0xc4, 0x01, 0x81, 0xc0, 0xc3, 0x09, 0x9e, 0x01,
+    0x81, 0x21, 0xc3, 0x0d, 0x14, 0x01, 0x81, 0x28, 0xc2, 0x22, 0xcc, 0x01,
+    0x81, 0x31, 0xc4, 0x18, 0x10, 0x01, 0x81, 0x38, 0xc8, 0x0d, 0x03, 0x08,
+    0x47, 0xf8, 0xc5, 0x28, 0xee, 0x08, 0x47, 0xf1, 0xc2, 0x00, 0xc4, 0x08,
+    0x47, 0xe8, 0xc2, 0x39, 0x8b, 0x08, 0x47, 0xa9, 0xc3, 0x1e, 0x1b, 0x08,
+    0x47, 0x40, 0xc3, 0x11, 0xef, 0x08, 0x47, 0xa1, 0x03, 0x42, 0x67, 0x7c,
+    0xc2, 0x17, 0xb6, 0x08, 0x47, 0x79, 0xc4, 0x36, 0xb5, 0x08, 0x47, 0x00,
+    0xc2, 0x00, 0x8e, 0x08, 0x47, 0x38, 0x19, 0xc2, 0x67, 0x88, 0x15, 0xc2,
+    0x67, 0x90, 0x83, 0x07, 0xfb, 0x89, 0x8b, 0x07, 0xfb, 0x91, 0x97, 0x07,
+    0xfb, 0x99, 0x87, 0x07, 0xfb, 0xa1, 0x91, 0x07, 0xfb, 0xa9, 0x0d, 0xc2,
+    0x67, 0xaa, 0x16, 0xc2, 0x67, 0xbe, 0x90, 0x07, 0xfc, 0xeb, 0x02, 0x67,
+    0xd2, 0x0a, 0xc2, 0x67, 0xe6, 0x0f, 0xc2, 0x67, 0xfa, 0x1b, 0xc2, 0x68,
+    0x0e, 0x14, 0x42, 0x68, 0x1a, 0xc5, 0x8e, 0xdf, 0x07, 0xfd, 0x0b, 0x02,
+    0x68, 0x2e, 0xc6, 0xbb, 0xec, 0x07, 0xfd, 0xd8, 0x44, 0x3a, 0xbf, 0xc2,
+    0x68, 0x34, 0xc3, 0x39, 0x37, 0x07, 0xfd, 0xa8, 0x02, 0x42, 0x68, 0x52,
+    0xc4, 0x79, 0xf3, 0x07, 0xfd, 0x93, 0x02, 0x68, 0x74, 0xc6, 0xba, 0x7c,
+    0x07, 0xfd, 0xe8, 0xc4, 0xb7, 0x9e, 0x07, 0xfd, 0xb8, 0xc4, 0xc6, 0x7a,
+    0x07, 0xfd, 0xc1, 0xc6, 0xc6, 0x79, 0x07, 0xfd, 0xd0, 0xc6, 0xc1, 0x86,
+    0x07, 0xfd, 0xe1, 0xc5, 0xc0, 0x7d, 0x07, 0xfd, 0x38, 0x87, 0x07, 0xfe,
+    0x18, 0x83, 0x07, 0xfe, 0x23, 0x02, 0x68, 0x7a, 0x87, 0x07, 0xfe, 0x5b,
+    0x02, 0x68, 0x7e, 0x91, 0x07, 0xfe, 0x91, 0x97, 0x07, 0xfe, 0xb9, 0x8b,
+    0x07, 0xfe, 0xd8, 0x91, 0x07, 0xfe, 0x31, 0x97, 0x07, 0xfe, 0xd0, 0x87,
+    0x07, 0xfe, 0x78, 0x83, 0x07, 0xfe, 0x6b, 0x02, 0x68, 0x82, 0x87, 0x07,
+    0xfe, 0xab, 0x02, 0x68, 0x86, 0x8b, 0x07, 0xfe, 0xb0, 0x02, 0x42, 0x68,
+    0x8a, 0xc2, 0x0c, 0x43, 0x0d, 0x80, 0x09, 0xc2, 0x14, 0x68, 0x0d, 0x88,
+    0xf8, 0x19, 0xc2, 0x68, 0x96, 0x83, 0x01, 0x82, 0x09, 0x8b, 0x01, 0x82,
+    0x19, 0x97, 0x01, 0x82, 0x29, 0x87, 0x01, 0x82, 0x39, 0x91, 0x01, 0x82,
+    0x49, 0xc2, 0x00, 0x16, 0x01, 0x83, 0x19, 0x1b, 0xc2, 0x68, 0xa6, 0x0d,
+    0x42, 0x68, 0xb2, 0xcd, 0x78, 0xcc, 0x0f, 0xdc, 0xb1, 0xc5, 0x01, 0xc2,
+    0x0f, 0xdd, 0x88, 0xe0, 0x08, 0xa7, 0x0f, 0xdd, 0xa0, 0xc5, 0x68, 0x6e,
+    0x01, 0x11, 0xf1, 0xc9, 0xaf, 0x4b, 0x01, 0x72, 0x2a, 0x02, 0x68, 0xba,
+    0xc6, 0xca, 0xcd, 0x07, 0xff, 0xc9, 0xc9, 0x1b, 0x0a, 0x07, 0xff, 0xd1,
+    0xca, 0x7c, 0x02, 0x07, 0xff, 0xd8, 0x43, 0x13, 0x6d, 0xc2, 0x68, 0xc0,
+    0x46, 0x00, 0xd4, 0xc2, 0x68, 0xc6, 0x45, 0x00, 0x8c, 0x42, 0x68, 0xd2,
+    0x42, 0x05, 0x1d, 0xc2, 0x68, 0xe4, 0xc7, 0x80, 0x70, 0x01, 0x50, 0xd9,
+    0xcc, 0x06, 0xbb, 0x01, 0x50, 0xc9, 0xca, 0x9d, 0xb0, 0x01, 0x50, 0xc1,
+    0xd9, 0x1f, 0x4a, 0x01, 0x50, 0xb9, 0xcd, 0x75, 0xa6, 0x01, 0x50, 0x70,
+    0xd6, 0x30, 0xa6, 0x01, 0x50, 0xa9, 0xd1, 0x56, 0x40, 0x01, 0x50, 0x78,
+    0xc3, 0x05, 0x14, 0x08, 0x5b, 0xc3, 0x02, 0x68, 0xf0, 0x16, 0xc2, 0x68,
+    0xf4, 0xc4, 0x09, 0x9d, 0x08, 0x5b, 0xd8, 0x16, 0xc2, 0x69, 0x04, 0x15,
+    0xc2, 0x69, 0x10, 0xc2, 0x00, 0x67, 0x08, 0x5b, 0x79, 0xc3, 0x20, 0x18,
+    0x08, 0x5b, 0x69, 0xc8, 0xb9, 0x7a, 0x08, 0x5b, 0x61, 0xc6, 0xcf, 0xd7,
+    0x08, 0x5b, 0x59, 0xc4, 0xe0, 0xe7, 0x08, 0x5b, 0x51, 0xc4, 0x4a, 0xb9,
+    0x08, 0x5b, 0x49, 0xc2, 0x01, 0x7f, 0x08, 0x5b, 0x23, 0x02, 0x69, 0x1a,
+    0xc5, 0x4a, 0xb3, 0x08, 0x5b, 0x31, 0xcd, 0x7e, 0x89, 0x08, 0x5b, 0x29,
+    0xc6, 0x40, 0x9a, 0x08, 0x5b, 0x19, 0xc5, 0x9c, 0xa2, 0x08, 0x5b, 0x11,
+    0xc4, 0xe3, 0x27, 0x08, 0x5b, 0x09, 0xc5, 0xa5, 0xfd, 0x08, 0x5b, 0x00,
+    0xc3, 0x05, 0x14, 0x08, 0x5a, 0xc3, 0x02, 0x69, 0x20, 0x16, 0xc2, 0x69,
+    0x24, 0xc4, 0x09, 0x9d, 0x08, 0x5a, 0xd8, 0x16, 0xc2, 0x69, 0x34, 0x15,
+    0xc2, 0x69, 0x40, 0xc4, 0x5d, 0xe2, 0x08, 0x5a, 0x99, 0xc3, 0x00, 0x4e,
+    0x08, 0x5a, 0x61, 0xc6, 0xcf, 0xd7, 0x08, 0x5a, 0x59, 0xc4, 0xe0, 0xe7,
+    0x08, 0x5a, 0x51, 0xc4, 0x4a, 0xb9, 0x08, 0x5a, 0x49, 0xc2, 0x01, 0x7f,
+    0x08, 0x5a, 0x23, 0x02, 0x69, 0x4a, 0xc5, 0x4a, 0xb3, 0x08, 0x5a, 0x31,
+    0xc3, 0x7e, 0x89, 0x08, 0x5a, 0x29, 0xc6, 0x40, 0x9a, 0x08, 0x5a, 0x19,
+    0xc5, 0x9c, 0xa2, 0x08, 0x5a, 0x11, 0xc4, 0xe3, 0x27, 0x08, 0x5a, 0x09,
+    0x03, 0xc2, 0x69, 0x50, 0xc3, 0x20, 0x18, 0x08, 0x5a, 0x69, 0xc2, 0x00,
+    0x67, 0x08, 0x5a, 0x81, 0xc4, 0xb9, 0x7e, 0x08, 0x5a, 0x90, 0xc3, 0x05,
+    0x14, 0x00, 0x00, 0xf9, 0x16, 0xc2, 0x69, 0x5c, 0xc4, 0x09, 0x9d, 0x00,
+    0x00, 0xe0, 0x4a, 0x0c, 0x8c, 0xc2, 0x69, 0x68, 0x49, 0x44, 0xee, 0xc2,
+    0x69, 0x72, 0xc5, 0xdc, 0xa9, 0x0f, 0x65, 0x0b, 0x02, 0x69, 0x90, 0xc4,
+    0x41, 0x55, 0x0f, 0x64, 0xf3, 0x02, 0x69, 0x96, 0xc4, 0x26, 0x78, 0x0f,
+    0x63, 0xcb, 0x02, 0x69, 0x9c, 0xc5, 0x06, 0xdb, 0x0f, 0x63, 0xc3, 0x02,
+    0x69, 0xa9, 0x15, 0xc2, 0x69, 0xb4, 0x08, 0xc2, 0x69, 0xc6, 0x16, 0xc2,
+    0x69, 0xce, 0xc3, 0x05, 0x14, 0x0f, 0x63, 0x8a, 0x02, 0x69, 0xdf, 0xce,
+    0x08, 0x73, 0x0f, 0x65, 0x79, 0x44, 0x05, 0x14, 0x42, 0x69, 0xe3, 0xc3,
+    0x0d, 0x14, 0x0e, 0x9b, 0xb1, 0xc3, 0x09, 0x9e, 0x0e, 0x9b, 0xa8, 0xc4,
+    0x02, 0xde, 0x0e, 0x9b, 0xa1, 0xc2, 0x02, 0xa0, 0x0e, 0x9b, 0x98, 0x0c,
+    0xc2, 0x69, 0xef, 0xc8, 0xb6, 0x8a, 0x01, 0x96, 0x09, 0x42, 0x01, 0xc3,
+    0xc2, 0x69, 0xf9, 0x03, 0xc2, 0x6a, 0x03, 0xc9, 0xa8, 0xee, 0x01, 0x96,
+    0x41, 0xc7, 0xc9, 0x2d, 0x01, 0x96, 0x49, 0xc8, 0xbc, 0x22, 0x01, 0x96,
+    0x51, 0x06, 0xc2, 0x6a, 0x0f, 0x45, 0xd6, 0x19, 0x42, 0x6a, 0x1b, 0xc5,
+    0x00, 0x2c, 0x01, 0x7f, 0x81, 0xd0, 0x5d, 0x62, 0x01, 0x7f, 0x90, 0xc5,
+    0x05, 0x02, 0x01, 0x7f, 0x89, 0xd0, 0x5d, 0x72, 0x01, 0x7f, 0x98, 0xc5,
+    0x00, 0xd4, 0x01, 0x7f, 0xa9, 0xc5, 0x05, 0x02, 0x01, 0x7f, 0xb1, 0x0e,
+    0xc2, 0x6a, 0x40, 0x46, 0x02, 0xae, 0x42, 0x6a, 0x4c, 0xc8, 0xbd, 0x1a,
+    0x01, 0x8c, 0xa1, 0xc8, 0xb6, 0x72, 0x01, 0x8c, 0xd8, 0xc5, 0x01, 0xc2,
+    0x01, 0x8c, 0xa9, 0xc7, 0x36, 0x55, 0x01, 0x8c, 0xe0, 0xc2, 0x00, 0xc4,
+    0x08, 0x42, 0xdb, 0x02, 0x6a, 0x58, 0x19, 0xc2, 0x6a, 0x5e, 0xc4, 0x02,
+    0xde, 0x08, 0x42, 0xd0, 0x00, 0x42, 0x6a, 0x68, 0xc2, 0x39, 0x8b, 0x08,
+    0x42, 0xa9, 0xc3, 0x1e, 0x1b, 0x08, 0x42, 0x40, 0xc3, 0x11, 0xef, 0x08,
+    0x42, 0xa1, 0x03, 0x42, 0x6a, 0x74, 0xc3, 0x16, 0x5a, 0x08, 0x42, 0x79,
+    0xc4, 0x36, 0xb5, 0x08, 0x42, 0x00, 0xc2, 0x00, 0x8e, 0x08, 0x42, 0x38,
+    0xca, 0xa7, 0x92, 0x0f, 0xd2, 0x43, 0x02, 0x6a, 0x80, 0xc4, 0xde, 0x83,
+    0x01, 0x32, 0xb3, 0x02, 0x6a, 0x86, 0xc4, 0xe3, 0x93, 0x01, 0x32, 0xcb,
+    0x02, 0x6a, 0x8c, 0x0d, 0xc2, 0x6a, 0x92, 0xc6, 0xca, 0xfd, 0x01, 0x32,
+    0xbb, 0x02, 0x6a, 0xa4, 0xc5, 0xa8, 0xf7, 0x01, 0x32, 0xab, 0x02, 0x6a,
+    0xaa, 0x47, 0x45, 0x86, 0x42, 0x6a, 0xb0, 0x00, 0x42, 0x6a, 0xcc, 0x46,
+    0x00, 0x8b, 0x42, 0x6a, 0xd8, 0x03, 0xc2, 0x6a, 0xe4, 0xc5, 0xc2, 0xc2,
+    0x01, 0x59, 0x08, 0xc7, 0xc6, 0xef, 0x01, 0x4e, 0xb1, 0xd0, 0x5a, 0x62,
+    0x01, 0x59, 0x68, 0x00, 0x42, 0x6a, 0xf3, 0x00, 0x42, 0x6b, 0x05, 0xca,
+    0x82, 0xd3, 0x01, 0x31, 0xd1, 0x44, 0x03, 0x15, 0x42, 0x6b, 0x14, 0xc9,
+    0x8e, 0x0a, 0x0f, 0xaa, 0x31, 0xca, 0x9d, 0x1a, 0x01, 0x58, 0xe0, 0x00,
+    0xc2, 0x6b, 0x1e, 0x4a, 0x01, 0xa9, 0x42, 0x6b, 0x2a, 0xe0, 0x0a, 0xc7,
+    0x0f, 0xbd, 0x00, 0x00, 0x42, 0x6b, 0x3c, 0xc4, 0x5b, 0x26, 0x01, 0x36,
+    0x09, 0xc3, 0x12, 0xb8, 0x01, 0x36, 0x00, 0x4a, 0x03, 0x3d, 0xc2, 0x6b,
+    0x54, 0x4a, 0x01, 0xa9, 0x42, 0x6b, 0x66, 0x46, 0x01, 0x94, 0xc2, 0x6b,
+    0x72, 0xc7, 0xc4, 0x80, 0x01, 0x1f, 0x10, 0x11, 0xc2, 0x6b, 0x78, 0xc2,
+    0x00, 0xb3, 0x01, 0x34, 0x82, 0x02, 0x6b, 0x84, 0xc4, 0x0e, 0x6a, 0x01,
+    0x39, 0x39, 0xc4, 0x11, 0xa4, 0x01, 0x5e, 0x70, 0x4a, 0x03, 0x3d, 0xc2,
+    0x6b, 0x8a, 0x4a, 0x01, 0xa9, 0x42, 0x6b, 0x96, 0xc5, 0x06, 0x82, 0x01,
+    0x30, 0xe9, 0xce, 0x24, 0xd5, 0x0f, 0xa2, 0x30, 0xc8, 0x01, 0x92, 0x01,
+    0x2d, 0x9b, 0x02, 0x6b, 0xa6, 0xce, 0x6c, 0x8a, 0x01, 0x2d, 0xa9, 0xc7,
+    0xc6, 0x6a, 0x0f, 0xde, 0x50, 0x15, 0xc2, 0x6b, 0xac, 0xc7, 0x3a, 0x19,
+    0x01, 0x59, 0x31, 0xc7, 0x0a, 0xe0, 0x01, 0x59, 0x40, 0xc4, 0x2b, 0xf1,
+    0x0f, 0x9f, 0x89, 0xc5, 0xbb, 0xcd, 0x01, 0x59, 0x00, 0xc9, 0x46, 0x70,
+    0x01, 0x2d, 0x79, 0xc3, 0x01, 0x5d, 0x01, 0x57, 0xf1, 0xc7, 0x5a, 0x6b,
+    0x01, 0x59, 0x78, 0xc4, 0x18, 0x10, 0x0f, 0x17, 0xb9, 0xc2, 0x22, 0xcc,
+    0x0f, 0x17, 0xb0, 0xc3, 0x0d, 0x14, 0x0f, 0x17, 0xa9, 0xc3, 0x09, 0x9e,
+    0x0f, 0x17, 0xa0, 0xc4, 0x02, 0xde, 0x0f, 0x17, 0x99, 0xc2, 0x02, 0xa0,
+    0x0f, 0x17, 0x90, 0xc2, 0x00, 0xec, 0x0f, 0x17, 0x78, 0xc2, 0x00, 0xec,
+    0x0f, 0x17, 0x68, 0xc2, 0x14, 0x77, 0x0f, 0x17, 0x59, 0x83, 0x0f, 0x16,
+    0x30, 0xc2, 0x00, 0xc4, 0x0f, 0x17, 0x50, 0xc2, 0x19, 0x2c, 0x0f, 0x17,
+    0x49, 0xc2, 0x01, 0x30, 0x0f, 0x16, 0xe9, 0x83, 0x0f, 0x16, 0x48, 0x83,
+    0x0f, 0x16, 0x03, 0x02, 0x6b, 0xbe, 0xc2, 0x00, 0x75, 0x0f, 0x17, 0x21,
+    0x97, 0x0f, 0x16, 0xb0, 0x90, 0x0f, 0x17, 0x38, 0x90, 0x0f, 0x17, 0x32,
+    0x02, 0x6b, 0xc5, 0xc2, 0x00, 0x75, 0x0f, 0x17, 0x28, 0xc2, 0x00, 0x39,
+    0x0f, 0x17, 0x09, 0xc2, 0x0d, 0xf6, 0x0f, 0x17, 0x01, 0xc2, 0x00, 0xd0,
+    0x0f, 0x16, 0x61, 0x83, 0x0f, 0x16, 0x58, 0xc3, 0x64, 0x58, 0x0f, 0x16,
+    0xf9, 0x83, 0x0f, 0x16, 0x40, 0xc2, 0x00, 0xd0, 0x0f, 0x16, 0xc9, 0x83,
+    0x0f, 0x16, 0xa0, 0xc2, 0x00, 0xd0, 0x0f, 0x16, 0x79, 0x83, 0x0f, 0x16,
+    0x70, 0x83, 0x0f, 0x16, 0x51, 0xc2, 0x00, 0xd0, 0x0f, 0x16, 0x38, 0xc6,
+    0x18, 0x10, 0x08, 0xc7, 0x81, 0xc4, 0xd2, 0x1d, 0x08, 0xc7, 0x78, 0xc4,
+    0x45, 0x6a, 0x08, 0xc7, 0x71, 0xc4, 0x4a, 0x2e, 0x08, 0xc7, 0x68, 0xc5,
+    0x0d, 0x0d, 0x08, 0xc7, 0x61, 0xc5, 0x28, 0xee, 0x08, 0xc7, 0x59, 0xc2,
+    0x00, 0xc4, 0x08, 0xc7, 0x50, 0xc4, 0x18, 0x10, 0x08, 0xc7, 0x39, 0xc2,
+    0x22, 0xcc, 0x08, 0xc7, 0x30, 0xc3, 0x0d, 0x14, 0x08, 0xc7, 0x29, 0xc3,
+    0x09, 0x9e, 0x08, 0xc7, 0x20, 0xc4, 0x02, 0xde, 0x08, 0xc7, 0x19, 0xc2,
+    0x02, 0xa0, 0x08, 0xc7, 0x10, 0xc2, 0x25, 0x9f, 0x08, 0xc6, 0xf1, 0xc3,
+    0xe5, 0xed, 0x08, 0xc6, 0xe8, 0xc2, 0x00, 0xb1, 0x08, 0xc6, 0xe1, 0x11,
+    0xc2, 0x6b, 0xc9, 0xc3, 0xbe, 0x83, 0x08, 0xc6, 0xc8, 0x8f, 0x08, 0xc6,
+    0xb1, 0x96, 0x08, 0xc6, 0xa9, 0xc2, 0x00, 0x75, 0x08, 0xc6, 0x50, 0xc3,
+    0x38, 0x86, 0x08, 0xc6, 0x99, 0xc3, 0x4f, 0x37, 0x08, 0xc6, 0x00, 0xc2,
+    0x04, 0xcd, 0x08, 0xc6, 0x88, 0x10, 0x42, 0x6b, 0xd5, 0x85, 0x08, 0xc6,
+    0x79, 0x97, 0x08, 0xc6, 0x38, 0x97, 0x08, 0xc6, 0x1b, 0x02, 0x6b, 0xdd,
+    0x91, 0x08, 0xc6, 0x29, 0x83, 0x08, 0xc6, 0x20, 0xc2, 0x25, 0x9f, 0x08,
+    0xc5, 0xf1, 0xc3, 0xe5, 0xed, 0x08, 0xc5, 0xe8, 0xc2, 0x00, 0xb1, 0x08,
+    0xc5, 0xe1, 0x11, 0xc2, 0x6b, 0xe1, 0xc3, 0xbe, 0x83, 0x08, 0xc5, 0xc8,
+    0x8f, 0x08, 0xc5, 0xb1, 0x96, 0x08, 0xc5, 0xa9, 0xc2, 0x00, 0x75, 0x08,
+    0xc5, 0x50, 0xc3, 0x38, 0x86, 0x08, 0xc5, 0x99, 0xc3, 0x4f, 0x37, 0x08,
+    0xc5, 0x00, 0xc2, 0x04, 0xcd, 0x08, 0xc5, 0x88, 0x10, 0x42, 0x6b, 0xed,
+    0x85, 0x08, 0xc5, 0x79, 0x97, 0x08, 0xc5, 0x38, 0x97, 0x08, 0xc5, 0x1b,
+    0x02, 0x6b, 0xf5, 0x91, 0x08, 0xc5, 0x29, 0x83, 0x08, 0xc5, 0x20, 0xd3,
+    0x46, 0x7d, 0x01, 0x39, 0x29, 0x43, 0x00, 0xbf, 0x42, 0x6b, 0xf9, 0xc4,
+    0x01, 0xc3, 0x01, 0x02, 0xd9, 0xcb, 0x05, 0x1c, 0x01, 0x02, 0xc0, 0x12,
+    0xc2, 0x6b, 0xff, 0xcc, 0x88, 0x1d, 0x0f, 0xc8, 0xa9, 0x16, 0xc2, 0x6c,
+    0x11, 0x11, 0xc2, 0x6c, 0x1d, 0xcf, 0x60, 0x99, 0x0f, 0xb2, 0x29, 0xcc,
+    0x87, 0x75, 0x0f, 0xb2, 0x21, 0xd0, 0x5a, 0xf2, 0x0f, 0xb0, 0xdb, 0x02,
+    0x6c, 0x2f, 0x42, 0x00, 0x99, 0xc2, 0x6c, 0x35, 0xcf, 0x67, 0x0b, 0x0f,
+    0xb1, 0x21, 0x0f, 0xc2, 0x6c, 0x41, 0xdb, 0x17, 0x7c, 0x0f, 0xc9, 0x59,
+    0xda, 0x1b, 0xea, 0x0f, 0xcb, 0xa1, 0xce, 0x6d, 0x6a, 0x0f, 0xd7, 0x20,
+    0xcf, 0x36, 0xc5, 0x01, 0x49, 0x61, 0xd0, 0x20, 0x66, 0x01, 0x49, 0x78,
+    0xc4, 0x26, 0x78, 0x07, 0xf8, 0xc9, 0xc4, 0x15, 0xe7, 0x07, 0xf8, 0x81,
+    0xc3, 0x05, 0x14, 0x07, 0xf8, 0x89, 0x16, 0xc2, 0x6c, 0x4d, 0x08, 0xc2,
+    0x6c, 0x59, 0x15, 0xc2, 0x6c, 0x65, 0xc5, 0x06, 0xdb, 0x07, 0xf8, 0xc0,
+    0xc3, 0x0d, 0xe5, 0x07, 0xf8, 0xd1, 0x42, 0x0a, 0x8c, 0x42, 0x6c, 0x71,
+    0xcc, 0x8b, 0x11, 0x07, 0xf8, 0xe1, 0x43, 0x00, 0x4b, 0x42, 0x6c, 0x7b,
+    0x4f, 0x0b, 0x17, 0xc2, 0x6c, 0x93, 0x4d, 0x29, 0xb9, 0x42, 0x6c, 0xfb,
+    0xce, 0x25, 0xad, 0x07, 0xf9, 0xe9, 0xcd, 0x00, 0x32, 0x07, 0xfa, 0xe9,
+    0xd1, 0x4f, 0x7a, 0x07, 0xfb, 0x01, 0xcb, 0x1a, 0x50, 0x07, 0xf8, 0x48,
+    0xc9, 0xb2, 0xa2, 0x0f, 0x98, 0xd9, 0xc6, 0x00, 0x91, 0x0f, 0x98, 0x98,
+    0x44, 0x1a, 0xce, 0xc2, 0x6d, 0x63, 0xc3, 0x01, 0xe2, 0x0b, 0x79, 0x90,
+    0xa5, 0x0b, 0x7c, 0xc9, 0xa4, 0x0b, 0x7c, 0xc1, 0xa3, 0x0b, 0x7c, 0xb9,
+    0xa2, 0x0b, 0x7c, 0xb1, 0xa1, 0x0b, 0x7c, 0xa9, 0xa0, 0x0b, 0x7c, 0xa1,
+    0x9f, 0x0b, 0x7c, 0x98, 0x87, 0x0b, 0x7a, 0x49, 0x83, 0x0b, 0x79, 0xb9,
+    0xc2, 0x00, 0xd0, 0x0b, 0x79, 0x71, 0xc2, 0x0d, 0xf6, 0x0b, 0x79, 0x50,
+    0xc2, 0x19, 0x2c, 0x0b, 0x78, 0xe1, 0x83, 0x0b, 0x78, 0xd0, 0xca, 0x56,
+    0xca, 0x0b, 0x7a, 0x80, 0xc2, 0x00, 0xd0, 0x0b, 0x79, 0x69, 0x83, 0x0b,
+    0x79, 0x60, 0xc2, 0x00, 0xd0, 0x0b, 0x79, 0x21, 0x83, 0x0b, 0x79, 0x18,
+    0xc2, 0x00, 0xd0, 0x0b, 0x78, 0xa9, 0x83, 0x0b, 0x78, 0xa0, 0xc2, 0x16,
+    0x5a, 0x0b, 0x7a, 0x39, 0x83, 0x0b, 0x79, 0xc1, 0xc2, 0x00, 0xd0, 0x0b,
+    0x79, 0x79, 0xc2, 0x02, 0x1c, 0x0b, 0x79, 0x58, 0xc2, 0x19, 0x2c, 0x0b,
+    0x78, 0xe9, 0x83, 0x0b, 0x78, 0xd8, 0xc3, 0x90, 0x65, 0x0b, 0x79, 0xf9,
+    0x10, 0xc2, 0x6d, 0x7b, 0xc2, 0x01, 0xc3, 0x0b, 0x78, 0x30, 0x15, 0xc2,
+    0x6d, 0x85, 0xc2, 0x19, 0x2c, 0x0b, 0x7a, 0x01, 0x83, 0x0b, 0x79, 0xe8,
+    0x83, 0x0b, 0x79, 0xe1, 0xc2, 0x00, 0xd0, 0x0b, 0x79, 0xb0, 0x15, 0xc2,
+    0x6d, 0x8f, 0x83, 0x0b, 0x78, 0x69, 0xc2, 0x01, 0x6f, 0x0b, 0x78, 0x60,
+    0xc2, 0x00, 0xd0, 0x0b, 0x79, 0x49, 0x83, 0x0b, 0x79, 0x40, 0xc2, 0x19,
+    0x2c, 0x0b, 0x78, 0xc9, 0x83, 0x0b, 0x78, 0xc0, 0x90, 0x0b, 0x7b, 0x62,
+    0x02, 0x6d, 0x99, 0xc2, 0x00, 0x75, 0x0b, 0x7c, 0x30, 0x90, 0x0b, 0x7b,
+    0x1a, 0x02, 0x6d, 0x9d, 0x94, 0x0b, 0x7b, 0xa8, 0x89, 0x0b, 0x7a, 0xf8,
+    0x94, 0x0b, 0x7c, 0x11, 0x9b, 0x0b, 0x7b, 0x00, 0x87, 0x0b, 0x7b, 0xa0,
+    0x89, 0x0b, 0x7a, 0xc0, 0x00, 0x42, 0x6d, 0xa1, 0xcd, 0x0e, 0x61, 0x0f,
+    0xbe, 0x19, 0xca, 0x22, 0x51, 0x0f, 0xbe, 0x08, 0xc6, 0x0b, 0x09, 0x0f,
+    0xbc, 0x79, 0xc6, 0x02, 0xd1, 0x01, 0x35, 0x50, 0xd0, 0x5c, 0x62, 0x0f,
+    0xbc, 0x29, 0xcb, 0x85, 0x72, 0x01, 0x35, 0x58, 0x00, 0xc2, 0x6d, 0xad,
+    0xe0, 0x0b, 0x87, 0x01, 0x3b, 0x68, 0x00, 0xc2, 0x6d, 0xb9, 0xe0, 0x0b,
+    0x87, 0x01, 0x3b, 0x60, 0x49, 0x35, 0x21, 0xc2, 0x6d, 0xc5, 0xd3, 0x3c,
+    0xb5, 0x0f, 0xbd, 0x81, 0x4c, 0x0e, 0x55, 0x42, 0x6d, 0xd1, 0xd1, 0x52,
+    0x11, 0x01, 0x35, 0x61, 0xc4, 0x01, 0xe3, 0x01, 0x2c, 0x91, 0xc6, 0x13,
+    0x52, 0x0f, 0xbd, 0x51, 0x43, 0x4d, 0x57, 0x42, 0x6d, 0xdd, 0xcf, 0x15,
+    0x36, 0x0f, 0xbd, 0xe1, 0xd2, 0x22, 0x49, 0x0f, 0xbe, 0x70, 0x9b, 0x0b,
+    0x73, 0xfb, 0x02, 0x6d, 0xe9, 0x83, 0x0b, 0x73, 0x6b, 0x02, 0x6d, 0xed,
+    0x91, 0x0b, 0x73, 0xeb, 0x02, 0x6d, 0xf7, 0x94, 0x0b, 0x73, 0xe1, 0x90,
+    0x0b, 0x73, 0xdb, 0x02, 0x6d, 0xfb, 0x86, 0x0b, 0x73, 0xc9, 0x9a, 0x0b,
+    0x73, 0xc1, 0x8a, 0x0b, 0x73, 0xb3, 0x02, 0x6e, 0x03, 0x93, 0x0b, 0x73,
+    0xa9, 0x8e, 0x0b, 0x73, 0xa1, 0x97, 0x0b, 0x73, 0x91, 0x85, 0x0b, 0x73,
+    0x89, 0x84, 0x0b, 0x73, 0x81, 0x87, 0x0b, 0x73, 0x79, 0x8c, 0x0b, 0x73,
+    0x71, 0x8d, 0x0b, 0x73, 0x63, 0x02, 0x6e, 0x07, 0x8b, 0x0b, 0x73, 0x59,
+    0x88, 0x0b, 0x73, 0x51, 0x89, 0x0b, 0x73, 0x49, 0x96, 0x0b, 0x73, 0x41,
+    0x92, 0x0b, 0x73, 0x39, 0x9c, 0x0b, 0x73, 0x29, 0x99, 0x0b, 0x73, 0x19,
+    0x98, 0x0b, 0x73, 0x11, 0x95, 0x0b, 0x73, 0x09, 0x8f, 0x0b, 0x73, 0x00,
+    0x9b, 0x0b, 0x72, 0xfb, 0x02, 0x6e, 0x0b, 0x83, 0x0b, 0x72, 0x6b, 0x02,
+    0x6e, 0x0f, 0x91, 0x0b, 0x72, 0xeb, 0x02, 0x6e, 0x19, 0x94, 0x0b, 0x72,
+    0xe1, 0x90, 0x0b, 0x72, 0xdb, 0x02, 0x6e, 0x1d, 0x86, 0x0b, 0x72, 0xc9,
+    0x9a, 0x0b, 0x72, 0xc1, 0x8a, 0x0b, 0x72, 0xb3, 0x02, 0x6e, 0x25, 0x93,
+    0x0b, 0x72, 0xa9, 0x8e, 0x0b, 0x72, 0xa1, 0x97, 0x0b, 0x72, 0x91, 0x85,
+    0x0b, 0x72, 0x89, 0x84, 0x0b, 0x72, 0x81, 0x87, 0x0b, 0x72, 0x79, 0x8c,
+    0x0b, 0x72, 0x71, 0x8d, 0x0b, 0x72, 0x63, 0x02, 0x6e, 0x29, 0x8b, 0x0b,
+    0x72, 0x59, 0x88, 0x0b, 0x72, 0x51, 0x89, 0x0b, 0x72, 0x49, 0x96, 0x0b,
+    0x72, 0x41, 0x92, 0x0b, 0x72, 0x39, 0x9c, 0x0b, 0x72, 0x29, 0x99, 0x0b,
+    0x72, 0x19, 0x98, 0x0b, 0x72, 0x11, 0x95, 0x0b, 0x72, 0x09, 0x8f, 0x0b,
+    0x72, 0x00, 0xc4, 0x02, 0xde, 0x0b, 0x74, 0x1b, 0x02, 0x6e, 0x2d, 0xc2,
+    0x02, 0xa0, 0x0b, 0x74, 0x12, 0x02, 0x6e, 0x33, 0xcf, 0x6b, 0x25, 0x0b,
+    0x74, 0xa0, 0xc4, 0x18, 0x10, 0x0b, 0x74, 0x39, 0xc2, 0x22, 0xcc, 0x0b,
+    0x74, 0x30, 0xc3, 0x0d, 0x14, 0x0b, 0x74, 0x29, 0xc3, 0x09, 0x9e, 0x0b,
+    0x74, 0x20, 0xc7, 0x1f, 0x6e, 0x0b, 0x74, 0x91, 0xc5, 0x66, 0xb1, 0x0b,
+    0x74, 0x58, 0xc8, 0x48, 0x23, 0x0b, 0x74, 0x89, 0xc6, 0x44, 0x9c, 0x0b,
+    0x74, 0x80, 0xc6, 0x14, 0x07, 0x0b, 0x74, 0x79, 0xc7, 0x34, 0x37, 0x0b,
+    0x74, 0x70, 0xc7, 0x52, 0xcc, 0x0b, 0x74, 0x69, 0xc5, 0x22, 0x43, 0x0b,
+    0x74, 0x61, 0xc2, 0x00, 0xc4, 0x0b, 0x74, 0x50, 0xc6, 0x06, 0xaf, 0x01,
+    0x1e, 0xb1, 0xc9, 0x67, 0xa7, 0x01, 0x1e, 0xa8, 0x24, 0xc2, 0x6e, 0x39,
+    0x25, 0xc2, 0x6e, 0x75, 0x1f, 0xc2, 0x6e, 0xb1, 0x1e, 0xc2, 0x6e, 0xed,
+    0x26, 0xc2, 0x6f, 0x29, 0x22, 0xc2, 0x6f, 0x65, 0x1d, 0xc2, 0x6f, 0xa1,
+    0x21, 0xc2, 0x6f, 0xd7, 0x23, 0xc2, 0x70, 0x13, 0x20, 0x42, 0x70, 0x4f,
+    0x26, 0xc2, 0x70, 0x8b, 0x20, 0xc2, 0x70, 0xbb, 0x1e, 0xc2, 0x70, 0xf7,
+    0x23, 0xc2, 0x71, 0x33, 0x24, 0xc2, 0x71, 0x6f, 0x21, 0xc2, 0x71, 0xab,
+    0x1d, 0xc2, 0x71, 0xe7, 0x22, 0xc2, 0x72, 0x23, 0x25, 0xc2, 0x72, 0x5f,
+    0x1f, 0x42, 0x72, 0x9b, 0xc2, 0x02, 0xa0, 0x0f, 0x46, 0x41, 0xc4, 0x02,
+    0xde, 0x0f, 0x46, 0x48, 0xc3, 0x09, 0x9e, 0x0f, 0x46, 0x51, 0xc3, 0x0d,
+    0x14, 0x0f, 0x46, 0x58, 0xc2, 0x22, 0xcc, 0x0f, 0x46, 0x61, 0xc4, 0x18,
+    0x10, 0x0f, 0x46, 0x68, 0x07, 0xc2, 0x72, 0xd7, 0xc8, 0x4b, 0x95, 0x0f,
+    0x46, 0x98, 0x95, 0x0f, 0x46, 0x91, 0xca, 0xa2, 0x92, 0x0f, 0x46, 0xa8,
+    0x16, 0xc2, 0x72, 0xe1, 0xcd, 0x76, 0xf8, 0x08, 0x4f, 0xf1, 0x07, 0xc2,
+    0x72, 0xf3, 0x15, 0xc2, 0x72, 0xff, 0x08, 0xc2, 0x73, 0x0b, 0x44, 0x05,
+    0x14, 0x42, 0x73, 0x17, 0xc4, 0x26, 0x78, 0x08, 0x4e, 0x43, 0x02, 0x73,
+    0x23, 0xc5, 0x06, 0xdb, 0x08, 0x4e, 0x3b, 0x02, 0x73, 0x2d, 0x15, 0xc2,
+    0x73, 0x37, 0x08, 0xc2, 0x73, 0x49, 0x16, 0xc2, 0x73, 0x51, 0xc3, 0x05,
+    0x14, 0x08, 0x4e, 0x02, 0x02, 0x73, 0x62, 0x48, 0x3f, 0x14, 0xc2, 0x73,
+    0x66, 0x46, 0x02, 0x0f, 0x42, 0x73, 0x72, 0xc2, 0xe5, 0xfd, 0x08, 0x4c,
+    0xf8, 0xc2, 0x0e, 0x9a, 0x08, 0x4c, 0xe9, 0x16, 0xc2, 0x73, 0xd1, 0xc2,
+    0x0f, 0x9a, 0x08, 0x4c, 0xb9, 0x0d, 0xc2, 0x73, 0xe3, 0x15, 0xc2, 0x73,
+    0xed, 0xc3, 0xe6, 0x71, 0x08, 0x4c, 0x91, 0x83, 0x08, 0x4c, 0x01, 0x87,
+    0x08, 0x4c, 0x09, 0x8b, 0x08, 0x4c, 0x11, 0x91, 0x08, 0x4c, 0x19, 0xc2,
+    0x19, 0x2c, 0x08, 0x4c, 0x21, 0xc2, 0x01, 0x4a, 0x08, 0x4c, 0x29, 0xc2,
+    0x01, 0x5d, 0x08, 0x4c, 0x33, 0x02, 0x73, 0xf8, 0xc2, 0x00, 0xb0, 0x08,
+    0x4c, 0x41, 0xc2, 0x01, 0xc3, 0x08, 0x4c, 0x49, 0x10, 0xc2, 0x73, 0xfe,
+    0xc2, 0x00, 0x39, 0x08, 0x4c, 0x73, 0x02, 0x74, 0x0c, 0xc2, 0x00, 0xdb,
+    0x08, 0x4c, 0x80, 0x47, 0x22, 0x04, 0xc2, 0x74, 0x12, 0xcc, 0x8b, 0x4d,
+    0x01, 0x4c, 0xd8, 0xc3, 0x7f, 0x18, 0x05, 0x5f, 0x29, 0x03, 0xc2, 0x74,
+    0x18, 0x97, 0x05, 0x57, 0x70, 0xc3, 0x7f, 0x18, 0x05, 0x5f, 0x21, 0x8b,
+    0x05, 0x57, 0x58, 0x97, 0x05, 0x57, 0x61, 0xc3, 0x7f, 0x18, 0x05, 0x5f,
+    0x40, 0xc7, 0xc9, 0xe3, 0x05, 0x5f, 0x10, 0xc3, 0x71, 0x83, 0x05, 0x5e,
+    0x4b, 0x02, 0x74, 0x20, 0x83, 0x05, 0x5e, 0x2b, 0x02, 0x74, 0x26, 0xc2,
+    0x00, 0xc1, 0x05, 0x57, 0x41, 0xc2, 0x19, 0x2c, 0x05, 0x57, 0x18, 0xc2,
+    0x00, 0x71, 0x05, 0x5e, 0x3b, 0x02, 0x74, 0x2c, 0x16, 0xc2, 0x74, 0x32,
+    0xc3, 0x18, 0xb0, 0x05, 0x5e, 0x50, 0x83, 0x05, 0x5e, 0x23, 0x02, 0x74,
+    0x3c, 0xc3, 0x08, 0x09, 0x05, 0x5e, 0x80, 0xc2, 0x01, 0x25, 0x05, 0x5e,
+    0x03, 0x02, 0x74, 0x42, 0xc3, 0x18, 0xb0, 0x05, 0x5e, 0x40, 0xc3, 0x08,
+    0x09, 0x05, 0x5e, 0xd1, 0x83, 0x05, 0x5e, 0xa8, 0xc3, 0x18, 0xb0, 0x05,
+    0x5e, 0xc9, 0x06, 0xc2, 0x74, 0x48, 0xc2, 0x00, 0x71, 0x05, 0x5e, 0xb8,
+    0xc3, 0x18, 0xb0, 0x05, 0x5e, 0xc1, 0xc2, 0x01, 0x25, 0x05, 0x5e, 0x90,
+    0xc2, 0x0d, 0xf6, 0x05, 0x57, 0x51, 0xc2, 0x00, 0xd0, 0x05, 0x57, 0x49,
+    0xc2, 0x00, 0xc2, 0x05, 0x5e, 0x08, 0x83, 0x05, 0x57, 0x11, 0xc2, 0x00,
+    0x71, 0x05, 0x5e, 0x30, 0xc7, 0xc9, 0xe3, 0x05, 0x5e, 0xe8, 0xc7, 0xc9,
+    0xe3, 0x05, 0x5e, 0xe0, 0xc3, 0x08, 0x09, 0x05, 0x5e, 0x99, 0xc2, 0x00,
+    0x71, 0x05, 0x5e, 0xb0, 0xc9, 0xb1, 0xc1, 0x0f, 0xb5, 0xa9, 0xc7, 0x61,
+    0x82, 0x0f, 0xb4, 0xf1, 0xc8, 0xb7, 0xaa, 0x0f, 0xb5, 0x00, 0xc2, 0x00,
+    0x74, 0x01, 0x34, 0x59, 0xc3, 0x01, 0x95, 0x01, 0x34, 0x50, 0xe0, 0x01,
+    0x27, 0x08, 0xb3, 0x60, 0x46, 0x00, 0x8b, 0x42, 0x74, 0x52, 0xcf, 0x01,
+    0x38, 0x08, 0xb3, 0x31, 0xc8, 0x00, 0xbf, 0x08, 0xb3, 0x28, 0xcf, 0x01,
+    0x38, 0x08, 0xb3, 0x21, 0xc8, 0x00, 0xbf, 0x08, 0xb3, 0x00, 0xc4, 0x26,
+    0x78, 0x00, 0xc0, 0xc9, 0xc5, 0x06, 0xdb, 0x00, 0xc0, 0xc1, 0x15, 0xc2,
+    0x74, 0x5e, 0x08, 0xc2, 0x74, 0x6a, 0x16, 0xc2, 0x74, 0x76, 0xc3, 0x05,
+    0x14, 0x00, 0xc0, 0x89, 0xc4, 0x15, 0xe7, 0x00, 0xc0, 0x80, 0x45, 0xc2,
+    0x59, 0x42, 0x74, 0x82, 0x48, 0xb1, 0x71, 0xc2, 0x74, 0xa4, 0xc2, 0x00,
+    0x75, 0x00, 0xc1, 0x48, 0x44, 0x62, 0x5b, 0xc2, 0x74, 0xf0, 0xc2, 0x0d,
+    0xf6, 0x00, 0xc1, 0xe1, 0x83, 0x00, 0xc1, 0x90, 0x83, 0x00, 0xc1, 0xa3,
+    0x02, 0x75, 0x61, 0x8b, 0x00, 0xc2, 0x10, 0x44, 0x14, 0x85, 0xc2, 0x75,
+    0x67, 0xc2, 0x00, 0xd0, 0x00, 0xc1, 0x89, 0x83, 0x00, 0xc1, 0x80, 0xc2,
+    0x00, 0x0a, 0x00, 0xc2, 0x09, 0xc2, 0x00, 0x39, 0x00, 0xc1, 0xf9, 0x83,
+    0x00, 0xc1, 0xe8, 0xc2, 0x00, 0xd0, 0x00, 0xc2, 0x01, 0x83, 0x00, 0xc1,
+    0x78, 0xc2, 0x00, 0xd0, 0x00, 0xc1, 0xd9, 0x83, 0x00, 0xc1, 0xd0, 0x87,
+    0x00, 0xc1, 0x38, 0x87, 0x00, 0xc1, 0x30, 0x87, 0x00, 0xc1, 0x28, 0xc4,
+    0x09, 0x9d, 0x00, 0xc0, 0x79, 0x16, 0xc2, 0x75, 0xc9, 0xc3, 0x05, 0x14,
+    0x00, 0xc0, 0x58, 0x45, 0x09, 0x98, 0xc2, 0x75, 0xd5, 0xcb, 0x97, 0xf5,
+    0x08, 0xb2, 0x11, 0xc4, 0x19, 0x53, 0x08, 0xb2, 0x08, 0xc4, 0xe3, 0x83,
+    0x08, 0xb2, 0x21, 0x03, 0xc2, 0x75, 0xf9, 0x42, 0x07, 0xb2, 0x42, 0x76,
+    0x05, 0x03, 0xc2, 0x76, 0x11, 0x91, 0x08, 0xb1, 0xd9, 0x87, 0x08, 0xb1,
+    0xc9, 0x48, 0xb2, 0x2d, 0xc2, 0x76, 0x1d, 0x97, 0x08, 0xb1, 0x9b, 0x02,
+    0x76, 0x2b, 0x8b, 0x08, 0xb1, 0x8a, 0x02, 0x76, 0x2f, 0x0e, 0xc2, 0x76,
+    0x33, 0xc2, 0x00, 0xd0, 0x08, 0xb1, 0x71, 0x15, 0xc2, 0x76, 0x3d, 0x18,
+    0xc2, 0x76, 0x4d, 0xc2, 0x00, 0x39, 0x08, 0xb1, 0x41, 0xc2, 0x19, 0x2c,
+    0x08, 0xb1, 0x39, 0xc2, 0x01, 0xc3, 0x08, 0xb1, 0x31, 0x04, 0xc2, 0x76,
+    0x57, 0x12, 0xc2, 0x76, 0x61, 0x10, 0xc2, 0x76, 0x6b, 0x06, 0xc2, 0x76,
+    0x81, 0x16, 0xc2, 0x76, 0x8f, 0x0c, 0xc2, 0x76, 0x9d, 0x05, 0xc2, 0x76,
+    0xa7, 0x09, 0xc2, 0x76, 0xb1, 0x0d, 0xc2, 0x76, 0xbb, 0x83, 0x08, 0xb0,
+    0x03, 0x02, 0x76, 0xc5, 0x91, 0x08, 0xb0, 0x61, 0x87, 0x08, 0xb0, 0x51,
+    0x97, 0x08, 0xb0, 0x23, 0x02, 0x76, 0xd1, 0x8b, 0x08, 0xb0, 0x12, 0x02,
+    0x76, 0xd5, 0x15, 0xc2, 0x76, 0xd9, 0x05, 0xc2, 0x76, 0xef, 0x14, 0xc2,
+    0x77, 0x19, 0x0e, 0xc2, 0x77, 0x2f, 0x09, 0xc2, 0x77, 0x41, 0x04, 0xc2,
+    0x77, 0x56, 0x06, 0xc2, 0x77, 0x62, 0x03, 0xc2, 0x77, 0x6c, 0x12, 0xc2,
+    0x77, 0x7e, 0x16, 0xc2, 0x77, 0x8a, 0x17, 0xc2, 0x77, 0x96, 0x18, 0xc2,
+    0x77, 0xa6, 0x0f, 0xc2, 0x77, 0xb2, 0x07, 0xc2, 0x77, 0xbc, 0x0a, 0xc2,
+    0x77, 0xc8, 0x1b, 0xc2, 0x77, 0xd4, 0xca, 0x9c, 0xf2, 0x00, 0x17, 0xf0,
+    0x89, 0x0e, 0xa1, 0xd3, 0x02, 0x77, 0xe0, 0x88, 0x0e, 0xa1, 0xc9, 0x87,
+    0x0e, 0xa1, 0xc3, 0x02, 0x77, 0xe6, 0x86, 0x0e, 0xa1, 0xbb, 0x02, 0x77,
+    0xf2, 0x85, 0x0e, 0xa1, 0xb3, 0x02, 0x77, 0xf8, 0x84, 0x0e, 0xa1, 0xab,
+    0x02, 0x77, 0xfe, 0x83, 0x0e, 0xa1, 0xa3, 0x02, 0x78, 0x04, 0x91, 0x0e,
+    0xa2, 0x13, 0x02, 0x78, 0x0a, 0x92, 0x0e, 0xa2, 0x1b, 0x02, 0x78, 0x0e,
+    0x97, 0x0e, 0xa2, 0x43, 0x02, 0x78, 0x1e, 0x96, 0x0e, 0xa2, 0x3b, 0x02,
+    0x78, 0x24, 0x95, 0x0e, 0xa2, 0x33, 0x02, 0x78, 0x33, 0x94, 0x0e, 0xa2,
+    0x2b, 0x02, 0x78, 0x39, 0x9a, 0x0e, 0xa2, 0x5b, 0x02, 0x78, 0x3f, 0x90,
+    0x0e, 0xa2, 0x0b, 0x02, 0x78, 0x43, 0x8f, 0x0e, 0xa2, 0x03, 0x02, 0x78,
+    0x47, 0x8e, 0x0e, 0xa1, 0xfb, 0x02, 0x78, 0x4b, 0x8d, 0x0e, 0xa1, 0xf3,
+    0x02, 0x78, 0x51, 0x8b, 0x0e, 0xa1, 0xe3, 0x02, 0x78, 0x57, 0x9c, 0x0e,
+    0xa2, 0x6b, 0x02, 0x78, 0x5d, 0x9b, 0x0e, 0xa2, 0x61, 0x99, 0x0e, 0xa2,
+    0x51, 0x98, 0x0e, 0xa2, 0x49, 0x93, 0x0e, 0xa2, 0x21, 0x8c, 0x0e, 0xa1,
+    0xe9, 0x8a, 0x0e, 0xa1, 0xd8, 0xc8, 0x9c, 0x0e, 0x0e, 0xb8, 0xd9, 0xc9,
+    0xaa, 0x9e, 0x0e, 0xb8, 0xc9, 0xd3, 0x43, 0x00, 0x0e, 0xb8, 0xa8, 0x91,
+    0x0e, 0xa2, 0xe3, 0x02, 0x78, 0x63, 0x92, 0x0e, 0xa2, 0xeb, 0x02, 0x78,
+    0x67, 0x85, 0x0e, 0xa2, 0x83, 0x02, 0x78, 0x77, 0x97, 0x0e, 0xa3, 0x13,
+    0x02, 0x78, 0x7d, 0x96, 0x0e, 0xa3, 0x0b, 0x02, 0x78, 0x83, 0x95, 0x0e,
+    0xa3, 0x03, 0x02, 0x78, 0x8f, 0x88, 0x0e, 0xa2, 0x9b, 0x02, 0x78, 0x95,
+    0x94, 0x0e, 0xa2, 0xfb, 0x02, 0x78, 0x9b, 0x9a, 0x0e, 0xa3, 0x2b, 0x02,
+    0x78, 0xa1, 0x90, 0x0e, 0xa2, 0xdb, 0x02, 0x78, 0xa5, 0x8f, 0x0e, 0xa2,
+    0xd3, 0x02, 0x78, 0xa9, 0x8e, 0x0e, 0xa2, 0xcb, 0x02, 0x78, 0xad, 0x8d,
+    0x0e, 0xa2, 0xc3, 0x02, 0x78, 0xb3, 0x8b, 0x0e, 0xa2, 0xb3, 0x02, 0x78,
+    0xb9, 0x87, 0x0e, 0xa2, 0x93, 0x02, 0x78, 0xbf, 0x9c, 0x0e, 0xa3, 0x3b,
+    0x02, 0x78, 0xcb, 0x86, 0x0e, 0xa2, 0x8b, 0x02, 0x78, 0xd1, 0x89, 0x0e,
+    0xa2, 0xa3, 0x02, 0x78, 0xdd, 0x84, 0x0e, 0xa2, 0x7b, 0x02, 0x78, 0xe3,
+    0x83, 0x0e, 0xa2, 0x73, 0x02, 0x78, 0xe9, 0x9b, 0x0e, 0xa3, 0x31, 0x99,
+    0x0e, 0xa3, 0x21, 0x98, 0x0e, 0xa3, 0x19, 0x93, 0x0e, 0xa2, 0xf1, 0x8c,
+    0x0e, 0xa2, 0xb8, 0x45, 0x03, 0x14, 0xc2, 0x78, 0xef, 0x46, 0x07, 0x2f,
+    0x42, 0x79, 0x93, 0xc4, 0x26, 0x78, 0x0e, 0xbe, 0xb9, 0xc5, 0x06, 0xdb,
+    0x0e, 0xbe, 0xb1, 0x15, 0xc2, 0x79, 0x9f, 0x08, 0xc2, 0x79, 0xab, 0x16,
+    0xc2, 0x79, 0xb7, 0xc3, 0x05, 0x14, 0x0e, 0xbe, 0x79, 0xc4, 0x15, 0xe7,
+    0x0e, 0xbe, 0x70, 0x86, 0x0e, 0xa0, 0x1b, 0x02, 0x79, 0xc3, 0x91, 0x0e,
+    0xa0, 0x73, 0x02, 0x79, 0xcf, 0x92, 0x0e, 0xa0, 0x7b, 0x02, 0x79, 0xd3,
+    0x85, 0x0e, 0xa0, 0x13, 0x02, 0x79, 0xe3, 0x97, 0x0e, 0xa0, 0xa3, 0x02,
+    0x79, 0xe9, 0x96, 0x0e, 0xa0, 0x9b, 0x02, 0x79, 0xef, 0x95, 0x0e, 0xa0,
+    0x93, 0x02, 0x79, 0xfe, 0x94, 0x0e, 0xa0, 0x8b, 0x02, 0x7a, 0x04, 0x9a,
+    0x0e, 0xa0, 0xbb, 0x02, 0x7a, 0x0a, 0x90, 0x0e, 0xa0, 0x6b, 0x02, 0x7a,
+    0x0e, 0x8f, 0x0e, 0xa0, 0x63, 0x02, 0x7a, 0x12, 0x8e, 0x0e, 0xa0, 0x5b,
+    0x02, 0x7a, 0x16, 0x8d, 0x0e, 0xa0, 0x53, 0x02, 0x7a, 0x1c, 0x8b, 0x0e,
+    0xa0, 0x43, 0x02, 0x7a, 0x22, 0x87, 0x0e, 0xa0, 0x23, 0x02, 0x7a, 0x28,
+    0x9c, 0x0e, 0xa0, 0xcb, 0x02, 0x7a, 0x34, 0x89, 0x0e, 0xa0, 0x33, 0x02,
+    0x7a, 0x3a, 0x84, 0x0e, 0xa0, 0x0b, 0x02, 0x7a, 0x40, 0x83, 0x0e, 0xa0,
+    0x03, 0x02, 0x7a, 0x46, 0x9b, 0x0e, 0xa0, 0xc1, 0x99, 0x0e, 0xa0, 0xb1,
+    0x98, 0x0e, 0xa0, 0xa9, 0x93, 0x0e, 0xa0, 0x81, 0x8c, 0x0e, 0xa0, 0x49,
+    0x8a, 0x0e, 0xa0, 0x39, 0x88, 0x0e, 0xa0, 0x28, 0x12, 0xc2, 0x7a, 0x4c,
+    0xca, 0x9c, 0xac, 0x0e, 0xba, 0xa1, 0xcc, 0x8b, 0x65, 0x0e, 0xba, 0x91,
+    0xcc, 0x89, 0xfd, 0x0e, 0xba, 0x89, 0xce, 0x10, 0x3e, 0x0e, 0xba, 0x81,
+    0x46, 0x03, 0x13, 0xc2, 0x7a, 0x5e, 0xc5, 0xdb, 0xf0, 0x0e, 0xb9, 0xa9,
+    0x48, 0x0b, 0x17, 0x42, 0x7b, 0x02, 0xc8, 0x9c, 0x0e, 0x0e, 0xb7, 0x09,
+    0xc9, 0xaa, 0x9e, 0x0e, 0xb6, 0xf9, 0xd3, 0x43, 0x00, 0x0e, 0xb6, 0xd8,
+    0x46, 0x03, 0x13, 0xc2, 0x7b, 0xa3, 0x48, 0x0b, 0x17, 0x42, 0x7c, 0x0b,
+    0xc4, 0x26, 0x78, 0x0e, 0xbf, 0xf9, 0xc5, 0x06, 0xdb, 0x0e, 0xbf, 0xf1,
+    0x15, 0xc2, 0x7c, 0x73, 0x08, 0xc2, 0x7c, 0x7f, 0x16, 0xc2, 0x7c, 0x8b,
+    0xc3, 0x05, 0x14, 0x0e, 0xbf, 0xb9, 0xc4, 0x15, 0xe7, 0x0e, 0xbf, 0xb0,
+    0x9c, 0x0e, 0xb5, 0x19, 0x9b, 0x0e, 0xb5, 0x11, 0x9a, 0x0e, 0xb5, 0x09,
+    0x99, 0x0e, 0xb5, 0x01, 0x98, 0x0e, 0xb4, 0xf9, 0x97, 0x0e, 0xb4, 0xf1,
+    0x96, 0x0e, 0xb4, 0xe9, 0x95, 0x0e, 0xb4, 0xe1, 0x94, 0x0e, 0xb4, 0xd9,
+    0x93, 0x0e, 0xb4, 0xd1, 0x92, 0x0e, 0xb4, 0xc9, 0x91, 0x0e, 0xb4, 0xc1,
+    0x90, 0x0e, 0xb4, 0xb9, 0x8f, 0x0e, 0xb4, 0xb1, 0x8e, 0x0e, 0xb4, 0xa9,
+    0x8d, 0x0e, 0xb4, 0xa1, 0x8c, 0x0e, 0xb4, 0x99, 0x8b, 0x0e, 0xb4, 0x91,
+    0x8a, 0x0e, 0xb4, 0x89, 0x89, 0x0e, 0xb4, 0x81, 0x88, 0x0e, 0xb4, 0x79,
+    0x87, 0x0e, 0xb4, 0x71, 0x86, 0x0e, 0xb4, 0x69, 0x85, 0x0e, 0xb4, 0x61,
+    0x84, 0x0e, 0xb4, 0x59, 0x83, 0x0e, 0xb4, 0x50, 0x9c, 0x0e, 0xb4, 0x49,
+    0x9b, 0x0e, 0xb4, 0x41, 0x9a, 0x0e, 0xb4, 0x39, 0x99, 0x0e, 0xb4, 0x31,
+    0x98, 0x0e, 0xb4, 0x29, 0x97, 0x0e, 0xb4, 0x21, 0x96, 0x0e, 0xb4, 0x19,
+    0x95, 0x0e, 0xb4, 0x11, 0x94, 0x0e, 0xb4, 0x09, 0x93, 0x0e, 0xb4, 0x01,
+    0x92, 0x0e, 0xb3, 0xf9, 0x91, 0x0e, 0xb3, 0xf1, 0x90, 0x0e, 0xb3, 0xe9,
+    0x8f, 0x0e, 0xb3, 0xe1, 0x8e, 0x0e, 0xb3, 0xd9, 0x8d, 0x0e, 0xb3, 0xd1,
+    0x8c, 0x0e, 0xb3, 0xc9, 0x8b, 0x0e, 0xb3, 0xc1, 0x8a, 0x0e, 0xb3, 0xb9,
+    0x89, 0x0e, 0xb3, 0xb1, 0x88, 0x0e, 0xb3, 0xa9, 0x87, 0x0e, 0xb3, 0xa1,
+    0x86, 0x0e, 0xb3, 0x99, 0x85, 0x0e, 0xb3, 0x91, 0x84, 0x0e, 0xb3, 0x89,
+    0x83, 0x0e, 0xb3, 0x80, 0x45, 0x58, 0xc2, 0xc2, 0x7c, 0x97, 0x46, 0x09,
+    0x97, 0xc2, 0x7c, 0xd1, 0x47, 0xc7, 0x4a, 0xc2, 0x7c, 0xf5, 0x46, 0x03,
+    0x13, 0xc2, 0x7d, 0x01, 0x48, 0x0b, 0x17, 0x42, 0x7d, 0x69, 0x46, 0x03,
+    0x13, 0xc2, 0x7d, 0xd1, 0x48, 0x0b, 0x17, 0x42, 0x7e, 0x2d, 0xc4, 0x26,
+    0x78, 0x0e, 0xbf, 0x09, 0xc5, 0x06, 0xdb, 0x0e, 0xbf, 0x01, 0x15, 0xc2,
+    0x7e, 0x75, 0x08, 0xc2, 0x7e, 0x81, 0x16, 0xc2, 0x7e, 0x8d, 0xc3, 0x05,
+    0x14, 0x0e, 0xbe, 0xc9, 0xc4, 0x15, 0xe7, 0x0e, 0xbe, 0xc0, 0x9c, 0x0e,
+    0xab, 0x59, 0x9b, 0x0e, 0xab, 0x51, 0x9a, 0x0e, 0xab, 0x49, 0x99, 0x0e,
+    0xab, 0x41, 0x98, 0x0e, 0xab, 0x39, 0x97, 0x0e, 0xab, 0x31, 0x96, 0x0e,
+    0xab, 0x29, 0x95, 0x0e, 0xab, 0x21, 0x94, 0x0e, 0xab, 0x19, 0x93, 0x0e,
+    0xab, 0x11, 0x92, 0x0e, 0xab, 0x09, 0x91, 0x0e, 0xab, 0x01, 0x90, 0x0e,
+    0xaa, 0xf9, 0x8f, 0x0e, 0xaa, 0xf1, 0x8e, 0x0e, 0xaa, 0xe9, 0x8d, 0x0e,
+    0xaa, 0xe1, 0x8c, 0x0e, 0xaa, 0xd9, 0x8b, 0x0e, 0xaa, 0xd1, 0x8a, 0x0e,
+    0xaa, 0xc9, 0x89, 0x0e, 0xaa, 0xc1, 0x88, 0x0e, 0xaa, 0xb9, 0x87, 0x0e,
+    0xaa, 0xb1, 0x86, 0x0e, 0xaa, 0xa9, 0x85, 0x0e, 0xaa, 0xa1, 0x84, 0x0e,
+    0xaa, 0x99, 0x83, 0x0e, 0xaa, 0x90, 0x9b, 0x0e, 0xaa, 0x81, 0x9a, 0x0e,
+    0xaa, 0x79, 0x99, 0x0e, 0xaa, 0x71, 0x98, 0x0e, 0xaa, 0x69, 0x97, 0x0e,
+    0xaa, 0x61, 0x96, 0x0e, 0xaa, 0x59, 0x95, 0x0e, 0xaa, 0x51, 0x91, 0x0e,
+    0xaa, 0x31, 0x8f, 0x0e, 0xaa, 0x21, 0x8e, 0x0e, 0xaa, 0x19, 0x8d, 0x0e,
+    0xaa, 0x11, 0x8c, 0x0e, 0xaa, 0x09, 0x8b, 0x0e, 0xaa, 0x01, 0x89, 0x0e,
+    0xa9, 0xf1, 0x88, 0x0e, 0xa9, 0xe9, 0x87, 0x0e, 0xa9, 0xe1, 0x86, 0x0e,
+    0xa9, 0xd9, 0x84, 0x0e, 0xa9, 0xc9, 0x83, 0x0e, 0xa9, 0xc0, 0x46, 0x03,
+    0x13, 0xc2, 0x7e, 0x99, 0x48, 0x0b, 0x17, 0x42, 0x7f, 0x01, 0xd5, 0x35,
+    0x36, 0x01, 0x3f, 0x79, 0x46, 0x01, 0xfc, 0xc2, 0x7f, 0x55, 0xd4, 0x38,
+    0xf4, 0x01, 0x3f, 0x59, 0xcd, 0x0b, 0x91, 0x01, 0x3f, 0x48, 0xd6, 0x08,
+    0x88, 0x01, 0x3f, 0x61, 0xce, 0x25, 0xad, 0x01, 0x3f, 0x30, 0xc4, 0x18,
+    0x10, 0x08, 0xea, 0xb9, 0xc2, 0x22, 0xcc, 0x08, 0xea, 0xb0, 0xc3, 0x0d,
+    0x14, 0x08, 0xea, 0xa9, 0xc3, 0x09, 0x9e, 0x08, 0xea, 0xa0, 0xc4, 0x02,
+    0xde, 0x08, 0xea, 0x99, 0xc2, 0x02, 0xa0, 0x08, 0xea, 0x90, 0x03, 0xc2,
+    0x7f, 0x61, 0x91, 0x08, 0xe9, 0xe9, 0x87, 0x08, 0xe9, 0xd1, 0xc9, 0xb2,
+    0x2d, 0x08, 0xe9, 0xb1, 0x97, 0x08, 0xe9, 0xa3, 0x02, 0x7f, 0x6d, 0x8b,
+    0x08, 0xe9, 0x92, 0x02, 0x7f, 0x71, 0xc2, 0x00, 0x39, 0x08, 0xe9, 0x81,
+    0xc2, 0x00, 0xd0, 0x08, 0xe8, 0xe1, 0x83, 0x08, 0xe8, 0xd9, 0x16, 0x42,
+    0x7f, 0x75, 0xc3, 0x2d, 0xfd, 0x08, 0xe9, 0x79, 0xc2, 0x00, 0xd0, 0x08,
+    0xe8, 0xa1, 0x83, 0x08, 0xe8, 0x98, 0xc3, 0x1d, 0x35, 0x08, 0xe9, 0x71,
+    0xc2, 0x00, 0xd0, 0x08, 0xe8, 0x69, 0x83, 0x08, 0xe8, 0x60, 0xc2, 0x00,
+    0xdb, 0x08, 0xe9, 0x69, 0x83, 0x08, 0xe9, 0x38, 0x83, 0x08, 0xe9, 0x59,
+    0xc2, 0x0d, 0xf6, 0x08, 0xe9, 0x51, 0xc2, 0x00, 0xd0, 0x08, 0xe9, 0x48,
+    0xc2, 0x00, 0xd0, 0x08, 0xe9, 0x19, 0x83, 0x08, 0xe9, 0x10, 0xc2, 0x00,
+    0xd0, 0x08, 0xe9, 0x09, 0x83, 0x08, 0xe9, 0x00, 0x83, 0x08, 0xe8, 0xf9,
+    0xc2, 0x00, 0xc1, 0x08, 0xe8, 0xd1, 0xc2, 0x19, 0x2c, 0x08, 0xe8, 0xa9,
+    0xc2, 0x01, 0x30, 0x08, 0xe8, 0x80, 0xc2, 0x00, 0xd0, 0x08, 0xe8, 0xf1,
+    0x83, 0x08, 0xe8, 0xe9, 0x06, 0x42, 0x7f, 0x7f, 0xc2, 0x00, 0xd0, 0x08,
+    0xe8, 0x91, 0x83, 0x08, 0xe8, 0x88, 0xc2, 0x00, 0xd0, 0x08, 0xe8, 0x79,
+    0x83, 0x08, 0xe8, 0x70, 0x97, 0x08, 0xe8, 0x59, 0x8b, 0x08, 0xe8, 0x41,
+    0x83, 0x08, 0xe8, 0x08, 0x97, 0x08, 0xe8, 0x28, 0x8b, 0x08, 0xe8, 0x18,
+    0xcb, 0x1e, 0x89, 0x08, 0xe5, 0xb1, 0xc8, 0x14, 0x38, 0x08, 0xe5, 0xa8,
+    0x83, 0x08, 0xe5, 0x79, 0xc2, 0x00, 0xd0, 0x08, 0xe5, 0x71, 0x15, 0xc2,
+    0x7f, 0x89, 0xc2, 0x00, 0xdb, 0x08, 0xe5, 0x59, 0xc2, 0x00, 0x39, 0x08,
+    0xe5, 0x51, 0xc2, 0x19, 0x2c, 0x08, 0xe5, 0x49, 0x1c, 0xc2, 0x7f, 0x93,
+    0xc2, 0x01, 0x4a, 0x08, 0xe5, 0x29, 0x06, 0xc2, 0x7f, 0x9d, 0x16, 0xc2,
+    0x7f, 0xa7, 0xc2, 0x01, 0xc3, 0x08, 0xe5, 0x09, 0xc2, 0x01, 0x5d, 0x08,
+    0xe5, 0x01, 0x12, 0xc2, 0x7f, 0xb5, 0x10, 0xc2, 0x7f, 0xbf, 0xc2, 0x25,
+    0x3b, 0x08, 0xe4, 0xc1, 0x05, 0xc2, 0x7f, 0xcf, 0xc2, 0x01, 0x30, 0x08,
+    0xe4, 0xa1, 0x0d, 0x42, 0x7f, 0xd9, 0x83, 0x08, 0xe4, 0x69, 0xc2, 0x00,
+    0xd0, 0x08, 0xe4, 0x60, 0x83, 0x08, 0xe4, 0x39, 0xc2, 0x00, 0xd0, 0x08,
+    0xe4, 0x30, 0xc2, 0x02, 0x1c, 0x08, 0xe4, 0x21, 0x83, 0x08, 0xe3, 0xe0,
+    0x15, 0xc2, 0x7f, 0xe3, 0xc2, 0x00, 0xd0, 0x08, 0xe3, 0xd9, 0x83, 0x08,
+    0xe3, 0xd0, 0xc2, 0x00, 0xd0, 0x08, 0xe3, 0xf9, 0x83, 0x08, 0xe3, 0xf0,
+    0x83, 0x08, 0xe3, 0xe9, 0xc2, 0x19, 0x2c, 0x08, 0xe3, 0xc9, 0xc2, 0x01,
+    0x30, 0x08, 0xe3, 0xa8, 0xc2, 0x00, 0xd0, 0x08, 0xe3, 0xb9, 0x83, 0x08,
+    0xe3, 0xb0, 0xc2, 0x00, 0xd0, 0x08, 0xe3, 0x99, 0x83, 0x08, 0xe3, 0x90,
+    0xd7, 0x29, 0x29, 0x00, 0x68, 0x01, 0xca, 0x1e, 0x8a, 0x00, 0x68, 0x09,
+    0xce, 0x71, 0x5a, 0x00, 0x69, 0xe0, 0xc7, 0x14, 0x39, 0x00, 0x68, 0x11,
+    0xc7, 0x7a, 0x7f, 0x00, 0x69, 0xe8, 0x0b, 0xc2, 0x7f, 0xed, 0xd2, 0x48,
+    0xb3, 0x00, 0x69, 0xd8, 0xcd, 0x80, 0x36, 0x00, 0x68, 0x21, 0x47, 0xb2,
+    0x2e, 0xc2, 0x7f, 0xf9, 0x83, 0x00, 0x69, 0xa8, 0x83, 0x00, 0x68, 0x31,
+    0x8b, 0x00, 0x68, 0x81, 0x97, 0x00, 0x68, 0xa1, 0xc9, 0xa9, 0x90, 0x00,
+    0x6a, 0xf8, 0x8b, 0x00, 0x68, 0x40, 0x97, 0x00, 0x68, 0x50, 0x87, 0x00,
+    0x68, 0x78, 0x91, 0x00, 0x68, 0x98, 0x83, 0x00, 0x68, 0xa9, 0xc2, 0x00,
+    0xd0, 0x00, 0x68, 0xb0, 0x83, 0x00, 0x68, 0xb9, 0xc2, 0x00, 0xd0, 0x00,
+    0x68, 0xc0, 0xc2, 0x01, 0x30, 0x00, 0x68, 0xc9, 0xc2, 0x19, 0x2c, 0x00,
+    0x68, 0xf1, 0x10, 0xc2, 0x80, 0x07, 0x83, 0x00, 0x69, 0x40, 0x83, 0x00,
+    0x68, 0xd1, 0x0a, 0x42, 0x80, 0x11, 0x83, 0x00, 0x68, 0xe1, 0xc2, 0x00,
+    0xd0, 0x00, 0x68, 0xe8, 0x16, 0xc2, 0x80, 0x1b, 0x83, 0x00, 0x69, 0x21,
+    0xc2, 0x00, 0xd0, 0x00, 0x69, 0x28, 0x06, 0xc2, 0x80, 0x2b, 0x83, 0x00,
+    0x69, 0x31, 0xc2, 0x00, 0xd0, 0x00, 0x69, 0x39, 0xc7, 0xc7, 0x58, 0x00,
+    0x6a, 0x70, 0x83, 0x00, 0x69, 0x51, 0xc2, 0x00, 0xd0, 0x00, 0x69, 0x58,
+    0x83, 0x00, 0x69, 0x61, 0xc2, 0x00, 0xd0, 0x00, 0x69, 0x68, 0x83, 0x00,
+    0x69, 0x81, 0xc2, 0x00, 0x39, 0x00, 0x69, 0x88, 0x83, 0x00, 0x69, 0x91,
+    0x0e, 0x42, 0x80, 0x35, 0xc2, 0x00, 0xd0, 0x00, 0x69, 0xb1, 0xc2, 0x0d,
+    0xf6, 0x00, 0x69, 0xb9, 0x83, 0x00, 0x69, 0xc0, 0x83, 0x00, 0x69, 0xf1,
+    0x8b, 0x00, 0x6a, 0x41, 0x97, 0x00, 0x6a, 0x60, 0x8b, 0x00, 0x6a, 0x00,
+    0x97, 0x00, 0x6a, 0x10, 0x94, 0x00, 0x6a, 0x1b, 0x02, 0x80, 0x3f, 0x8e,
+    0x00, 0x6b, 0x12, 0x02, 0x80, 0x43, 0x87, 0x00, 0x6a, 0x38, 0x91, 0x00,
+    0x6a, 0x58, 0xd8, 0x22, 0xbb, 0x00, 0x6a, 0xc1, 0x08, 0xc2, 0x80, 0x47,
+    0x16, 0xc2, 0x80, 0x53, 0xc7, 0x08, 0x79, 0x00, 0x6b, 0x99, 0xc4, 0x01,
+    0xce, 0x00, 0x6b, 0xa1, 0xc9, 0x67, 0x38, 0x00, 0x6b, 0xb1, 0xc6, 0x06,
+    0xdb, 0x00, 0x6b, 0xb8, 0xca, 0xa3, 0xfa, 0x00, 0x6a, 0xd1, 0xca, 0x1e,
+    0x15, 0x00, 0x6a, 0xe9, 0xc8, 0x08, 0x79, 0x00, 0x6b, 0xa9, 0xca, 0xa7,
+    0x88, 0x00, 0x6b, 0xc0, 0xc4, 0x15, 0xe7, 0x00, 0x6b, 0x31, 0xc3, 0x05,
+    0x14, 0x00, 0x6b, 0x39, 0x16, 0xc2, 0x80, 0x5f, 0x08, 0xc2, 0x80, 0x6b,
+    0x15, 0xc2, 0x80, 0x77, 0xc5, 0x06, 0xdb, 0x00, 0x6b, 0x71, 0xc4, 0x26,
+    0x78, 0x00, 0x6b, 0x78, 0xc7, 0x0d, 0x04, 0x00, 0x6b, 0x89, 0xc8, 0x4b,
+    0x94, 0x00, 0x6b, 0x90, 0x96, 0x08, 0x57, 0xa3, 0x02, 0x80, 0x83, 0xd3,
+    0x44, 0x43, 0x08, 0x57, 0x90, 0xc8, 0x0d, 0x03, 0x08, 0x57, 0x78, 0xc5,
+    0x28, 0xee, 0x08, 0x57, 0x71, 0xc2, 0x00, 0xc4, 0x08, 0x57, 0x68, 0xc2,
+    0x39, 0x8b, 0x08, 0x57, 0x21, 0xc6, 0xd2, 0xc5, 0x08, 0x56, 0xa9, 0xc3,
+    0x1e, 0x1b, 0x08, 0x56, 0x70, 0xc4, 0x3e, 0x5a, 0x08, 0x57, 0x19, 0xc3,
+    0x11, 0xef, 0x08, 0x57, 0x11, 0x03, 0x42, 0x80, 0x89, 0xc4, 0xe0, 0x03,
+    0x08, 0x57, 0x01, 0xc3, 0x2d, 0x8a, 0x08, 0x56, 0xf0, 0xc3, 0x2d, 0x8a,
+    0x08, 0x56, 0xf9, 0xc3, 0x00, 0xb6, 0x08, 0x56, 0x88, 0xc4, 0x40, 0x95,
+    0x08, 0x56, 0xd1, 0xc3, 0x16, 0x5a, 0x08, 0x56, 0xc9, 0xc4, 0x36, 0xb5,
+    0x08, 0x56, 0x00, 0xc6, 0xd2, 0xc5, 0x08, 0x56, 0xa1, 0xc5, 0x40, 0x9b,
+    0x08, 0x56, 0x28, 0xc4, 0xdc, 0xe6, 0x08, 0x56, 0x91, 0xc3, 0x00, 0xb6,
+    0x08, 0x56, 0x80, 0xc2, 0x00, 0x8e, 0x08, 0x56, 0x68, 0xc5, 0xd6, 0x78,
+    0x08, 0x56, 0x61, 0xc4, 0x40, 0x95, 0x08, 0x56, 0x58, 0xc5, 0xd6, 0x78,
+    0x08, 0x56, 0x51, 0xc4, 0x40, 0x95, 0x08, 0x56, 0x48, 0xc5, 0xd5, 0xdd,
+    0x08, 0x56, 0x21, 0xc4, 0x9c, 0xa3, 0x08, 0x56, 0x18, 0xc4, 0x9b, 0x90,
+    0x08, 0x56, 0x11, 0xc3, 0x1e, 0x1b, 0x08, 0x56, 0x08, 0xc2, 0x00, 0x74,
+    0x00, 0x42, 0xc1, 0x96, 0x00, 0x42, 0xab, 0x02, 0x80, 0x95, 0x95, 0x00,
+    0x42, 0x73, 0x02, 0x80, 0x99, 0x94, 0x00, 0x42, 0x99, 0x93, 0x00, 0x42,
+    0x91, 0x92, 0x00, 0x42, 0x81, 0x90, 0x00, 0x42, 0x69, 0x8f, 0x00, 0x42,
+    0x61, 0x8e, 0x00, 0x42, 0x59, 0x8d, 0x00, 0x42, 0x53, 0x02, 0x80, 0xa1,
+    0x9c, 0x00, 0x42, 0x31, 0x8a, 0x00, 0x42, 0x21, 0x86, 0x00, 0x42, 0x19,
+    0x89, 0x00, 0x42, 0x11, 0x84, 0x00, 0x42, 0x08, 0x90, 0x00, 0x42, 0x79,
+    0x96, 0x00, 0x42, 0x38, 0x14, 0xc2, 0x80, 0xa7, 0xc2, 0x00, 0xd0, 0x08,
+    0x8b, 0x89, 0xc2, 0x0d, 0xf6, 0x08, 0x8b, 0x81, 0xc2, 0x02, 0x41, 0x08,
+    0x8b, 0x79, 0xc2, 0x00, 0xdb, 0x08, 0x8b, 0x71, 0xc2, 0x01, 0xc3, 0x08,
+    0x8b, 0x61, 0x04, 0xc2, 0x80, 0xb1, 0x12, 0xc2, 0x80, 0xbb, 0x10, 0xc2,
+    0x80, 0xc5, 0x06, 0xc2, 0x80, 0xd5, 0x16, 0xc2, 0x80, 0xe3, 0x0c, 0xc2,
+    0x80, 0xf1, 0x05, 0xc2, 0x80, 0xfb, 0x09, 0xc2, 0x81, 0x05, 0x0d, 0xc2,
+    0x81, 0x0f, 0x91, 0x08, 0x8a, 0xa1, 0x87, 0x08, 0x8a, 0x99, 0x97, 0x08,
+    0x8a, 0x91, 0x8b, 0x08, 0x8a, 0x89, 0x83, 0x08, 0x8a, 0x80, 0x05, 0xc2,
+    0x81, 0x19, 0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0xb8, 0x05, 0xc2, 0x81, 0x25,
+    0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0xa8, 0x05, 0xc2, 0x81, 0x31, 0xc7, 0xc0,
+    0xcf, 0x0f, 0x80, 0xb0, 0x05, 0xc2, 0x81, 0x3d, 0xc7, 0xc0, 0xcf, 0x0f,
+    0x80, 0xc0, 0x05, 0xc2, 0x81, 0x49, 0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0x80,
+    0x05, 0xc2, 0x81, 0x55, 0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0x88, 0x05, 0xc2,
+    0x81, 0x61, 0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0x90, 0x05, 0xc2, 0x81, 0x6d,
+    0xc7, 0xc0, 0xcf, 0x0f, 0x80, 0x98, 0x05, 0xc2, 0x81, 0x79, 0xc7, 0xc0,
+    0xcf, 0x0f, 0x80, 0xa0, 0x46, 0x10, 0x79, 0xc2, 0x81, 0x85, 0xc4, 0xe3,
+    0x7f, 0x0f, 0x9d, 0xe0, 0xcb, 0x8d, 0x0b, 0x0f, 0x9c, 0xc0, 0x9a, 0x01,
+    0x38, 0xa9, 0xc4, 0x00, 0xba, 0x00, 0x06, 0xba, 0x02, 0x81, 0xeb, 0xc5,
+    0x13, 0x84, 0x01, 0x14, 0x71, 0xce, 0x1f, 0x18, 0x01, 0x14, 0x68, 0xc2,
+    0x00, 0xd0, 0x08, 0x95, 0x41, 0xc2, 0x00, 0x39, 0x08, 0x95, 0x39, 0x83,
+    0x08, 0x95, 0x10, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0xf9, 0x83, 0x08, 0x94,
+    0xe8, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0xe1, 0x83, 0x08, 0x94, 0xd8, 0x83,
+    0x08, 0x94, 0xd1, 0xc2, 0x00, 0xc1, 0x08, 0x94, 0xa9, 0xc2, 0x19, 0x2c,
+    0x08, 0x94, 0x78, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0xc9, 0x83, 0x08, 0x94,
+    0xc1, 0x06, 0x42, 0x81, 0xef, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0xb9, 0x83,
+    0x08, 0x94, 0xb1, 0x16, 0x42, 0x81, 0xff, 0x83, 0x08, 0x94, 0x61, 0xc2,
+    0x25, 0x3b, 0x08, 0x94, 0x68, 0x83, 0x08, 0x94, 0x51, 0xc2, 0x00, 0xd0,
+    0x08, 0x94, 0x58, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0x41, 0x83, 0x08, 0x94,
+    0x30, 0xc2, 0x00, 0xd0, 0x08, 0x94, 0x29, 0x83, 0x08, 0x94, 0x20, 0xc3,
+    0x4d, 0x47, 0x05, 0x4f, 0x29, 0x45, 0x28, 0xb1, 0xc2, 0x82, 0x09, 0x48,
+    0xba, 0xb2, 0x42, 0x82, 0x19, 0xc3, 0x02, 0x9f, 0x05, 0x53, 0xc9, 0xc3,
+    0x05, 0x14, 0x05, 0x53, 0xc1, 0xcb, 0x0f, 0x09, 0x05, 0x53, 0xb8, 0x44,
+    0x3d, 0xbb, 0x42, 0x82, 0x25, 0x48, 0x68, 0x93, 0x42, 0x82, 0x69, 0x83,
+    0x00, 0x80, 0x59, 0xc2, 0x00, 0xd0, 0x00, 0x80, 0x60, 0x83, 0x00, 0x82,
+    0x83, 0x02, 0x82, 0x89, 0x4b, 0x91, 0x8e, 0x42, 0x82, 0x8f, 0xc2, 0x19,
+    0x2c, 0x00, 0x80, 0x51, 0x83, 0x00, 0x80, 0x78, 0x83, 0x00, 0x80, 0x69,
+    0xc2, 0x00, 0xd0, 0x00, 0x80, 0x70, 0x87, 0x00, 0x81, 0x41, 0xc3, 0x20,
+    0xf1, 0x00, 0x82, 0xd1, 0xc3, 0xe5, 0xf0, 0x00, 0x82, 0xd9, 0x42, 0x3f,
+    0x98, 0x42, 0x82, 0x9b, 0xc3, 0x00, 0xcf, 0x00, 0x83, 0x29, 0xc3, 0x09,
+    0x0e, 0x00, 0x83, 0x30, 0xc3, 0x3a, 0x09, 0x00, 0x83, 0x71, 0xc3, 0xdf,
+    0x5b, 0x00, 0x83, 0x79, 0xc4, 0xaa, 0x0d, 0x00, 0x83, 0x80, 0x94, 0x00,
+    0x82, 0x98, 0x8e, 0x00, 0x82, 0xa8, 0x8b, 0x00, 0x84, 0xe8, 0xc6, 0x00,
+    0xd3, 0x00, 0x84, 0x28, 0x45, 0x03, 0x14, 0xc2, 0x82, 0xa3, 0x83, 0x01,
+    0x85, 0xa9, 0x8b, 0x01, 0x85, 0xb9, 0x97, 0x01, 0x85, 0xc9, 0x87, 0x01,
+    0x85, 0xd9, 0x91, 0x01, 0x85, 0xe8, 0x47, 0x78, 0xc0, 0x42, 0x82, 0xe0,
+    0x8b, 0x01, 0x86, 0xfb, 0x02, 0x82, 0xee, 0x83, 0x01, 0x86, 0xf1, 0x97,
+    0x01, 0x87, 0x01, 0x87, 0x01, 0x87, 0x09, 0x91, 0x01, 0x87, 0x10, 0x83,
+    0x01, 0x85, 0x59, 0x8b, 0x01, 0x85, 0x69, 0x97, 0x01, 0x85, 0x79, 0x87,
+    0x01, 0x85, 0x89, 0x91, 0x01, 0x85, 0x98, 0x83, 0x01, 0x85, 0x61, 0x8b,
+    0x01, 0x85, 0x71, 0x97, 0x01, 0x85, 0x81, 0x87, 0x01, 0x85, 0x91, 0x91,
+    0x01, 0x85, 0xa0, 0x83, 0x01, 0x85, 0xb1, 0x8b, 0x01, 0x85, 0xc1, 0x97,
+    0x01, 0x85, 0xd1, 0x87, 0x01, 0x85, 0xe1, 0x91, 0x01, 0x85, 0xf0, 0x83,
+    0x01, 0x85, 0xf9, 0x8b, 0x01, 0x86, 0x09, 0x97, 0x01, 0x86, 0x21, 0x87,
+    0x01, 0x86, 0x31, 0x91, 0x01, 0x86, 0x40, 0x83, 0x01, 0x86, 0x01, 0x8b,
+    0x01, 0x86, 0x11, 0x97, 0x01, 0x86, 0x29, 0x87, 0x01, 0x86, 0x39, 0x91,
+    0x01, 0x86, 0x48, 0x83, 0x01, 0x86, 0x51, 0x8b, 0x01, 0x86, 0x59, 0x97,
+    0x01, 0x86, 0x61, 0x87, 0x01, 0x86, 0x69, 0x91, 0x01, 0x86, 0x70, 0x83,
+    0x01, 0x86, 0x79, 0x8b, 0x01, 0x86, 0x91, 0x97, 0x01, 0x86, 0xa9, 0x87,
+    0x01, 0x86, 0xc1, 0x91, 0x01, 0x86, 0xd8, 0x83, 0x01, 0x86, 0x81, 0x8b,
+    0x01, 0x86, 0x99, 0x97, 0x01, 0x86, 0xb1, 0x87, 0x01, 0x86, 0xc9, 0x91,
+    0x01, 0x86, 0xe0, 0x83, 0x01, 0x86, 0x89, 0x8b, 0x01, 0x86, 0xa1, 0x97,
+    0x01, 0x86, 0xb9, 0x87, 0x01, 0x86, 0xd1, 0x91, 0x01, 0x86, 0xe8, 0x83,
+    0x01, 0x87, 0x21, 0x97, 0x01, 0x87, 0x31, 0x91, 0x01, 0x87, 0x40, 0x83,
+    0x01, 0x87, 0x49, 0x8b, 0x01, 0x87, 0x51, 0x97, 0x01, 0x87, 0x59, 0x87,
+    0x01, 0x87, 0x61, 0x91, 0x01, 0x87, 0x68, 0x83, 0x01, 0x87, 0x79, 0x8b,
+    0x01, 0x87, 0x81, 0x87, 0x01, 0x87, 0x89, 0x91, 0x01, 0x87, 0x90, 0x97,
+    0x01, 0x87, 0xa1, 0x83, 0x01, 0x87, 0xb9, 0x8b, 0x01, 0x87, 0xc1, 0x87,
+    0x01, 0x87, 0xc9, 0x91, 0x01, 0x87, 0xd0, 0xc4, 0x1e, 0x97, 0x08, 0x85,
+    0xc9, 0xc5, 0x40, 0xe7, 0x08, 0x84, 0x10, 0xc2, 0x00, 0xd0, 0x08, 0x84,
+    0xd9, 0xc3, 0x40, 0xe2, 0x08, 0x84, 0xd1, 0x83, 0x08, 0x84, 0xc8, 0xc2,
+    0x00, 0xd0, 0x08, 0x84, 0xc1, 0x83, 0x08, 0x84, 0xb8, 0xd2, 0x4a, 0x87,
+    0x00, 0x64, 0x01, 0xc6, 0xc3, 0x62, 0x00, 0x64, 0x20, 0xc7, 0x14, 0x39,
+    0x00, 0x64, 0x11, 0xc7, 0x7a, 0x7f, 0x00, 0x65, 0xe8, 0xc5, 0x40, 0xe7,
+    0x00, 0x64, 0x19, 0xc4, 0x1e, 0x97, 0x00, 0x66, 0x68, 0x83, 0x00, 0x64,
+    0x2b, 0x02, 0x82, 0xf4, 0x8b, 0x00, 0x64, 0x3b, 0x02, 0x83, 0x00, 0x97,
+    0x00, 0x64, 0x4b, 0x02, 0x83, 0x04, 0x18, 0xc2, 0x83, 0x08, 0x87, 0x00,
+    0x64, 0x73, 0x02, 0x83, 0x12, 0x91, 0x00, 0x64, 0x93, 0x02, 0x83, 0x16,
+    0x0d, 0xc2, 0x83, 0x1a, 0x09, 0xc2, 0x83, 0x24, 0x10, 0xc2, 0x83, 0x2e,
+    0x05, 0xc2, 0x83, 0x47, 0x0c, 0xc2, 0x83, 0x51, 0x16, 0xc2, 0x83, 0x5b,
+    0x06, 0xc2, 0x83, 0x69, 0x12, 0xc2, 0x83, 0x77, 0x04, 0xc2, 0x83, 0x81,
+    0xc2, 0x01, 0xc3, 0x00, 0x65, 0x71, 0xc2, 0x19, 0x2c, 0x00, 0x65, 0x79,
+    0x14, 0xc2, 0x83, 0x8b, 0x0e, 0xc2, 0x83, 0x95, 0x15, 0xc2, 0x83, 0x9d,
+    0xc2, 0x00, 0xd0, 0x00, 0x65, 0xc9, 0xc2, 0x00, 0x87, 0x00, 0x66, 0xf0,
+    0x83, 0x00, 0x65, 0xf1, 0x8b, 0x00, 0x66, 0x41, 0x97, 0x00, 0x66, 0x60,
+    0x8b, 0x00, 0x66, 0x00, 0x97, 0x00, 0x66, 0x10, 0x94, 0x00, 0x66, 0x1b,
+    0x02, 0x83, 0xad, 0x8e, 0x00, 0x67, 0x12, 0x02, 0x83, 0xb1, 0x87, 0x00,
+    0x66, 0x38, 0x91, 0x00, 0x66, 0x58, 0xc2, 0x02, 0xa0, 0x00, 0x67, 0x41,
+    0xc4, 0x02, 0xde, 0x00, 0x67, 0x48, 0xc3, 0x09, 0x9e, 0x00, 0x67, 0x51,
+    0xc3, 0x0d, 0x14, 0x00, 0x67, 0x58, 0xc2, 0x22, 0xcc, 0x00, 0x67, 0x61,
+    0xc4, 0x18, 0x10, 0x00, 0x67, 0x68, 0xc2, 0x02, 0x6f, 0x01, 0x78, 0x03,
+    0x02, 0x83, 0xb5, 0x12, 0xc2, 0x83, 0xbb, 0xc2, 0x18, 0xb3, 0x01, 0x7b,
+    0xe0, 0x0b, 0xc2, 0x83, 0xc7, 0x07, 0xc2, 0x83, 0xd7, 0x03, 0xc2, 0x83,
+    0xe7, 0xc3, 0x08, 0x48, 0x01, 0x7d, 0x3a, 0x02, 0x83, 0xf3, 0x11, 0xc2,
+    0x83, 0xf9, 0x0b, 0xc2, 0x84, 0x1c, 0x14, 0xc2, 0x84, 0x2c, 0x07, 0x42,
+    0x84, 0x3c, 0x0e, 0xc2, 0x84, 0x48, 0x07, 0xc2, 0x84, 0x52, 0x12, 0xc2,
+    0x84, 0x68, 0x05, 0xc2, 0x84, 0x7e, 0xc4, 0x03, 0x14, 0x01, 0x79, 0x49,
+    0x0a, 0xc2, 0x84, 0x8a, 0xc4, 0xb0, 0xd3, 0x01, 0x79, 0xc9, 0x16, 0xc2,
+    0x84, 0x92, 0xc5, 0x0b, 0x0a, 0x01, 0x7a, 0x29, 0xc2, 0x05, 0x1d, 0x01,
+    0x7a, 0x39, 0x03, 0xc2, 0x84, 0xa0, 0xc4, 0x49, 0x26, 0x01, 0x7b, 0x11,
+    0x0b, 0xc2, 0x84, 0xb0, 0xc3, 0x56, 0x1d, 0x01, 0x7b, 0x51, 0xc4, 0x0d,
+    0xed, 0x01, 0x7d, 0x98, 0x11, 0xc2, 0x84, 0xbc, 0xcf, 0x67, 0xec, 0x01,
+    0x78, 0xb1, 0x07, 0xc2, 0x84, 0xc6, 0x03, 0x42, 0x84, 0xd0, 0xc2, 0x02,
+    0xa0, 0x01, 0x78, 0x33, 0x02, 0x84, 0xe0, 0x03, 0xc2, 0x84, 0xe6, 0xc2,
+    0x00, 0xc4, 0x01, 0x78, 0xb9, 0x42, 0x00, 0x33, 0xc2, 0x84, 0xf8, 0x14,
+    0xc2, 0x85, 0x04, 0x0b, 0xc2, 0x85, 0x16, 0x11, 0x42, 0x85, 0x22, 0xc2,
+    0x00, 0xd1, 0x01, 0x78, 0x41, 0x11, 0xc2, 0x85, 0x2e, 0x07, 0xc2, 0x85,
+    0x3c, 0x0b, 0x42, 0x85, 0x48, 0x10, 0xc2, 0x85, 0x54, 0xc4, 0x00, 0x2d,
+    0x01, 0x78, 0x59, 0x03, 0xc2, 0x85, 0x60, 0xc3, 0x18, 0x11, 0x01, 0x7e,
+    0x8b, 0x02, 0x85, 0x6b, 0xc2, 0x0c, 0x43, 0x01, 0x7b, 0x61, 0xc9, 0xa9,
+    0xf3, 0x01, 0x7e, 0x58, 0x11, 0xc2, 0x85, 0x71, 0x0e, 0xc2, 0x85, 0x8d,
+    0xc4, 0xdf, 0xbb, 0x01, 0x79, 0x31, 0x03, 0xc2, 0x85, 0x9d, 0xc3, 0x25,
+    0x4d, 0x01, 0x7d, 0x10, 0xc2, 0x00, 0x89, 0x01, 0x78, 0x71, 0x10, 0x42,
+    0x85, 0xaf, 0xc4, 0x00, 0x27, 0x01, 0x78, 0x91, 0x14, 0xc2, 0x85, 0xbb,
+    0xc3, 0x01, 0xc8, 0x01, 0x7b, 0xf1, 0xc2, 0x00, 0x2d, 0x01, 0x7c, 0xb8,
+    0x14, 0xc2, 0x85, 0xc7, 0x11, 0xc2, 0x85, 0xd3, 0x07, 0xc2, 0x85, 0xdf,
+    0x03, 0xc2, 0x85, 0xeb, 0x0a, 0xc2, 0x85, 0xfa, 0x42, 0x00, 0x74, 0x42,
+    0x86, 0x06, 0x0b, 0xc2, 0x86, 0x0e, 0xc3, 0xbb, 0x1c, 0x01, 0x79, 0x39,
+    0x03, 0xc2, 0x86, 0x20, 0xc2, 0x00, 0xa8, 0x01, 0x7c, 0xd1, 0xc2, 0x05,
+    0x1d, 0x01, 0x7c, 0xd8, 0xc4, 0x46, 0xf6, 0x01, 0x78, 0xe1, 0xc2, 0x24,
+    0xe2, 0x01, 0x7a, 0x21, 0x42, 0x01, 0xa3, 0xc2, 0x86, 0x2e, 0xc2, 0x02,
+    0x35, 0x01, 0x7b, 0xe8, 0x91, 0x01, 0x79, 0x0b, 0x02, 0x86, 0x3a, 0x42,
+    0x00, 0x39, 0xc2, 0x86, 0x46, 0xc3, 0x00, 0xfe, 0x01, 0x7d, 0x41, 0xc4,
+    0xe0, 0x07, 0x01, 0x7e, 0x08, 0x0b, 0xc2, 0x86, 0x52, 0x11, 0xc2, 0x86,
+    0x62, 0x14, 0xc2, 0x86, 0x7e, 0x03, 0xc2, 0x86, 0x90, 0x0e, 0xc2, 0x86,
+    0x9c, 0xc3, 0x0e, 0x8b, 0x01, 0x7c, 0xb0, 0x11, 0xc2, 0x86, 0xae, 0xc2,
+    0x00, 0x3d, 0x01, 0x7b, 0xc8, 0xc2, 0x00, 0x33, 0x01, 0x7a, 0x89, 0x0b,
+    0xc2, 0x86, 0xb8, 0x03, 0xc2, 0x86, 0xd0, 0xc6, 0x14, 0xdb, 0x01, 0x7b,
+    0xd9, 0xc3, 0x65, 0xba, 0x01, 0x7c, 0xe1, 0x0e, 0xc2, 0x86, 0xe2, 0x14,
+    0x42, 0x86, 0xec, 0xc2, 0x00, 0x06, 0x01, 0x7a, 0xf9, 0x94, 0x01, 0x7b,
+    0xc0, 0xc5, 0xd9, 0xf2, 0x01, 0x7c, 0xa9, 0xc6, 0xd0, 0xaf, 0x01, 0x7d,
+    0x28, 0xa2, 0x0c, 0x66, 0xa9, 0xa1, 0x0c, 0x66, 0xa1, 0xa0, 0x0c, 0x66,
+    0x99, 0x9f, 0x0c, 0x66, 0x91, 0x9e, 0x0c, 0x66, 0x89, 0x9d, 0x0c, 0x66,
+    0x80, 0x88, 0x0c, 0x66, 0x79, 0x87, 0x0c, 0x66, 0x71, 0x86, 0x0c, 0x66,
+    0x69, 0x85, 0x0c, 0x66, 0x61, 0x84, 0x0c, 0x66, 0x59, 0x83, 0x0c, 0x66,
+    0x51, 0xa6, 0x0c, 0x66, 0x49, 0xa5, 0x0c, 0x66, 0x41, 0xa4, 0x0c, 0x66,
+    0x39, 0xa3, 0x0c, 0x66, 0x31, 0xa2, 0x0c, 0x66, 0x29, 0xa1, 0x0c, 0x66,
+    0x21, 0xa0, 0x0c, 0x66, 0x19, 0x9f, 0x0c, 0x66, 0x11, 0x9e, 0x0c, 0x66,
+    0x09, 0x9d, 0x0c, 0x66, 0x00, 0x88, 0x0c, 0x65, 0xf9, 0x87, 0x0c, 0x65,
+    0xf1, 0x86, 0x0c, 0x65, 0xe9, 0x85, 0x0c, 0x65, 0xe1, 0x84, 0x0c, 0x65,
+    0xd9, 0x83, 0x0c, 0x65, 0xd1, 0xa6, 0x0c, 0x65, 0xc9, 0xa5, 0x0c, 0x65,
+    0xc1, 0xa4, 0x0c, 0x65, 0xb9, 0xa3, 0x0c, 0x65, 0xb1, 0xa2, 0x0c, 0x65,
+    0xa9, 0xa1, 0x0c, 0x65, 0xa1, 0xa0, 0x0c, 0x65, 0x99, 0x9f, 0x0c, 0x65,
+    0x91, 0x9e, 0x0c, 0x65, 0x89, 0x9d, 0x0c, 0x65, 0x80, 0x88, 0x0c, 0x65,
+    0x79, 0x87, 0x0c, 0x65, 0x71, 0x86, 0x0c, 0x65, 0x69, 0x85, 0x0c, 0x65,
+    0x61, 0x84, 0x0c, 0x65, 0x59, 0x83, 0x0c, 0x65, 0x51, 0xa6, 0x0c, 0x65,
+    0x49, 0xa5, 0x0c, 0x65, 0x41, 0xa4, 0x0c, 0x65, 0x39, 0xa3, 0x0c, 0x65,
+    0x31, 0xa2, 0x0c, 0x65, 0x29, 0xa1, 0x0c, 0x65, 0x21, 0xa0, 0x0c, 0x65,
+    0x19, 0x9f, 0x0c, 0x65, 0x11, 0x9e, 0x0c, 0x65, 0x09, 0x9d, 0x0c, 0x65,
+    0x00, 0x88, 0x0c, 0x64, 0xf9, 0x87, 0x0c, 0x64, 0xf1, 0x86, 0x0c, 0x64,
+    0xe9, 0x85, 0x0c, 0x64, 0xe1, 0x84, 0x0c, 0x64, 0xd9, 0x83, 0x0c, 0x64,
+    0xd1, 0xa6, 0x0c, 0x64, 0xc9, 0xa5, 0x0c, 0x64, 0xc1, 0xa4, 0x0c, 0x64,
+    0xb9, 0xa3, 0x0c, 0x64, 0xb1, 0xa2, 0x0c, 0x64, 0xa9, 0xa1, 0x0c, 0x64,
+    0xa1, 0xa0, 0x0c, 0x64, 0x99, 0x9f, 0x0c, 0x64, 0x91, 0x9e, 0x0c, 0x64,
+    0x89, 0x9d, 0x0c, 0x64, 0x80, 0x88, 0x0c, 0x64, 0x79, 0x87, 0x0c, 0x64,
+    0x71, 0x86, 0x0c, 0x64, 0x69, 0x85, 0x0c, 0x64, 0x61, 0x84, 0x0c, 0x64,
+    0x59, 0x83, 0x0c, 0x64, 0x51, 0xa6, 0x0c, 0x64, 0x49, 0xa5, 0x0c, 0x64,
+    0x41, 0xa4, 0x0c, 0x64, 0x39, 0xa3, 0x0c, 0x64, 0x31, 0xa2, 0x0c, 0x64,
+    0x29, 0xa1, 0x0c, 0x64, 0x21, 0xa0, 0x0c, 0x64, 0x19, 0x9f, 0x0c, 0x64,
+    0x11, 0x9e, 0x0c, 0x64, 0x09, 0x9d, 0x0c, 0x64, 0x00, 0x88, 0x0c, 0x63,
+    0xf9, 0x87, 0x0c, 0x63, 0xf1, 0x86, 0x0c, 0x63, 0xe9, 0x85, 0x0c, 0x63,
+    0xe1, 0x84, 0x0c, 0x63, 0xd9, 0x83, 0x0c, 0x63, 0xd1, 0xa6, 0x0c, 0x63,
+    0xc9, 0xa5, 0x0c, 0x63, 0xc1, 0xa4, 0x0c, 0x63, 0xb9, 0xa3, 0x0c, 0x63,
+    0xb1, 0xa2, 0x0c, 0x63, 0xa9, 0xa1, 0x0c, 0x63, 0xa1, 0xa0, 0x0c, 0x63,
+    0x99, 0x9f, 0x0c, 0x63, 0x91, 0x9e, 0x0c, 0x63, 0x89, 0x9d, 0x0c, 0x63,
+    0x80, 0x88, 0x0c, 0x63, 0x79, 0x87, 0x0c, 0x63, 0x71, 0x86, 0x0c, 0x63,
+    0x69, 0x85, 0x0c, 0x63, 0x61, 0x84, 0x0c, 0x63, 0x59, 0x83, 0x0c, 0x63,
+    0x51, 0xa6, 0x0c, 0x63, 0x49, 0xa5, 0x0c, 0x63, 0x41, 0xa4, 0x0c, 0x63,
+    0x39, 0xa3, 0x0c, 0x63, 0x31, 0xa2, 0x0c, 0x63, 0x29, 0xa1, 0x0c, 0x63,
+    0x21, 0xa0, 0x0c, 0x63, 0x19, 0x9f, 0x0c, 0x63, 0x11, 0x9e, 0x0c, 0x63,
+    0x09, 0x9d, 0x0c, 0x63, 0x00, 0x88, 0x0c, 0x62, 0xf9, 0x87, 0x0c, 0x62,
+    0xf1, 0x86, 0x0c, 0x62, 0xe9, 0x85, 0x0c, 0x62, 0xe1, 0x84, 0x0c, 0x62,
+    0xd9, 0x83, 0x0c, 0x62, 0xd1, 0xa6, 0x0c, 0x62, 0xc9, 0xa5, 0x0c, 0x62,
+    0xc1, 0xa4, 0x0c, 0x62, 0xb9, 0xa3, 0x0c, 0x62, 0xb1, 0xa2, 0x0c, 0x62,
+    0xa9, 0xa1, 0x0c, 0x62, 0xa1, 0xa0, 0x0c, 0x62, 0x99, 0x9f, 0x0c, 0x62,
+    0x91, 0x9e, 0x0c, 0x62, 0x89, 0x9d, 0x0c, 0x62, 0x80, 0x88, 0x0c, 0x62,
+    0x79, 0x87, 0x0c, 0x62, 0x71, 0x86, 0x0c, 0x62, 0x69, 0x85, 0x0c, 0x62,
+    0x61, 0x84, 0x0c, 0x62, 0x59, 0x83, 0x0c, 0x62, 0x51, 0xa6, 0x0c, 0x62,
+    0x49, 0xa5, 0x0c, 0x62, 0x41, 0xa4, 0x0c, 0x62, 0x39, 0xa3, 0x0c, 0x62,
+    0x31, 0xa2, 0x0c, 0x62, 0x29, 0xa1, 0x0c, 0x62, 0x21, 0xa0, 0x0c, 0x62,
+    0x19, 0x9f, 0x0c, 0x62, 0x11, 0x9e, 0x0c, 0x62, 0x09, 0x9d, 0x0c, 0x62,
+    0x00, 0x88, 0x0c, 0x61, 0xf9, 0x87, 0x0c, 0x61, 0xf1, 0x86, 0x0c, 0x61,
+    0xe9, 0x85, 0x0c, 0x61, 0xe1, 0x84, 0x0c, 0x61, 0xd9, 0x83, 0x0c, 0x61,
+    0xd1, 0xa6, 0x0c, 0x61, 0xc9, 0xa5, 0x0c, 0x61, 0xc1, 0xa4, 0x0c, 0x61,
+    0xb9, 0xa3, 0x0c, 0x61, 0xb1, 0xa2, 0x0c, 0x61, 0xa9, 0xa1, 0x0c, 0x61,
+    0xa1, 0xa0, 0x0c, 0x61, 0x99, 0x9f, 0x0c, 0x61, 0x91, 0x9e, 0x0c, 0x61,
+    0x89, 0x9d, 0x0c, 0x61, 0x80, 0x88, 0x0c, 0x61, 0x79, 0x87, 0x0c, 0x61,
+    0x71, 0x86, 0x0c, 0x61, 0x69, 0x85, 0x0c, 0x61, 0x61, 0x84, 0x0c, 0x61,
+    0x59, 0x83, 0x0c, 0x61, 0x51, 0xa6, 0x0c, 0x61, 0x49, 0xa5, 0x0c, 0x61,
+    0x41, 0xa4, 0x0c, 0x61, 0x39, 0xa3, 0x0c, 0x61, 0x31, 0xa2, 0x0c, 0x61,
+    0x29, 0xa1, 0x0c, 0x61, 0x21, 0xa0, 0x0c, 0x61, 0x19, 0x9f, 0x0c, 0x61,
+    0x11, 0x9e, 0x0c, 0x61, 0x09, 0x9d, 0x0c, 0x61, 0x00, 0x88, 0x0c, 0x60,
+    0xf9, 0x87, 0x0c, 0x60, 0xf1, 0x86, 0x0c, 0x60, 0xe9, 0x85, 0x0c, 0x60,
+    0xe1, 0x84, 0x0c, 0x60, 0xd9, 0x83, 0x0c, 0x60, 0xd1, 0xa6, 0x0c, 0x60,
+    0xc9, 0xa5, 0x0c, 0x60, 0xc1, 0xa4, 0x0c, 0x60, 0xb9, 0xa3, 0x0c, 0x60,
+    0xb1, 0xa2, 0x0c, 0x60, 0xa9, 0xa1, 0x0c, 0x60, 0xa1, 0xa0, 0x0c, 0x60,
+    0x99, 0x9f, 0x0c, 0x60, 0x91, 0x9e, 0x0c, 0x60, 0x89, 0x9d, 0x0c, 0x60,
+    0x80, 0x88, 0x0c, 0x60, 0x79, 0x87, 0x0c, 0x60, 0x71, 0x86, 0x0c, 0x60,
+    0x69, 0x85, 0x0c, 0x60, 0x61, 0x84, 0x0c, 0x60, 0x59, 0x83, 0x0c, 0x60,
+    0x51, 0xa6, 0x0c, 0x60, 0x49, 0xa5, 0x0c, 0x60, 0x41, 0xa4, 0x0c, 0x60,
+    0x39, 0xa3, 0x0c, 0x60, 0x31, 0xa2, 0x0c, 0x60, 0x29, 0xa1, 0x0c, 0x60,
+    0x21, 0xa0, 0x0c, 0x60, 0x19, 0x9f, 0x0c, 0x60, 0x11, 0x9e, 0x0c, 0x60,
+    0x09, 0x9d, 0x0c, 0x60, 0x00, 0x88, 0x0c, 0x5f, 0xf9, 0x87, 0x0c, 0x5f,
+    0xf1, 0x86, 0x0c, 0x5f, 0xe9, 0x85, 0x0c, 0x5f, 0xe1, 0x84, 0x0c, 0x5f,
+    0xd9, 0x83, 0x0c, 0x5f, 0xd1, 0xa6, 0x0c, 0x5f, 0xc9, 0xa5, 0x0c, 0x5f,
+    0xc1, 0xa4, 0x0c, 0x5f, 0xb9, 0xa3, 0x0c, 0x5f, 0xb1, 0xa2, 0x0c, 0x5f,
+    0xa9, 0xa1, 0x0c, 0x5f, 0xa1, 0xa0, 0x0c, 0x5f, 0x99, 0x9f, 0x0c, 0x5f,
+    0x91, 0x9e, 0x0c, 0x5f, 0x89, 0x9d, 0x0c, 0x5f, 0x80, 0x88, 0x0c, 0x5f,
+    0x79, 0x87, 0x0c, 0x5f, 0x71, 0x86, 0x0c, 0x5f, 0x69, 0x85, 0x0c, 0x5f,
+    0x61, 0x84, 0x0c, 0x5f, 0x59, 0x83, 0x0c, 0x5f, 0x51, 0xa6, 0x0c, 0x5f,
+    0x49, 0xa5, 0x0c, 0x5f, 0x41, 0xa4, 0x0c, 0x5f, 0x39, 0xa3, 0x0c, 0x5f,
+    0x31, 0xa2, 0x0c, 0x5f, 0x29, 0xa1, 0x0c, 0x5f, 0x21, 0xa0, 0x0c, 0x5f,
+    0x19, 0x9f, 0x0c, 0x5f, 0x11, 0x9e, 0x0c, 0x5f, 0x09, 0x9d, 0x0c, 0x5f,
+    0x00, 0x88, 0x0c, 0x5e, 0xf9, 0x87, 0x0c, 0x5e, 0xf1, 0x86, 0x0c, 0x5e,
+    0xe9, 0x85, 0x0c, 0x5e, 0xe1, 0x84, 0x0c, 0x5e, 0xd9, 0x83, 0x0c, 0x5e,
+    0xd1, 0xa6, 0x0c, 0x5e, 0xc9, 0xa5, 0x0c, 0x5e, 0xc1, 0xa4, 0x0c, 0x5e,
+    0xb9, 0xa3, 0x0c, 0x5e, 0xb1, 0xa2, 0x0c, 0x5e, 0xa9, 0xa1, 0x0c, 0x5e,
+    0xa1, 0xa0, 0x0c, 0x5e, 0x99, 0x9f, 0x0c, 0x5e, 0x91, 0x9e, 0x0c, 0x5e,
+    0x89, 0x9d, 0x0c, 0x5e, 0x80, 0x88, 0x0c, 0x5e, 0x79, 0x87, 0x0c, 0x5e,
+    0x71, 0x86, 0x0c, 0x5e, 0x69, 0x85, 0x0c, 0x5e, 0x61, 0x84, 0x0c, 0x5e,
+    0x59, 0x83, 0x0c, 0x5e, 0x51, 0xa6, 0x0c, 0x5e, 0x49, 0xa5, 0x0c, 0x5e,
+    0x41, 0xa4, 0x0c, 0x5e, 0x39, 0xa3, 0x0c, 0x5e, 0x31, 0xa2, 0x0c, 0x5e,
+    0x29, 0xa1, 0x0c, 0x5e, 0x21, 0xa0, 0x0c, 0x5e, 0x19, 0x9f, 0x0c, 0x5e,
+    0x11, 0x9e, 0x0c, 0x5e, 0x09, 0x9d, 0x0c, 0x5e, 0x00, 0x88, 0x0c, 0x5d,
+    0xf9, 0x87, 0x0c, 0x5d, 0xf1, 0x86, 0x0c, 0x5d, 0xe9, 0x85, 0x0c, 0x5d,
+    0xe1, 0x84, 0x0c, 0x5d, 0xd9, 0x83, 0x0c, 0x5d, 0xd1, 0xa6, 0x0c, 0x5d,
+    0xc9, 0xa5, 0x0c, 0x5d, 0xc1, 0xa4, 0x0c, 0x5d, 0xb9, 0xa3, 0x0c, 0x5d,
+    0xb1, 0xa2, 0x0c, 0x5d, 0xa9, 0xa1, 0x0c, 0x5d, 0xa1, 0xa0, 0x0c, 0x5d,
+    0x99, 0x9f, 0x0c, 0x5d, 0x91, 0x9e, 0x0c, 0x5d, 0x89, 0x9d, 0x0c, 0x5d,
+    0x80, 0x88, 0x0c, 0x5d, 0x79, 0x87, 0x0c, 0x5d, 0x71, 0x86, 0x0c, 0x5d,
+    0x69, 0x85, 0x0c, 0x5d, 0x61, 0x84, 0x0c, 0x5d, 0x59, 0x83, 0x0c, 0x5d,
+    0x51, 0xa6, 0x0c, 0x5d, 0x49, 0xa5, 0x0c, 0x5d, 0x41, 0xa4, 0x0c, 0x5d,
+    0x39, 0xa3, 0x0c, 0x5d, 0x31, 0xa2, 0x0c, 0x5d, 0x29, 0xa1, 0x0c, 0x5d,
+    0x21, 0xa0, 0x0c, 0x5d, 0x19, 0x9f, 0x0c, 0x5d, 0x11, 0x9e, 0x0c, 0x5d,
+    0x09, 0x9d, 0x0c, 0x5d, 0x00, 0x88, 0x0c, 0x5c, 0xf9, 0x87, 0x0c, 0x5c,
+    0xf1, 0x86, 0x0c, 0x5c, 0xe9, 0x85, 0x0c, 0x5c, 0xe1, 0x84, 0x0c, 0x5c,
+    0xd9, 0x83, 0x0c, 0x5c, 0xd1, 0xa6, 0x0c, 0x5c, 0xc9, 0xa5, 0x0c, 0x5c,
+    0xc1, 0xa4, 0x0c, 0x5c, 0xb9, 0xa3, 0x0c, 0x5c, 0xb1, 0xa2, 0x0c, 0x5c,
+    0xa9, 0xa1, 0x0c, 0x5c, 0xa1, 0xa0, 0x0c, 0x5c, 0x99, 0x9f, 0x0c, 0x5c,
+    0x91, 0x9e, 0x0c, 0x5c, 0x89, 0x9d, 0x0c, 0x5c, 0x80, 0x88, 0x0c, 0x5c,
+    0x79, 0x87, 0x0c, 0x5c, 0x71, 0x86, 0x0c, 0x5c, 0x69, 0x85, 0x0c, 0x5c,
+    0x61, 0x84, 0x0c, 0x5c, 0x59, 0x83, 0x0c, 0x5c, 0x51, 0xa6, 0x0c, 0x5c,
+    0x49, 0xa5, 0x0c, 0x5c, 0x41, 0xa4, 0x0c, 0x5c, 0x39, 0xa3, 0x0c, 0x5c,
+    0x31, 0xa2, 0x0c, 0x5c, 0x29, 0xa1, 0x0c, 0x5c, 0x21, 0xa0, 0x0c, 0x5c,
+    0x19, 0x9f, 0x0c, 0x5c, 0x11, 0x9e, 0x0c, 0x5c, 0x09, 0x9d, 0x0c, 0x5c,
+    0x00, 0x88, 0x0c, 0x5b, 0xf9, 0x87, 0x0c, 0x5b, 0xf1, 0x86, 0x0c, 0x5b,
+    0xe9, 0x85, 0x0c, 0x5b, 0xe1, 0x84, 0x0c, 0x5b, 0xd9, 0x83, 0x0c, 0x5b,
+    0xd1, 0xa6, 0x0c, 0x5b, 0xc9, 0xa5, 0x0c, 0x5b, 0xc1, 0xa4, 0x0c, 0x5b,
+    0xb9, 0xa3, 0x0c, 0x5b, 0xb1, 0xa2, 0x0c, 0x5b, 0xa9, 0xa1, 0x0c, 0x5b,
+    0xa1, 0xa0, 0x0c, 0x5b, 0x99, 0x9f, 0x0c, 0x5b, 0x91, 0x9e, 0x0c, 0x5b,
+    0x89, 0x9d, 0x0c, 0x5b, 0x80, 0x88, 0x0c, 0x5b, 0x79, 0x87, 0x0c, 0x5b,
+    0x71, 0x86, 0x0c, 0x5b, 0x69, 0x85, 0x0c, 0x5b, 0x61, 0x84, 0x0c, 0x5b,
+    0x59, 0x83, 0x0c, 0x5b, 0x51, 0xa6, 0x0c, 0x5b, 0x49, 0xa5, 0x0c, 0x5b,
+    0x41, 0xa4, 0x0c, 0x5b, 0x39, 0xa3, 0x0c, 0x5b, 0x31, 0xa2, 0x0c, 0x5b,
+    0x29, 0xa1, 0x0c, 0x5b, 0x21, 0xa0, 0x0c, 0x5b, 0x19, 0x9f, 0x0c, 0x5b,
+    0x11, 0x9e, 0x0c, 0x5b, 0x09, 0x9d, 0x0c, 0x5b, 0x00, 0x88, 0x0c, 0x5a,
+    0xf9, 0x87, 0x0c, 0x5a, 0xf1, 0x86, 0x0c, 0x5a, 0xe9, 0x85, 0x0c, 0x5a,
+    0xe1, 0x84, 0x0c, 0x5a, 0xd9, 0x83, 0x0c, 0x5a, 0xd1, 0xa6, 0x0c, 0x5a,
+    0xc9, 0xa5, 0x0c, 0x5a, 0xc1, 0xa4, 0x0c, 0x5a, 0xb9, 0xa3, 0x0c, 0x5a,
+    0xb1, 0xa2, 0x0c, 0x5a, 0xa9, 0xa1, 0x0c, 0x5a, 0xa1, 0xa0, 0x0c, 0x5a,
+    0x99, 0x9f, 0x0c, 0x5a, 0x91, 0x9e, 0x0c, 0x5a, 0x89, 0x9d, 0x0c, 0x5a,
+    0x80, 0x88, 0x0c, 0x5a, 0x79, 0x87, 0x0c, 0x5a, 0x71, 0x86, 0x0c, 0x5a,
+    0x69, 0x85, 0x0c, 0x5a, 0x61, 0x84, 0x0c, 0x5a, 0x59, 0x83, 0x0c, 0x5a,
+    0x51, 0xa6, 0x0c, 0x5a, 0x49, 0xa5, 0x0c, 0x5a, 0x41, 0xa4, 0x0c, 0x5a,
+    0x39, 0xa3, 0x0c, 0x5a, 0x31, 0xa2, 0x0c, 0x5a, 0x29, 0xa1, 0x0c, 0x5a,
+    0x21, 0xa0, 0x0c, 0x5a, 0x19, 0x9f, 0x0c, 0x5a, 0x11, 0x9e, 0x0c, 0x5a,
+    0x09, 0x9d, 0x0c, 0x5a, 0x00, 0x88, 0x0c, 0x59, 0xf9, 0x87, 0x0c, 0x59,
+    0xf1, 0x86, 0x0c, 0x59, 0xe9, 0x85, 0x0c, 0x59, 0xe1, 0x84, 0x0c, 0x59,
+    0xd9, 0x83, 0x0c, 0x59, 0xd1, 0xa6, 0x0c, 0x59, 0xc9, 0xa5, 0x0c, 0x59,
+    0xc1, 0xa4, 0x0c, 0x59, 0xb9, 0xa3, 0x0c, 0x59, 0xb1, 0xa2, 0x0c, 0x59,
+    0xa9, 0xa1, 0x0c, 0x59, 0xa1, 0xa0, 0x0c, 0x59, 0x99, 0x9f, 0x0c, 0x59,
+    0x91, 0x9e, 0x0c, 0x59, 0x89, 0x9d, 0x0c, 0x59, 0x80, 0x88, 0x0c, 0x59,
+    0x79, 0x87, 0x0c, 0x59, 0x71, 0x86, 0x0c, 0x59, 0x69, 0x85, 0x0c, 0x59,
+    0x61, 0x84, 0x0c, 0x59, 0x59, 0x83, 0x0c, 0x59, 0x51, 0xa6, 0x0c, 0x59,
+    0x49, 0xa5, 0x0c, 0x59, 0x41, 0xa4, 0x0c, 0x59, 0x39, 0xa3, 0x0c, 0x59,
+    0x31, 0xa2, 0x0c, 0x59, 0x29, 0xa1, 0x0c, 0x59, 0x21, 0xa0, 0x0c, 0x59,
+    0x19, 0x9f, 0x0c, 0x59, 0x11, 0x9e, 0x0c, 0x59, 0x09, 0x9d, 0x0c, 0x59,
+    0x00, 0x88, 0x0c, 0x58, 0xf9, 0x87, 0x0c, 0x58, 0xf1, 0x86, 0x0c, 0x58,
+    0xe9, 0x85, 0x0c, 0x58, 0xe1, 0x84, 0x0c, 0x58, 0xd9, 0x83, 0x0c, 0x58,
+    0xd1, 0xa6, 0x0c, 0x58, 0xc9, 0xa5, 0x0c, 0x58, 0xc1, 0xa4, 0x0c, 0x58,
+    0xb9, 0xa3, 0x0c, 0x58, 0xb1, 0xa2, 0x0c, 0x58, 0xa9, 0xa1, 0x0c, 0x58,
+    0xa1, 0xa0, 0x0c, 0x58, 0x99, 0x9f, 0x0c, 0x58, 0x91, 0x9e, 0x0c, 0x58,
+    0x89, 0x9d, 0x0c, 0x58, 0x80, 0x88, 0x0c, 0x58, 0x79, 0x87, 0x0c, 0x58,
+    0x71, 0x86, 0x0c, 0x58, 0x69, 0x85, 0x0c, 0x58, 0x61, 0x84, 0x0c, 0x58,
+    0x59, 0x83, 0x0c, 0x58, 0x51, 0xa6, 0x0c, 0x58, 0x49, 0xa5, 0x0c, 0x58,
+    0x41, 0xa4, 0x0c, 0x58, 0x39, 0xa3, 0x0c, 0x58, 0x31, 0xa2, 0x0c, 0x58,
+    0x29, 0xa1, 0x0c, 0x58, 0x21, 0xa0, 0x0c, 0x58, 0x19, 0x9f, 0x0c, 0x58,
+    0x11, 0x9e, 0x0c, 0x58, 0x09, 0x9d, 0x0c, 0x58, 0x00, 0xc2, 0x00, 0xd0,
+    0x08, 0x96, 0x59, 0xc2, 0x0e, 0x9a, 0x08, 0x96, 0x49, 0x83, 0x08, 0x96,
+    0x40, 0xc2, 0x00, 0xd0, 0x08, 0x96, 0x39, 0x83, 0x08, 0x96, 0x30, 0xc4,
+    0xdb, 0xfb, 0x08, 0x91, 0xf1, 0xc5, 0xd7, 0x18, 0x08, 0x91, 0xb8, 0xc2,
+    0x0e, 0x9a, 0x08, 0x90, 0xe1, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0xb9, 0x83,
+    0x08, 0x90, 0xb0, 0xc2, 0x00, 0xd0, 0x08, 0x90, 0xa9, 0x83, 0x08, 0x90,
+    0xa0, 0x02, 0xc2, 0x86, 0xf8, 0x00, 0x42, 0x87, 0x06, 0x43, 0x13, 0x3a,
+    0xc2, 0x87, 0x12, 0x43, 0x71, 0xed, 0xc2, 0x87, 0x1a, 0xc9, 0xb0, 0xc5,
+    0x00, 0xcf, 0x00, 0x44, 0xdf, 0x37, 0xc2, 0x87, 0x26, 0x43, 0x93, 0x74,
+    0x42, 0x87, 0x32, 0xc3, 0x38, 0x5b, 0x00, 0xcf, 0x89, 0xc4, 0xe0, 0xaf,
+    0x00, 0xcf, 0x08, 0x12, 0xc2, 0x87, 0x3e, 0x04, 0xc2, 0x87, 0x4d, 0xc4,
+    0xda, 0x97, 0x00, 0xbf, 0x89, 0xc3, 0x18, 0x91, 0x00, 0xbf, 0x80, 0xc7,
+    0xc6, 0x24, 0x00, 0xbe, 0xe9, 0xcc, 0x89, 0x31, 0x00, 0xbe, 0xe1, 0xc4,
+    0xe0, 0x0b, 0x00, 0xbe, 0x78, 0xc6, 0xcd, 0xb5, 0x00, 0xbe, 0xd1, 0xc3,
+    0x00, 0xd0, 0x00, 0xbe, 0xa1, 0xc6, 0xcd, 0x97, 0x00, 0xbe, 0x70, 0xc5,
+    0xdc, 0x22, 0x00, 0xbe, 0xc1, 0x03, 0x42, 0x87, 0x59, 0xce, 0x71, 0xe6,
+    0x00, 0xbe, 0xb1, 0xc4, 0xe4, 0x1f, 0x00, 0xbe, 0x90, 0xca, 0xa3, 0x50,
+    0x00, 0xbe, 0x69, 0xc6, 0xcc, 0xdd, 0x00, 0xbe, 0x50, 0xc4, 0xe4, 0x17,
+    0x00, 0xbe, 0x61, 0xc6, 0xd3, 0xd9, 0x00, 0xbe, 0x38, 0x97, 0x00, 0xbe,
+    0x29, 0x8b, 0x00, 0xbe, 0x19, 0x87, 0x00, 0xbe, 0x11, 0x83, 0x00, 0xbd,
+    0xb0, 0x91, 0x00, 0xbe, 0x21, 0x87, 0x00, 0xbd, 0xf0, 0x87, 0x00, 0xbe,
+    0x01, 0x8b, 0x00, 0xbd, 0xc0, 0x83, 0x00, 0xbd, 0xf9, 0x9b, 0x00, 0xbd,
+    0xd0, 0x83, 0x00, 0xbd, 0xe9, 0x97, 0x00, 0xbd, 0xe0, 0x97, 0x00, 0xbd,
+    0x99, 0x8b, 0x00, 0xbd, 0x81, 0x83, 0x00, 0xbd, 0x21, 0x93, 0x00, 0xbd,
+    0x18, 0xc3, 0x02, 0x9f, 0x00, 0xbd, 0x91, 0xc3, 0x05, 0x14, 0x00, 0xbd,
+    0x88, 0x97, 0x00, 0xbd, 0x4b, 0x02, 0x87, 0x6b, 0x8d, 0x00, 0xbd, 0x40,
+    0x8b, 0x00, 0xbd, 0x30, 0x91, 0x00, 0xbc, 0xb9, 0x83, 0x00, 0xbc, 0xa8,
+    0x91, 0x00, 0xbc, 0x91, 0x83, 0x00, 0xbc, 0x80, 0x91, 0x00, 0xbc, 0x69,
+    0x83, 0x00, 0xbc, 0x58, 0x91, 0x00, 0xbc, 0x41, 0x83, 0x00, 0xbc, 0x30,
+    0x91, 0x00, 0xbc, 0x19, 0x83, 0x00, 0xbc, 0x08, 0xca, 0x97, 0xf6, 0x08,
+    0x52, 0xb9, 0x96, 0x08, 0x52, 0x80, 0x91, 0x08, 0x50, 0x31, 0x87, 0x08,
+    0x50, 0x29, 0xc9, 0xb2, 0x2d, 0x08, 0x50, 0x19, 0x97, 0x08, 0x50, 0x11,
+    0x8b, 0x08, 0x50, 0x08, 0x16, 0xc2, 0x87, 0x6f, 0xc2, 0x00, 0xd0, 0x08,
+    0x50, 0xd9, 0x83, 0x08, 0x50, 0xd0, 0xc2, 0x00, 0xd0, 0x08, 0x50, 0xe9,
+    0x83, 0x08, 0x50, 0xe0, 0xcb, 0x20, 0x9d, 0x0f, 0xb0, 0xd1, 0xcc, 0x1d,
+    0x4a, 0x0f, 0xb0, 0xc8, 0xd7, 0x2a, 0xf5, 0x0f, 0xd2, 0x68, 0x49, 0x2a,
+    0xf5, 0x42, 0x87, 0x79, 0xc3, 0x00, 0x74, 0x0f, 0xd0, 0x03, 0x02, 0x87,
+    0x85, 0xc5, 0x56, 0xa5, 0x0f, 0xd0, 0x22, 0x02, 0x87, 0x8b, 0x49, 0x2a,
+    0xf5, 0x42, 0x87, 0x91, 0x49, 0x2a, 0xf5, 0x42, 0x87, 0x9d, 0x49, 0x2a,
+    0xf5, 0x42, 0x87, 0xa9, 0x0d, 0xc2, 0x87, 0xb5, 0xc5, 0xa8, 0xf7, 0x0f,
+    0xd1, 0x59, 0xc4, 0xde, 0x83, 0x0f, 0xd1, 0x61, 0xc6, 0xca, 0xfd, 0x0f,
+    0xd1, 0x69, 0xc4, 0xe3, 0x93, 0x0f, 0xd1, 0x78, 0x43, 0x00, 0xbc, 0xc2,
+    0x87, 0xc1, 0xc4, 0xe3, 0x5b, 0x08, 0xa2, 0x50, 0xcd, 0x80, 0x36, 0x08,
+    0xa2, 0xf9, 0x47, 0xb2, 0x2e, 0x42, 0x87, 0xe9, 0x83, 0x08, 0xa1, 0x99,
+    0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x89, 0xc2, 0x0d, 0xf6, 0x08, 0xa1, 0x90,
+    0x83, 0x08, 0xa1, 0x19, 0xc2, 0x00, 0xc1, 0x08, 0xa0, 0xf1, 0x1b, 0xc2,
+    0x87, 0xf7, 0x09, 0xc2, 0x88, 0x01, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x20,
+    0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x11, 0x83, 0x08, 0xa1, 0x09, 0x06, 0x42,
+    0x88, 0x0b, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x01, 0x83, 0x08, 0xa0, 0xf9,
+    0x16, 0x42, 0x88, 0x15, 0xc2, 0x00, 0xd0, 0x08, 0xa0, 0xb9, 0x83, 0x08,
+    0xa0, 0xb0, 0xc2, 0x00, 0xd0, 0x08, 0xa0, 0xa9, 0x83, 0x08, 0xa0, 0xa0,
+    0xc2, 0x00, 0xd0, 0x08, 0xa0, 0x89, 0x83, 0x08, 0xa0, 0x80, 0xc2, 0x00,
+    0xd0, 0x08, 0xa0, 0x79, 0x83, 0x08, 0xa0, 0x70, 0x97, 0x08, 0xa0, 0x69,
+    0x8b, 0x08, 0xa0, 0x59, 0x83, 0x08, 0xa0, 0x08, 0x97, 0x08, 0xa0, 0x28,
+    0x8b, 0x08, 0xa0, 0x18, 0x83, 0x08, 0xa1, 0x29, 0xc2, 0x00, 0xd0, 0x08,
+    0xa1, 0x30, 0x83, 0x08, 0xa1, 0x39, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x40,
+    0x83, 0x08, 0xa1, 0x49, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x50, 0x83, 0x08,
+    0xa1, 0x61, 0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x68, 0x83, 0x08, 0xa1, 0x71,
+    0xc2, 0x00, 0xd0, 0x08, 0xa1, 0x78, 0xc5, 0x0a, 0x8a, 0x08, 0xa2, 0xd1,
+    0xc5, 0x86, 0x20, 0x08, 0xa2, 0x60, 0xc4, 0x26, 0x78, 0x08, 0xa2, 0xc9,
+    0xc5, 0x06, 0xdb, 0x08, 0xa2, 0xc1, 0x15, 0xc2, 0x88, 0x1f, 0x08, 0xc2,
+    0x88, 0x2b, 0x16, 0xc2, 0x88, 0x37, 0xc3, 0x05, 0x14, 0x08, 0xa2, 0x89,
+    0xc4, 0x15, 0xe7, 0x08, 0xa2, 0x80, 0x97, 0x08, 0xa2, 0x09, 0x8b, 0x08,
+    0xa1, 0xf9, 0x83, 0x08, 0xa1, 0xa8, 0x8e, 0x08, 0xa1, 0xe3, 0x02, 0x88,
+    0x43, 0x94, 0x08, 0xa1, 0xd2, 0x02, 0x88, 0x47, 0x97, 0x08, 0xa1, 0xc8,
+    0x8b, 0x08, 0xa1, 0xb8, 0x98, 0x00, 0xce, 0xf8, 0xcd, 0x78, 0xf3, 0x00,
+    0xce, 0xd1, 0x49, 0xac, 0xb1, 0x42, 0x88, 0x4b, 0xc4, 0x26, 0x78, 0x00,
+    0xce, 0xc9, 0xc5, 0x06, 0xdb, 0x00, 0xce, 0xc1, 0x15, 0xc2, 0x88, 0x53,
+    0x08, 0xc2, 0x88, 0x5f, 0x16, 0xc2, 0x88, 0x6b, 0xc3, 0x05, 0x14, 0x00,
+    0xce, 0x89, 0xc4, 0x15, 0xe7, 0x00, 0xce, 0x80, 0x46, 0x26, 0xf7, 0xc2,
+    0x88, 0x77, 0x44, 0x05, 0x36, 0xc2, 0x88, 0x92, 0x45, 0x08, 0xcb, 0x42,
+    0x88, 0xe0, 0x0b, 0xc2, 0x89, 0x2e, 0x97, 0x00, 0xcd, 0x9b, 0x02, 0x89,
+    0x36, 0x91, 0x00, 0xcd, 0xbb, 0x02, 0x89, 0x45, 0x03, 0xc2, 0x89, 0x50,
+    0x87, 0x00, 0xcd, 0xa9, 0xcf, 0x6a, 0x35, 0x00, 0xcd, 0x80, 0x9c, 0x0f,
+    0x8c, 0x49, 0x9b, 0x0f, 0x8c, 0x41, 0x9a, 0x0f, 0x8c, 0x39, 0x99, 0x0f,
+    0x8c, 0x31, 0x98, 0x0f, 0x8c, 0x29, 0x97, 0x0f, 0x8c, 0x21, 0x96, 0x0f,
+    0x8c, 0x19, 0x95, 0x0f, 0x8c, 0x11, 0x94, 0x0f, 0x8c, 0x09, 0x93, 0x0f,
+    0x8c, 0x01, 0x92, 0x0f, 0x8b, 0xf9, 0x91, 0x0f, 0x8b, 0xf1, 0x90, 0x0f,
+    0x8b, 0xe9, 0x8f, 0x0f, 0x8b, 0xe1, 0x8e, 0x0f, 0x8b, 0xd9, 0x8d, 0x0f,
+    0x8b, 0xd1, 0x8c, 0x0f, 0x8b, 0xc9, 0x8b, 0x0f, 0x8b, 0xc1, 0x8a, 0x0f,
+    0x8b, 0xb9, 0x89, 0x0f, 0x8b, 0xb1, 0x88, 0x0f, 0x8b, 0xa9, 0x87, 0x0f,
+    0x8b, 0xa1, 0x86, 0x0f, 0x8b, 0x99, 0x85, 0x0f, 0x8b, 0x91, 0x84, 0x0f,
+    0x8b, 0x89, 0x83, 0x0f, 0x8b, 0x80, 0x16, 0xc2, 0x89, 0x5f, 0xc8, 0x4b,
+    0x5f, 0x01, 0x27, 0x99, 0x07, 0xc2, 0x89, 0x6b, 0x15, 0xc2, 0x89, 0x77,
+    0x08, 0x42, 0x89, 0x83, 0x9c, 0x0f, 0x8b, 0x49, 0x9b, 0x0f, 0x8b, 0x41,
+    0x9a, 0x0f, 0x8b, 0x39, 0x99, 0x0f, 0x8b, 0x31, 0x98, 0x0f, 0x8b, 0x29,
+    0x97, 0x0f, 0x8b, 0x21, 0x96, 0x0f, 0x8b, 0x19, 0x95, 0x0f, 0x8b, 0x11,
+    0x94, 0x0f, 0x8b, 0x09, 0x93, 0x0f, 0x8b, 0x01, 0x92, 0x0f, 0x8a, 0xf9,
+    0x91, 0x0f, 0x8a, 0xf1, 0x90, 0x0f, 0x8a, 0xe9, 0x8f, 0x0f, 0x8a, 0xe1,
+    0x8e, 0x0f, 0x8a, 0xd9, 0x8d, 0x0f, 0x8a, 0xd1, 0x8c, 0x0f, 0x8a, 0xc9,
+    0x8b, 0x0f, 0x8a, 0xc1, 0x8a, 0x0f, 0x8a, 0xb9, 0x89, 0x0f, 0x8a, 0xb1,
+    0x88, 0x0f, 0x8a, 0xa9, 0x87, 0x0f, 0x8a, 0xa1, 0x86, 0x0f, 0x8a, 0x99,
+    0x85, 0x0f, 0x8a, 0x91, 0x84, 0x0f, 0x8a, 0x89, 0x83, 0x0f, 0x8a, 0x80,
+    0x97, 0x08, 0xce, 0xe9, 0x8b, 0x08, 0xce, 0xd9, 0x83, 0x08, 0xce, 0x88,
+    0x94, 0x08, 0xce, 0xb8, 0x97, 0x08, 0xce, 0xa8, 0x8b, 0x08, 0xce, 0x98,
+    0xc7, 0x7a, 0x7f, 0x08, 0xcf, 0x09, 0xc7, 0x14, 0x39, 0x08, 0xce, 0xf0,
+    0xc4, 0x1e, 0x97, 0x08, 0xcf, 0x01, 0xc5, 0x40, 0xe7, 0x08, 0xce, 0xf8,
+    0xc2, 0x00, 0x39, 0x08, 0xce, 0x81, 0x83, 0x08, 0xce, 0x40, 0xc2, 0x00,
+    0xdb, 0x08, 0xce, 0x79, 0x83, 0x08, 0xce, 0x48, 0x83, 0x08, 0xce, 0x69,
+    0xc2, 0x0d, 0xf6, 0x08, 0xce, 0x61, 0xc2, 0x00, 0xd0, 0x08, 0xce, 0x58,
+    0x83, 0x08, 0xce, 0x51, 0xc8, 0xb2, 0x2e, 0x08, 0xcd, 0x32, 0x02, 0x89,
+    0x8f, 0xc2, 0x00, 0xd0, 0x08, 0xce, 0x29, 0x83, 0x08, 0xce, 0x20, 0xc2,
+    0x00, 0xd0, 0x08, 0xce, 0x19, 0x83, 0x08, 0xce, 0x10, 0x83, 0x08, 0xce,
+    0x09, 0xc2, 0x00, 0xc1, 0x08, 0xcd, 0xe1, 0xc2, 0x19, 0x2c, 0x08, 0xcd,
+    0xb9, 0xc2, 0x01, 0x30, 0x08, 0xcd, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0xce,
+    0x01, 0x83, 0x08, 0xcd, 0xf9, 0x06, 0x42, 0x89, 0x93, 0xc2, 0x00, 0xd0,
+    0x08, 0xcd, 0xf1, 0x83, 0x08, 0xcd, 0xe9, 0x16, 0x42, 0x89, 0x9d, 0xc2,
+    0x00, 0xd0, 0x08, 0xcd, 0xb1, 0x83, 0x08, 0xcd, 0xa8, 0xc2, 0x00, 0xd0,
+    0x08, 0xcd, 0xa1, 0x83, 0x08, 0xcd, 0x98, 0xc2, 0x00, 0xd0, 0x08, 0xcd,
+    0x89, 0x83, 0x08, 0xcd, 0x80, 0xc2, 0x00, 0xd0, 0x08, 0xcd, 0x79, 0x83,
+    0x08, 0xcd, 0x70, 0x97, 0x08, 0xcd, 0x69, 0x8b, 0x08, 0xcd, 0x59, 0x83,
+    0x08, 0xcd, 0x08, 0x97, 0x08, 0xcd, 0x28, 0x8b, 0x08, 0xcd, 0x18, 0xc8,
+    0x0d, 0x03, 0x08, 0x45, 0x78, 0x19, 0xc2, 0x89, 0xa7, 0xc2, 0x00, 0xc4,
+    0x08, 0x45, 0x69, 0xc4, 0x02, 0xde, 0x08, 0x45, 0x48, 0xc3, 0x0d, 0x14,
+    0x08, 0x45, 0x61, 0xc3, 0x09, 0x9e, 0x08, 0x45, 0x50, 0xc2, 0x39, 0x8b,
+    0x08, 0x44, 0xf1, 0xc3, 0x1e, 0x1b, 0x08, 0x44, 0x58, 0xc3, 0x11, 0xef,
+    0x08, 0x44, 0xe9, 0x03, 0x42, 0x89, 0xb1, 0xc4, 0x3e, 0x5a, 0x08, 0x44,
+    0xe1, 0xc3, 0x20, 0x18, 0x08, 0x44, 0xa1, 0xc3, 0x00, 0x4e, 0x08, 0x44,
+    0x91, 0xc6, 0xcf, 0xd7, 0x08, 0x44, 0x81, 0xc4, 0xe0, 0xe7, 0x08, 0x44,
+    0x71, 0xc4, 0x4a, 0xb9, 0x08, 0x44, 0x61, 0xc2, 0x01, 0x7f, 0x08, 0x44,
+    0x31, 0xc4, 0xe3, 0x27, 0x08, 0x44, 0x11, 0xc5, 0xa5, 0xfd, 0x08, 0x44,
+    0x00, 0xc3, 0x16, 0x5a, 0x08, 0x44, 0xb9, 0xc4, 0x36, 0xb5, 0x08, 0x44,
+    0x08, 0xc2, 0x00, 0x8e, 0x08, 0x44, 0x50, 0x49, 0x01, 0xaa, 0xc2, 0x89,
+    0xbd, 0xcc, 0x82, 0x35, 0x01, 0x0e, 0xb9, 0x03, 0xc2, 0x89, 0xcf, 0xcb,
+    0x01, 0xfc, 0x01, 0x58, 0x01, 0xcb, 0x94, 0x22, 0x01, 0x58, 0x41, 0xd5,
+    0x01, 0x92, 0x01, 0x5b, 0x3b, 0x02, 0x89, 0xde, 0xd0, 0x5b, 0xc2, 0x0f,
+    0xc2, 0xa8, 0x03, 0xc2, 0x89, 0xe4, 0xcc, 0x82, 0x35, 0x01, 0x0e, 0xb1,
+    0x49, 0x01, 0xaa, 0xc2, 0x89, 0xf3, 0xcb, 0x01, 0xfc, 0x01, 0x58, 0x09,
+    0xcb, 0x94, 0x22, 0x01, 0x58, 0x49, 0xd5, 0x01, 0x92, 0x01, 0x5b, 0x33,
+    0x02, 0x8a, 0x05, 0xd0, 0x5b, 0xc2, 0x0f, 0xc2, 0xa0, 0x49, 0x53, 0xa9,
+    0xc2, 0x8a, 0x0b, 0x43, 0x00, 0xe3, 0xc2, 0x8a, 0x17, 0xd0, 0x5f, 0x92,
+    0x05, 0x41, 0xb9, 0xca, 0xa6, 0xc0, 0x05, 0x41, 0xc0, 0xe0, 0x0c, 0x07,
+    0x01, 0x3d, 0x78, 0xd7, 0x27, 0xb9, 0x01, 0x17, 0x19, 0xd4, 0x3c, 0x50,
+    0x01, 0x17, 0x10, 0xc9, 0x2d, 0xd0, 0x01, 0x14, 0x29, 0xc7, 0x3a, 0x20,
+    0x01, 0x14, 0x20, 0xc2, 0x00, 0xdb, 0x0f, 0x08, 0xf1, 0x83, 0x0f, 0x08,
+    0xe0, 0xc2, 0x8d, 0x8f, 0x0f, 0x08, 0x99, 0xc2, 0x0d, 0xf6, 0x0f, 0x08,
+    0x69, 0x83, 0x0f, 0x08, 0x10, 0x84, 0x0d, 0x97, 0xd9, 0x83, 0x0d, 0x97,
+    0xd1, 0xa6, 0x0d, 0x97, 0xc9, 0xa5, 0x0d, 0x97, 0xc1, 0xa4, 0x0d, 0x97,
+    0xb9, 0xa3, 0x0d, 0x97, 0xb1, 0xa2, 0x0d, 0x97, 0xa9, 0xa1, 0x0d, 0x97,
+    0xa1, 0xa0, 0x0d, 0x97, 0x99, 0x9f, 0x0d, 0x97, 0x91, 0x9e, 0x0d, 0x97,
+    0x89, 0x9d, 0x0d, 0x97, 0x80, 0x88, 0x0d, 0x97, 0x79, 0x87, 0x0d, 0x97,
+    0x71, 0x86, 0x0d, 0x97, 0x69, 0x83, 0x0d, 0x97, 0x51, 0xa6, 0x0d, 0x97,
+    0x49, 0xa2, 0x0d, 0x97, 0x29, 0x85, 0x0d, 0x97, 0x61, 0x84, 0x0d, 0x97,
+    0x59, 0xa5, 0x0d, 0x97, 0x41, 0xa4, 0x0d, 0x97, 0x39, 0xa3, 0x0d, 0x97,
+    0x31, 0xa1, 0x0d, 0x97, 0x21, 0xa0, 0x0d, 0x97, 0x19, 0x9f, 0x0d, 0x97,
+    0x11, 0x9e, 0x0d, 0x97, 0x09, 0x9d, 0x0d, 0x97, 0x00, 0x83, 0x0d, 0x95,
+    0xd1, 0x88, 0x0d, 0x95, 0xf9, 0x87, 0x0d, 0x95, 0xf1, 0xa6, 0x0d, 0x95,
+    0xc9, 0xa5, 0x0d, 0x95, 0xc1, 0xa4, 0x0d, 0x95, 0xb9, 0xa3, 0x0d, 0x95,
+    0xb1, 0xa2, 0x0d, 0x95, 0xa9, 0xa1, 0x0d, 0x95, 0xa1, 0xa0, 0x0d, 0x95,
+    0x99, 0x9f, 0x0d, 0x95, 0x91, 0x9e, 0x0d, 0x95, 0x89, 0x9d, 0x0d, 0x95,
+    0x81, 0x84, 0x0d, 0x95, 0xd9, 0x85, 0x0d, 0x95, 0xe1, 0x86, 0x0d, 0x95,
+    0xe8, 0x83, 0x0d, 0x94, 0xd1, 0xa6, 0x0d, 0x94, 0xc9, 0xa5, 0x0d, 0x94,
+    0xc1, 0xa4, 0x0d, 0x94, 0xb9, 0xa3, 0x0d, 0x94, 0xb1, 0xa2, 0x0d, 0x94,
+    0xa9, 0xa1, 0x0d, 0x94, 0xa1, 0xa0, 0x0d, 0x94, 0x99, 0x9f, 0x0d, 0x94,
+    0x91, 0x9e, 0x0d, 0x94, 0x89, 0x9d, 0x0d, 0x94, 0x81, 0x88, 0x0d, 0x94,
+    0xf9, 0x87, 0x0d, 0x94, 0xf1, 0x86, 0x0d, 0x94, 0xe9, 0x85, 0x0d, 0x94,
+    0xe1, 0x84, 0x0d, 0x94, 0xd8, 0x88, 0x0d, 0x94, 0x79, 0x87, 0x0d, 0x94,
+    0x71, 0x86, 0x0d, 0x94, 0x69, 0x85, 0x0d, 0x94, 0x61, 0x84, 0x0d, 0x94,
+    0x59, 0x83, 0x0d, 0x94, 0x51, 0xa6, 0x0d, 0x94, 0x49, 0xa5, 0x0d, 0x94,
+    0x41, 0xa4, 0x0d, 0x94, 0x39, 0xa3, 0x0d, 0x94, 0x31, 0xa2, 0x0d, 0x94,
+    0x29, 0xa1, 0x0d, 0x94, 0x21, 0xa0, 0x0d, 0x94, 0x19, 0x9f, 0x0d, 0x94,
+    0x11, 0x9e, 0x0d, 0x94, 0x09, 0x9d, 0x0d, 0x94, 0x00, 0x88, 0x0d, 0x93,
+    0xf9, 0x87, 0x0d, 0x93, 0xf1, 0x86, 0x0d, 0x93, 0xe9, 0x85, 0x0d, 0x93,
+    0xe1, 0x84, 0x0d, 0x93, 0xd9, 0x83, 0x0d, 0x93, 0xd1, 0xa6, 0x0d, 0x93,
+    0xc9, 0xa5, 0x0d, 0x93, 0xc1, 0xa4, 0x0d, 0x93, 0xb9, 0xa3, 0x0d, 0x93,
+    0xb1, 0xa2, 0x0d, 0x93, 0xa9, 0xa1, 0x0d, 0x93, 0xa1, 0xa0, 0x0d, 0x93,
+    0x99, 0x9f, 0x0d, 0x93, 0x91, 0x9e, 0x0d, 0x93, 0x89, 0x9d, 0x0d, 0x93,
+    0x80, 0x88, 0x0d, 0x93, 0x79, 0x87, 0x0d, 0x93, 0x71, 0x86, 0x0d, 0x93,
+    0x69, 0x85, 0x0d, 0x93, 0x61, 0x84, 0x0d, 0x93, 0x59, 0x83, 0x0d, 0x93,
+    0x51, 0xa6, 0x0d, 0x93, 0x49, 0xa5, 0x0d, 0x93, 0x41, 0xa4, 0x0d, 0x93,
+    0x39, 0xa3, 0x0d, 0x93, 0x31, 0xa2, 0x0d, 0x93, 0x29, 0xa1, 0x0d, 0x93,
+    0x21, 0xa0, 0x0d, 0x93, 0x19, 0x9f, 0x0d, 0x93, 0x11, 0x9e, 0x0d, 0x93,
+    0x09, 0x9d, 0x0d, 0x93, 0x00, 0x88, 0x0d, 0x92, 0xf9, 0x87, 0x0d, 0x92,
+    0xf1, 0x86, 0x0d, 0x92, 0xe9, 0x85, 0x0d, 0x92, 0xe1, 0x84, 0x0d, 0x92,
+    0xd9, 0x83, 0x0d, 0x92, 0xd1, 0xa6, 0x0d, 0x92, 0xc9, 0xa5, 0x0d, 0x92,
+    0xc1, 0xa4, 0x0d, 0x92, 0xb9, 0xa3, 0x0d, 0x92, 0xb1, 0xa2, 0x0d, 0x92,
+    0xa9, 0xa1, 0x0d, 0x92, 0xa1, 0xa0, 0x0d, 0x92, 0x99, 0x9f, 0x0d, 0x92,
+    0x91, 0x9e, 0x0d, 0x92, 0x89, 0x9d, 0x0d, 0x92, 0x80, 0x88, 0x0d, 0x92,
+    0x79, 0x87, 0x0d, 0x92, 0x71, 0x86, 0x0d, 0x92, 0x69, 0x85, 0x0d, 0x92,
+    0x61, 0x84, 0x0d, 0x92, 0x59, 0x83, 0x0d, 0x92, 0x51, 0xa6, 0x0d, 0x92,
+    0x49, 0xa5, 0x0d, 0x92, 0x41, 0xa4, 0x0d, 0x92, 0x39, 0xa3, 0x0d, 0x92,
+    0x31, 0xa2, 0x0d, 0x92, 0x29, 0xa1, 0x0d, 0x92, 0x21, 0xa0, 0x0d, 0x92,
+    0x19, 0x9f, 0x0d, 0x92, 0x11, 0x9e, 0x0d, 0x92, 0x09, 0x9d, 0x0d, 0x92,
+    0x00, 0x88, 0x0d, 0x91, 0xf9, 0x87, 0x0d, 0x91, 0xf1, 0x86, 0x0d, 0x91,
+    0xe9, 0x85, 0x0d, 0x91, 0xe1, 0x84, 0x0d, 0x91, 0xd9, 0x83, 0x0d, 0x91,
+    0xd1, 0xa6, 0x0d, 0x91, 0xc9, 0xa5, 0x0d, 0x91, 0xc1, 0xa4, 0x0d, 0x91,
+    0xb9, 0xa3, 0x0d, 0x91, 0xb1, 0xa2, 0x0d, 0x91, 0xa9, 0xa1, 0x0d, 0x91,
+    0xa1, 0xa0, 0x0d, 0x91, 0x99, 0x9f, 0x0d, 0x91, 0x91, 0x9e, 0x0d, 0x91,
+    0x89, 0x9d, 0x0d, 0x91, 0x80, 0x88, 0x0d, 0x91, 0x79, 0x87, 0x0d, 0x91,
+    0x71, 0x86, 0x0d, 0x91, 0x69, 0x85, 0x0d, 0x91, 0x61, 0x84, 0x0d, 0x91,
+    0x59, 0x83, 0x0d, 0x91, 0x51, 0xa6, 0x0d, 0x91, 0x49, 0xa5, 0x0d, 0x91,
+    0x41, 0xa4, 0x0d, 0x91, 0x39, 0xa3, 0x0d, 0x91, 0x31, 0xa2, 0x0d, 0x91,
+    0x29, 0xa1, 0x0d, 0x91, 0x21, 0xa0, 0x0d, 0x91, 0x19, 0x9f, 0x0d, 0x91,
+    0x11, 0x9e, 0x0d, 0x91, 0x09, 0x9d, 0x0d, 0x91, 0x00, 0x88, 0x0d, 0x90,
+    0xf9, 0x87, 0x0d, 0x90, 0xf1, 0x86, 0x0d, 0x90, 0xe9, 0x85, 0x0d, 0x90,
+    0xe1, 0x84, 0x0d, 0x90, 0xd9, 0x83, 0x0d, 0x90, 0xd1, 0xa6, 0x0d, 0x90,
+    0xc9, 0xa5, 0x0d, 0x90, 0xc1, 0xa4, 0x0d, 0x90, 0xb9, 0xa3, 0x0d, 0x90,
+    0xb1, 0xa2, 0x0d, 0x90, 0xa9, 0xa1, 0x0d, 0x90, 0xa1, 0xa0, 0x0d, 0x90,
+    0x99, 0x9f, 0x0d, 0x90, 0x91, 0x9e, 0x0d, 0x90, 0x89, 0x9d, 0x0d, 0x90,
+    0x80, 0x88, 0x0d, 0x90, 0x79, 0x87, 0x0d, 0x90, 0x71, 0x86, 0x0d, 0x90,
+    0x69, 0x85, 0x0d, 0x90, 0x61, 0x84, 0x0d, 0x90, 0x59, 0x83, 0x0d, 0x90,
+    0x51, 0xa6, 0x0d, 0x90, 0x49, 0xa5, 0x0d, 0x90, 0x41, 0xa4, 0x0d, 0x90,
+    0x39, 0xa3, 0x0d, 0x90, 0x31, 0xa2, 0x0d, 0x90, 0x29, 0xa1, 0x0d, 0x90,
+    0x21, 0xa0, 0x0d, 0x90, 0x19, 0x9f, 0x0d, 0x90, 0x11, 0x9e, 0x0d, 0x90,
+    0x09, 0x9d, 0x0d, 0x90, 0x00, 0x88, 0x0d, 0x96, 0xf9, 0x87, 0x0d, 0x96,
+    0xf1, 0x86, 0x0d, 0x96, 0xe9, 0x85, 0x0d, 0x96, 0xe1, 0x84, 0x0d, 0x96,
+    0xd9, 0x83, 0x0d, 0x96, 0xd1, 0xa6, 0x0d, 0x96, 0xc9, 0xa5, 0x0d, 0x96,
+    0xc1, 0xa4, 0x0d, 0x96, 0xb9, 0xa3, 0x0d, 0x96, 0xb1, 0xa2, 0x0d, 0x96,
+    0xa9, 0xa1, 0x0d, 0x96, 0xa1, 0xa0, 0x0d, 0x96, 0x99, 0x9f, 0x0d, 0x96,
+    0x91, 0x9e, 0x0d, 0x96, 0x89, 0x9d, 0x0d, 0x96, 0x80, 0x88, 0x0d, 0x96,
+    0x79, 0x87, 0x0d, 0x96, 0x71, 0x86, 0x0d, 0x96, 0x69, 0x85, 0x0d, 0x96,
+    0x61, 0x84, 0x0d, 0x96, 0x59, 0x83, 0x0d, 0x96, 0x51, 0xa6, 0x0d, 0x96,
+    0x49, 0xa5, 0x0d, 0x96, 0x41, 0xa4, 0x0d, 0x96, 0x39, 0xa3, 0x0d, 0x96,
+    0x31, 0xa2, 0x0d, 0x96, 0x29, 0xa1, 0x0d, 0x96, 0x21, 0xa0, 0x0d, 0x96,
+    0x19, 0x9f, 0x0d, 0x96, 0x11, 0x9e, 0x0d, 0x96, 0x09, 0x9d, 0x0d, 0x96,
+    0x00, 0x88, 0x0d, 0x95, 0x79, 0x87, 0x0d, 0x95, 0x71, 0x86, 0x0d, 0x95,
+    0x69, 0x85, 0x0d, 0x95, 0x61, 0x84, 0x0d, 0x95, 0x59, 0x83, 0x0d, 0x95,
+    0x51, 0xa6, 0x0d, 0x95, 0x49, 0xa5, 0x0d, 0x95, 0x41, 0xa4, 0x0d, 0x95,
+    0x39, 0xa3, 0x0d, 0x95, 0x31, 0xa2, 0x0d, 0x95, 0x29, 0xa1, 0x0d, 0x95,
+    0x21, 0xa0, 0x0d, 0x95, 0x19, 0x9f, 0x0d, 0x95, 0x11, 0x9e, 0x0d, 0x95,
+    0x09, 0x9d, 0x0d, 0x95, 0x00, 0x88, 0x0d, 0x8f, 0xf9, 0x87, 0x0d, 0x8f,
+    0xf1, 0x86, 0x0d, 0x8f, 0xe9, 0x85, 0x0d, 0x8f, 0xe1, 0x84, 0x0d, 0x8f,
+    0xd9, 0x83, 0x0d, 0x8f, 0xd1, 0xa6, 0x0d, 0x8f, 0xc9, 0xa5, 0x0d, 0x8f,
+    0xc1, 0xa4, 0x0d, 0x8f, 0xb9, 0xa3, 0x0d, 0x8f, 0xb1, 0xa2, 0x0d, 0x8f,
+    0xa9, 0xa1, 0x0d, 0x8f, 0xa1, 0xa0, 0x0d, 0x8f, 0x99, 0x9f, 0x0d, 0x8f,
+    0x91, 0x9e, 0x0d, 0x8f, 0x89, 0x9d, 0x0d, 0x8f, 0x80, 0x88, 0x0d, 0x8f,
+    0x79, 0x87, 0x0d, 0x8f, 0x71, 0x86, 0x0d, 0x8f, 0x69, 0x85, 0x0d, 0x8f,
+    0x61, 0x84, 0x0d, 0x8f, 0x59, 0x83, 0x0d, 0x8f, 0x51, 0xa6, 0x0d, 0x8f,
+    0x49, 0xa5, 0x0d, 0x8f, 0x41, 0xa4, 0x0d, 0x8f, 0x39, 0xa3, 0x0d, 0x8f,
+    0x31, 0xa2, 0x0d, 0x8f, 0x29, 0xa1, 0x0d, 0x8f, 0x21, 0xa0, 0x0d, 0x8f,
+    0x19, 0x9f, 0x0d, 0x8f, 0x11, 0x9e, 0x0d, 0x8f, 0x09, 0x9d, 0x0d, 0x8f,
+    0x00, 0x88, 0x0d, 0x8e, 0xf9, 0x87, 0x0d, 0x8e, 0xf1, 0x86, 0x0d, 0x8e,
+    0xe9, 0x85, 0x0d, 0x8e, 0xe1, 0x84, 0x0d, 0x8e, 0xd9, 0x83, 0x0d, 0x8e,
+    0xd1, 0xa6, 0x0d, 0x8e, 0xc9, 0xa5, 0x0d, 0x8e, 0xc1, 0xa4, 0x0d, 0x8e,
+    0xb9, 0xa3, 0x0d, 0x8e, 0xb1, 0xa2, 0x0d, 0x8e, 0xa9, 0xa1, 0x0d, 0x8e,
+    0xa1, 0xa0, 0x0d, 0x8e, 0x99, 0x9f, 0x0d, 0x8e, 0x91, 0x9e, 0x0d, 0x8e,
+    0x89, 0x9d, 0x0d, 0x8e, 0x80, 0x88, 0x0d, 0x8e, 0x79, 0x87, 0x0d, 0x8e,
+    0x71, 0x86, 0x0d, 0x8e, 0x69, 0x85, 0x0d, 0x8e, 0x61, 0x84, 0x0d, 0x8e,
+    0x59, 0x83, 0x0d, 0x8e, 0x51, 0xa6, 0x0d, 0x8e, 0x49, 0xa5, 0x0d, 0x8e,
+    0x41, 0xa4, 0x0d, 0x8e, 0x39, 0xa3, 0x0d, 0x8e, 0x31, 0xa2, 0x0d, 0x8e,
+    0x29, 0xa1, 0x0d, 0x8e, 0x21, 0xa0, 0x0d, 0x8e, 0x19, 0x9f, 0x0d, 0x8e,
+    0x11, 0x9e, 0x0d, 0x8e, 0x09, 0x9d, 0x0d, 0x8e, 0x00, 0x88, 0x0d, 0x8d,
+    0xf9, 0x87, 0x0d, 0x8d, 0xf1, 0x86, 0x0d, 0x8d, 0xe9, 0x85, 0x0d, 0x8d,
+    0xe1, 0x84, 0x0d, 0x8d, 0xd9, 0x83, 0x0d, 0x8d, 0xd1, 0xa6, 0x0d, 0x8d,
+    0xc9, 0xa5, 0x0d, 0x8d, 0xc1, 0xa4, 0x0d, 0x8d, 0xb9, 0xa3, 0x0d, 0x8d,
+    0xb1, 0xa2, 0x0d, 0x8d, 0xa9, 0xa1, 0x0d, 0x8d, 0xa1, 0xa0, 0x0d, 0x8d,
+    0x99, 0x9f, 0x0d, 0x8d, 0x91, 0x9e, 0x0d, 0x8d, 0x89, 0x9d, 0x0d, 0x8d,
+    0x80, 0x88, 0x0d, 0x8d, 0x79, 0x87, 0x0d, 0x8d, 0x71, 0x86, 0x0d, 0x8d,
+    0x69, 0x85, 0x0d, 0x8d, 0x61, 0x84, 0x0d, 0x8d, 0x59, 0x83, 0x0d, 0x8d,
+    0x51, 0xa6, 0x0d, 0x8d, 0x49, 0xa5, 0x0d, 0x8d, 0x41, 0xa4, 0x0d, 0x8d,
+    0x39, 0xa3, 0x0d, 0x8d, 0x31, 0xa2, 0x0d, 0x8d, 0x29, 0xa1, 0x0d, 0x8d,
+    0x21, 0xa0, 0x0d, 0x8d, 0x19, 0x9f, 0x0d, 0x8d, 0x11, 0x9e, 0x0d, 0x8d,
+    0x09, 0x9d, 0x0d, 0x8d, 0x00, 0x88, 0x0d, 0x8c, 0xf9, 0x87, 0x0d, 0x8c,
+    0xf1, 0x86, 0x0d, 0x8c, 0xe9, 0x85, 0x0d, 0x8c, 0xe1, 0x84, 0x0d, 0x8c,
+    0xd9, 0x83, 0x0d, 0x8c, 0xd1, 0xa6, 0x0d, 0x8c, 0xc9, 0xa5, 0x0d, 0x8c,
+    0xc1, 0xa4, 0x0d, 0x8c, 0xb9, 0xa3, 0x0d, 0x8c, 0xb1, 0xa2, 0x0d, 0x8c,
+    0xa9, 0xa1, 0x0d, 0x8c, 0xa1, 0xa0, 0x0d, 0x8c, 0x99, 0x9f, 0x0d, 0x8c,
+    0x91, 0x9e, 0x0d, 0x8c, 0x89, 0x9d, 0x0d, 0x8c, 0x80, 0x88, 0x0d, 0x8c,
+    0x79, 0x87, 0x0d, 0x8c, 0x71, 0x86, 0x0d, 0x8c, 0x69, 0x85, 0x0d, 0x8c,
+    0x61, 0x84, 0x0d, 0x8c, 0x59, 0x83, 0x0d, 0x8c, 0x51, 0xa6, 0x0d, 0x8c,
+    0x49, 0xa5, 0x0d, 0x8c, 0x41, 0xa4, 0x0d, 0x8c, 0x39, 0xa3, 0x0d, 0x8c,
+    0x31, 0xa2, 0x0d, 0x8c, 0x29, 0xa1, 0x0d, 0x8c, 0x21, 0xa0, 0x0d, 0x8c,
+    0x19, 0x9f, 0x0d, 0x8c, 0x11, 0x9e, 0x0d, 0x8c, 0x09, 0x9d, 0x0d, 0x8c,
+    0x00, 0x88, 0x0d, 0x8b, 0xf9, 0x87, 0x0d, 0x8b, 0xf1, 0x86, 0x0d, 0x8b,
+    0xe9, 0x85, 0x0d, 0x8b, 0xe1, 0x84, 0x0d, 0x8b, 0xd9, 0x83, 0x0d, 0x8b,
+    0xd1, 0xa6, 0x0d, 0x8b, 0xc9, 0xa5, 0x0d, 0x8b, 0xc1, 0xa4, 0x0d, 0x8b,
+    0xb9, 0xa3, 0x0d, 0x8b, 0xb1, 0xa2, 0x0d, 0x8b, 0xa9, 0xa1, 0x0d, 0x8b,
+    0xa1, 0xa0, 0x0d, 0x8b, 0x99, 0x9f, 0x0d, 0x8b, 0x91, 0x9e, 0x0d, 0x8b,
+    0x89, 0x9d, 0x0d, 0x8b, 0x80, 0xcd, 0x79, 0x1a, 0x01, 0x24, 0xd9, 0xcd,
+    0x7d, 0xac, 0x01, 0x24, 0x98, 0xcf, 0x69, 0x36, 0x01, 0x24, 0xb9, 0xc2,
+    0x00, 0xbc, 0x00, 0x01, 0x18, 0xc2, 0x00, 0x39, 0x00, 0x3f, 0x51, 0xc3,
+    0x1c, 0x63, 0x00, 0x3f, 0x49, 0xc2, 0x25, 0x3b, 0x00, 0x3f, 0x40, 0xc7,
+    0xc3, 0xf4, 0x00, 0x3f, 0x38, 0xc7, 0xc3, 0xf4, 0x00, 0x3f, 0x00, 0xd0,
+    0x5b, 0xa2, 0x01, 0x4d, 0xa1, 0xd1, 0x02, 0x56, 0x01, 0x4d, 0x99, 0xd2,
+    0x4b, 0xdd, 0x01, 0x4d, 0x91, 0xc7, 0x80, 0x70, 0x01, 0x4d, 0x88, 0x43,
+    0x00, 0xaf, 0x42, 0x8a, 0x23, 0x03, 0xc2, 0x8a, 0x2d, 0xcd, 0x79, 0xa9,
+    0x0f, 0x98, 0x68, 0xa5, 0x09, 0x87, 0xe9, 0xa4, 0x09, 0x87, 0xe1, 0xa3,
+    0x09, 0x87, 0xd9, 0xa1, 0x09, 0x87, 0xcb, 0x02, 0x8a, 0x39, 0xa0, 0x09,
+    0x87, 0xc1, 0x9f, 0x09, 0x87, 0xb9, 0x9e, 0x09, 0x87, 0xb1, 0x9d, 0x09,
+    0x87, 0xa8, 0xa6, 0x09, 0x87, 0xa1, 0xa5, 0x09, 0x87, 0x93, 0x02, 0x8a,
+    0x3d, 0xa4, 0x09, 0x87, 0x89, 0xa3, 0x09, 0x87, 0x81, 0xa2, 0x09, 0x87,
+    0x79, 0xa1, 0x09, 0x87, 0x71, 0xa0, 0x09, 0x87, 0x69, 0x9f, 0x09, 0x87,
+    0x61, 0x9e, 0x09, 0x87, 0x59, 0x9d, 0x09, 0x87, 0x4a, 0x02, 0x8a, 0x41,
+    0xa6, 0x09, 0x87, 0x41, 0xa5, 0x09, 0x87, 0x39, 0xa4, 0x09, 0x87, 0x2b,
+    0x02, 0x8a, 0x45, 0xa3, 0x09, 0x87, 0x1b, 0x02, 0x8a, 0x49, 0xa2, 0x09,
+    0x87, 0x11, 0xa1, 0x09, 0x87, 0x09, 0xa0, 0x09, 0x87, 0x01, 0x9f, 0x09,
+    0x86, 0xf9, 0x9e, 0x09, 0x86, 0xf1, 0x9d, 0x09, 0x86, 0xe8, 0xa6, 0x09,
+    0x86, 0xdb, 0x02, 0x8a, 0x4d, 0xa5, 0x09, 0x86, 0xcb, 0x02, 0x8a, 0x51,
+    0xa4, 0x09, 0x86, 0xc1, 0xa3, 0x09, 0x86, 0xb9, 0xa2, 0x09, 0x86, 0xb1,
+    0xa1, 0x09, 0x86, 0xa9, 0xa0, 0x09, 0x86, 0xa1, 0x9f, 0x09, 0x86, 0x99,
+    0x9e, 0x09, 0x86, 0x90, 0x83, 0x09, 0x82, 0xa8, 0x9e, 0x09, 0x94, 0xd1,
+    0x9d, 0x09, 0x94, 0xba, 0x02, 0x8a, 0x55, 0xa6, 0x09, 0x94, 0xb1, 0xa5,
+    0x09, 0x94, 0xa9, 0xa4, 0x09, 0x94, 0xa1, 0xa3, 0x09, 0x94, 0x99, 0xa2,
+    0x09, 0x94, 0x91, 0xa1, 0x09, 0x94, 0x89, 0xa0, 0x09, 0x94, 0x81, 0x9f,
+    0x09, 0x94, 0x79, 0x9e, 0x09, 0x94, 0x71, 0x9d, 0x09, 0x94, 0x68, 0xa6,
+    0x09, 0x94, 0x61, 0xa5, 0x09, 0x94, 0x59, 0xa4, 0x09, 0x94, 0x51, 0xa3,
+    0x09, 0x94, 0x2b, 0x02, 0x8a, 0x5d, 0xa2, 0x09, 0x94, 0x21, 0xa1, 0x09,
+    0x94, 0x19, 0xa0, 0x09, 0x94, 0x0b, 0x02, 0x8a, 0x6d, 0x9f, 0x09, 0x94,
+    0x01, 0x9e, 0x09, 0x93, 0xf9, 0x9d, 0x09, 0x93, 0xea, 0x02, 0x8a, 0x71,
+    0xa6, 0x09, 0x93, 0xdb, 0x02, 0x8a, 0x75, 0xa5, 0x09, 0x93, 0xd1, 0xa4,
+    0x09, 0x93, 0xc9, 0xa3, 0x09, 0x93, 0xc1, 0xa2, 0x09, 0x93, 0xb3, 0x02,
+    0x8a, 0x79, 0xa1, 0x09, 0x93, 0xa3, 0x02, 0x8a, 0x7d, 0xa0, 0x09, 0x93,
+    0x99, 0x9f, 0x09, 0x93, 0x91, 0x9e, 0x09, 0x93, 0x89, 0x9d, 0x09, 0x93,
+    0x7a, 0x02, 0x8a, 0x81, 0xa6, 0x09, 0x93, 0x6b, 0x02, 0x8a, 0x85, 0xa5,
+    0x09, 0x93, 0x61, 0xa4, 0x09, 0x93, 0x59, 0xa3, 0x09, 0x93, 0x51, 0xa2,
+    0x09, 0x93, 0x49, 0xa1, 0x09, 0x93, 0x41, 0xa0, 0x09, 0x93, 0x39, 0x9f,
+    0x09, 0x93, 0x31, 0x9e, 0x09, 0x93, 0x29, 0x9d, 0x09, 0x93, 0x0a, 0x02,
+    0x8a, 0x89, 0xa6, 0x09, 0x93, 0x01, 0xa5, 0x09, 0x92, 0xf9, 0xa4, 0x09,
+    0x92, 0xf1, 0xa3, 0x09, 0x92, 0xbb, 0x02, 0x8a, 0x95, 0xa2, 0x09, 0x92,
+    0xab, 0x02, 0x8a, 0xad, 0xa1, 0x09, 0x92, 0xa1, 0xa0, 0x09, 0x92, 0x99,
+    0x9f, 0x09, 0x92, 0x91, 0x9e, 0x09, 0x92, 0x82, 0x02, 0x8a, 0xb1, 0xc3,
+    0x02, 0x39, 0x09, 0xa1, 0xa9, 0xc5, 0xdd, 0xd0, 0x09, 0xa1, 0x98, 0xc3,
+    0x02, 0x39, 0x09, 0xa1, 0xa1, 0xc5, 0xdd, 0xd0, 0x09, 0xa1, 0x90, 0xa2,
+    0x09, 0x8c, 0xd1, 0xa1, 0x09, 0x8c, 0xc9, 0xa0, 0x09, 0x8c, 0xc1, 0x9f,
+    0x09, 0x8c, 0xb9, 0x9e, 0x09, 0x8c, 0xab, 0x02, 0x8a, 0xb5, 0x9d, 0x09,
+    0x8c, 0x9a, 0x02, 0x8a, 0xb9, 0xa6, 0x09, 0x8c, 0x8b, 0x02, 0x8a, 0xbd,
+    0xa5, 0x09, 0x8c, 0x81, 0xa4, 0x09, 0x8c, 0x79, 0xa3, 0x09, 0x8c, 0x71,
+    0xa2, 0x09, 0x8c, 0x63, 0x02, 0x8a, 0xc1, 0xa1, 0x09, 0x8c, 0x59, 0xa0,
+    0x09, 0x8c, 0x51, 0x9f, 0x09, 0x8c, 0x49, 0x9e, 0x09, 0x8c, 0x40, 0x83,
+    0x09, 0x8c, 0x28, 0x83, 0x09, 0x9d, 0x70, 0xa6, 0x09, 0x9d, 0x61, 0xa5,
+    0x09, 0x9d, 0x59, 0xa4, 0x09, 0x9d, 0x4b, 0x02, 0x8a, 0xc5, 0xa3, 0x09,
+    0x9d, 0x41, 0xa2, 0x09, 0x9d, 0x39, 0xa1, 0x09, 0x9d, 0x31, 0xa0, 0x09,
+    0x9d, 0x23, 0x02, 0x8a, 0xc9, 0x9f, 0x09, 0x9d, 0x19, 0x9e, 0x09, 0x9d,
+    0x0b, 0x02, 0x8a, 0xcd, 0x9d, 0x09, 0x9c, 0xfa, 0x02, 0x8a, 0xd1, 0xa6,
+    0x09, 0x9c, 0xeb, 0x02, 0x8a, 0xd5, 0xa5, 0x09, 0x9c, 0xdb, 0x02, 0x8a,
+    0xd9, 0xa4, 0x09, 0x9c, 0xd1, 0xa3, 0x09, 0x9c, 0xc9, 0xa2, 0x09, 0x9c,
+    0xc1, 0xa1, 0x09, 0x9c, 0xb9, 0xa0, 0x09, 0x9c, 0xab, 0x02, 0x8a, 0xdd,
+    0x9f, 0x09, 0x9c, 0xa1, 0x9e, 0x09, 0x9c, 0x99, 0x9d, 0x09, 0x9c, 0x32,
+    0x02, 0x8a, 0xe1, 0xa6, 0x09, 0x9c, 0x29, 0xa5, 0x09, 0x9c, 0x21, 0xa4,
+    0x09, 0x9c, 0x19, 0xa3, 0x09, 0x9c, 0x11, 0xa2, 0x09, 0x9c, 0x09, 0xa1,
+    0x09, 0x9c, 0x01, 0xa0, 0x09, 0x9b, 0xf9, 0x9f, 0x09, 0x9b, 0xe3, 0x02,
+    0x8b, 0x11, 0x9e, 0x09, 0x9b, 0xc3, 0x02, 0x8b, 0x19, 0x9d, 0x09, 0x9b,
+    0xb8, 0xa6, 0x09, 0x9b, 0xb1, 0xa5, 0x09, 0x9b, 0xa9, 0xa4, 0x09, 0x9b,
+    0x93, 0x02, 0x8b, 0x25, 0xa3, 0x09, 0x9b, 0x89, 0xa2, 0x09, 0x9b, 0x81,
+    0xa1, 0x09, 0x9b, 0x79, 0xa0, 0x09, 0x9b, 0x71, 0x9f, 0x09, 0x9b, 0x63,
+    0x02, 0x8b, 0x2d, 0x9e, 0x09, 0x9b, 0x12, 0x02, 0x8b, 0x31, 0x9f, 0x09,
+    0xa1, 0x71, 0x9e, 0x09, 0xa1, 0x69, 0x9d, 0x09, 0xa1, 0x60, 0xa6, 0x09,
+    0xa1, 0x59, 0xa5, 0x09, 0xa1, 0x51, 0xa4, 0x09, 0xa1, 0x49, 0xa3, 0x09,
+    0xa1, 0x41, 0xa2, 0x09, 0xa1, 0x39, 0xa1, 0x09, 0xa1, 0x31, 0xa0, 0x09,
+    0xa1, 0x29, 0x9f, 0x09, 0xa1, 0x21, 0x9e, 0x09, 0xa1, 0x19, 0x9d, 0x09,
+    0xa1, 0x10, 0xa6, 0x09, 0xa1, 0x09, 0xa5, 0x09, 0xa1, 0x01, 0xa4, 0x09,
+    0xa0, 0xf9, 0xa3, 0x09, 0xa0, 0xf1, 0xa2, 0x09, 0xa0, 0xe9, 0xa1, 0x09,
+    0xa0, 0xe1, 0xa0, 0x09, 0xa0, 0xd9, 0x9f, 0x09, 0xa0, 0xd1, 0x9e, 0x09,
+    0xa0, 0xc9, 0x9d, 0x09, 0xa0, 0xc0, 0xa6, 0x09, 0xa0, 0xb9, 0xa5, 0x09,
+    0xa0, 0xb1, 0xa4, 0x09, 0xa0, 0x9b, 0x02, 0x8b, 0x55, 0xa3, 0x09, 0xa0,
+    0x91, 0xa2, 0x09, 0xa0, 0x89, 0xa1, 0x09, 0xa0, 0x81, 0xa0, 0x09, 0xa0,
+    0x79, 0x9f, 0x09, 0xa0, 0x71, 0x9e, 0x09, 0xa0, 0x68, 0xa6, 0x09, 0x82,
+    0x71, 0xa5, 0x09, 0x82, 0x69, 0xa4, 0x09, 0x82, 0x61, 0xa3, 0x09, 0x82,
+    0x59, 0xa2, 0x09, 0x82, 0x51, 0xa1, 0x09, 0x82, 0x49, 0xa0, 0x09, 0x82,
+    0x41, 0x9f, 0x09, 0x82, 0x39, 0x9e, 0x09, 0x82, 0x31, 0x9d, 0x09, 0x82,
+    0x28, 0xa6, 0x09, 0x82, 0x21, 0xa5, 0x09, 0x82, 0x19, 0xa4, 0x09, 0x82,
+    0x11, 0xa3, 0x09, 0x82, 0x09, 0xa2, 0x09, 0x82, 0x01, 0xa1, 0x09, 0x81,
+    0xf9, 0xa0, 0x09, 0x81, 0xf1, 0x9f, 0x09, 0x81, 0xe9, 0x9e, 0x09, 0x81,
+    0xe1, 0x9d, 0x09, 0x81, 0xd8, 0xa6, 0x09, 0x81, 0xd1, 0xa5, 0x09, 0x81,
+    0xc9, 0xa4, 0x09, 0x81, 0xc1, 0xa3, 0x09, 0x81, 0xb9, 0xa2, 0x09, 0x81,
+    0xab, 0x02, 0x8b, 0x5d, 0xa1, 0x09, 0x81, 0xa1, 0xa0, 0x09, 0x81, 0x93,
+    0x02, 0x8b, 0x61, 0x9f, 0x09, 0x81, 0x83, 0x02, 0x8b, 0x65, 0x9e, 0x09,
+    0x81, 0x79, 0x9d, 0x09, 0x81, 0x6a, 0x02, 0x8b, 0x69, 0xa6, 0x09, 0x81,
+    0x61, 0xa5, 0x09, 0x81, 0x59, 0xa4, 0x09, 0x81, 0x51, 0xa3, 0x09, 0x81,
+    0x49, 0xa2, 0x09, 0x81, 0x41, 0xa1, 0x09, 0x81, 0x39, 0xa0, 0x09, 0x81,
+    0x31, 0x9f, 0x09, 0x81, 0x23, 0x02, 0x8b, 0x6d, 0x9e, 0x09, 0x81, 0x19,
+    0x9d, 0x09, 0x81, 0x10, 0xa6, 0x09, 0x81, 0x09, 0xa5, 0x09, 0x81, 0x01,
+    0xa4, 0x09, 0x80, 0xf9, 0xa3, 0x09, 0x80, 0xf1, 0xa2, 0x09, 0x80, 0xe9,
+    0xa1, 0x09, 0x80, 0xe1, 0xa0, 0x09, 0x80, 0xd9, 0x9f, 0x09, 0x80, 0xd1,
+    0x9e, 0x09, 0x80, 0xc9, 0x9d, 0x09, 0x80, 0xc0, 0xa6, 0x09, 0x80, 0xb9,
+    0xa5, 0x09, 0x80, 0xb1, 0xa4, 0x09, 0x80, 0xa3, 0x02, 0x8b, 0x71, 0xa3,
+    0x09, 0x80, 0x99, 0xa2, 0x09, 0x80, 0x91, 0xa1, 0x09, 0x80, 0x83, 0x02,
+    0x8b, 0x75, 0xa0, 0x09, 0x80, 0x79, 0x9f, 0x09, 0x80, 0x71, 0x9e, 0x09,
+    0x80, 0x69, 0x9d, 0x09, 0x80, 0x60, 0xa6, 0x09, 0x80, 0x59, 0xa5, 0x09,
+    0x80, 0x51, 0xa4, 0x09, 0x80, 0x49, 0xa3, 0x09, 0x80, 0x33, 0x02, 0x8b,
+    0x79, 0xa2, 0x09, 0x80, 0x23, 0x02, 0x8b, 0x81, 0xa1, 0x09, 0x80, 0x19,
+    0xa0, 0x09, 0x80, 0x11, 0x9f, 0x09, 0x80, 0x09, 0x9e, 0x09, 0x80, 0x00,
+    0x8a, 0x09, 0xa0, 0x61, 0x89, 0x09, 0xa0, 0x59, 0x88, 0x09, 0xa0, 0x51,
+    0x87, 0x09, 0xa0, 0x49, 0x86, 0x09, 0xa0, 0x41, 0x85, 0x09, 0xa0, 0x39,
+    0x84, 0x09, 0xa0, 0x31, 0x83, 0x09, 0xa0, 0x28, 0x8b, 0x09, 0xa0, 0x19,
+    0x8a, 0x09, 0xa0, 0x11, 0x89, 0x09, 0xa0, 0x09, 0x88, 0x09, 0xa0, 0x01,
+    0x87, 0x09, 0x9f, 0xf9, 0x86, 0x09, 0x9f, 0xf1, 0x85, 0x09, 0x9f, 0xe9,
+    0x84, 0x09, 0x9f, 0xe1, 0x83, 0x09, 0x9f, 0xd8, 0x83, 0x09, 0x9f, 0x80,
+    0x83, 0x09, 0x9f, 0x70, 0x84, 0x09, 0x9f, 0x61, 0x83, 0x09, 0x9f, 0x58,
+    0x86, 0x09, 0x9f, 0x49, 0x85, 0x09, 0x9f, 0x41, 0x84, 0x09, 0x9f, 0x39,
+    0x83, 0x09, 0x9f, 0x30, 0x83, 0x09, 0x9e, 0x68, 0x83, 0x09, 0x9e, 0x30,
+    0x83, 0x09, 0x9e, 0x20, 0x83, 0x09, 0x9e, 0x00, 0x83, 0x09, 0x9d, 0xd8,
+    0x83, 0x09, 0x9d, 0xc8, 0x83, 0x09, 0x9d, 0x90, 0x83, 0x09, 0x9a, 0xb8,
+    0x83, 0x09, 0x9a, 0x98, 0x83, 0x09, 0x9a, 0x60, 0x84, 0x09, 0x99, 0xd1,
+    0x83, 0x09, 0x99, 0xc8, 0x83, 0x09, 0x99, 0x78, 0x83, 0x09, 0x99, 0x68,
+    0x83, 0x09, 0x98, 0xe0, 0x83, 0x09, 0x98, 0xb0, 0x83, 0x09, 0x98, 0x98,
+    0x83, 0x09, 0x98, 0x88, 0x83, 0x09, 0x98, 0x78, 0x83, 0x09, 0x98, 0x50,
+    0x83, 0x09, 0x97, 0xd8, 0x84, 0x09, 0x97, 0x89, 0x83, 0x09, 0x97, 0x80,
+    0x83, 0x09, 0x97, 0x30, 0x84, 0x09, 0x97, 0x11, 0x83, 0x09, 0x97, 0x08,
+    0x83, 0x09, 0x96, 0xc0, 0x83, 0x09, 0x96, 0x98, 0x83, 0x09, 0x96, 0x18,
+    0x83, 0x09, 0x95, 0xe0, 0x84, 0x09, 0x95, 0xa1, 0x83, 0x09, 0x95, 0x98,
+    0x83, 0x09, 0x95, 0x88, 0x83, 0x09, 0x94, 0xf8, 0x83, 0x09, 0x94, 0xe0,
+    0x9f, 0x09, 0x92, 0x73, 0x02, 0x8b, 0x85, 0x9e, 0x09, 0x92, 0x69, 0x9d,
+    0x09, 0x92, 0x60, 0xa6, 0x09, 0x92, 0x59, 0xa5, 0x09, 0x92, 0x4b, 0x02,
+    0x8b, 0x89, 0xa4, 0x09, 0x92, 0x41, 0xa3, 0x09, 0x92, 0x39, 0xa2, 0x09,
+    0x92, 0x31, 0xa1, 0x09, 0x92, 0x29, 0xa0, 0x09, 0x92, 0x21, 0x9f, 0x09,
+    0x92, 0x19, 0x9e, 0x09, 0x92, 0x0b, 0x02, 0x8b, 0x8d, 0x9d, 0x09, 0x91,
+    0xfa, 0x02, 0x8b, 0x91, 0xa6, 0x09, 0x91, 0xf1, 0xa5, 0x09, 0x91, 0xe9,
+    0xa4, 0x09, 0x91, 0xe1, 0xa3, 0x09, 0x91, 0xd9, 0xa2, 0x09, 0x91, 0xd1,
+    0xa1, 0x09, 0x91, 0xc9, 0xa0, 0x09, 0x91, 0xc1, 0x9f, 0x09, 0x91, 0xb9,
+    0x9e, 0x09, 0x91, 0xb0, 0xa6, 0x09, 0x91, 0xa1, 0xa5, 0x09, 0x91, 0x99,
+    0xa4, 0x09, 0x91, 0x8b, 0x02, 0x8b, 0x95, 0xa3, 0x09, 0x91, 0x81, 0xa2,
+    0x09, 0x91, 0x79, 0xa1, 0x09, 0x91, 0x71, 0xa0, 0x09, 0x91, 0x69, 0x9f,
+    0x09, 0x91, 0x61, 0x9e, 0x09, 0x91, 0x59, 0x9d, 0x09, 0x91, 0x50, 0xa6,
+    0x09, 0x91, 0x49, 0xa5, 0x09, 0x91, 0x41, 0xa4, 0x09, 0x91, 0x39, 0xa3,
+    0x09, 0x91, 0x31, 0xa2, 0x09, 0x91, 0x23, 0x02, 0x8b, 0x99, 0xa1, 0x09,
+    0x91, 0x19, 0xa0, 0x09, 0x91, 0x11, 0x9f, 0x09, 0x91, 0x09, 0x9e, 0x09,
+    0x91, 0x00, 0x9f, 0x09, 0x90, 0xf9, 0x9e, 0x09, 0x90, 0xf1, 0x9d, 0x09,
+    0x90, 0xe8, 0xa6, 0x09, 0x90, 0xe1, 0xa5, 0x09, 0x90, 0xd9, 0xa4, 0x09,
+    0x90, 0xcb, 0x02, 0x8b, 0x9d, 0xa3, 0x09, 0x90, 0xc1, 0xa2, 0x09, 0x90,
+    0xb3, 0x02, 0x8b, 0xa1, 0xa1, 0x09, 0x90, 0xa3, 0x02, 0x8b, 0xa5, 0xa0,
+    0x09, 0x90, 0x93, 0x02, 0x8b, 0xa9, 0x9f, 0x09, 0x90, 0x89, 0x9e, 0x09,
+    0x90, 0x81, 0x9d, 0x09, 0x90, 0x78, 0xa6, 0x09, 0x90, 0x71, 0xa5, 0x09,
+    0x90, 0x69, 0xa4, 0x09, 0x90, 0x61, 0xa3, 0x09, 0x90, 0x59, 0xa2, 0x09,
+    0x90, 0x4b, 0x02, 0x8b, 0xad, 0xa1, 0x09, 0x90, 0x41, 0xa0, 0x09, 0x90,
+    0x39, 0x9f, 0x09, 0x90, 0x31, 0x9e, 0x09, 0x90, 0x29, 0x9d, 0x09, 0x90,
+    0x20, 0xa6, 0x09, 0x90, 0x19, 0xa5, 0x09, 0x90, 0x03, 0x02, 0x8b, 0xb1,
+    0xa4, 0x09, 0x8f, 0xf9, 0xa3, 0x09, 0x8f, 0xf1, 0xa2, 0x09, 0x8f, 0xe9,
+    0xa1, 0x09, 0x8f, 0xe1, 0xa0, 0x09, 0x8f, 0xd9, 0x9f, 0x09, 0x8f, 0xd1,
+    0x9e, 0x09, 0x8f, 0xc9, 0x9d, 0x09, 0x8f, 0xc0, 0xa6, 0x09, 0x8f, 0xb9,
+    0xa5, 0x09, 0x8f, 0xb1, 0xa4, 0x09, 0x8f, 0xa9, 0xa3, 0x09, 0x8f, 0xa1,
+    0xa2, 0x09, 0x8f, 0x99, 0xa1, 0x09, 0x8f, 0x91, 0xa0, 0x09, 0x8f, 0x89,
+    0x9f, 0x09, 0x8f, 0x81, 0x9e, 0x09, 0x8f, 0x78, 0x83, 0x09, 0x8f, 0x50,
+    0x84, 0x09, 0x8f, 0x11, 0x83, 0x09, 0x8f, 0x08, 0x83, 0x09, 0x8e, 0xf0,
+    0x83, 0x09, 0x8e, 0xd0, 0x83, 0x09, 0x8e, 0xa8, 0x83, 0x09, 0x8e, 0x90,
+    0x83, 0x09, 0x8e, 0x60, 0x83, 0x09, 0x8e, 0x50, 0x83, 0x09, 0x8e, 0x40,
+    0x8a, 0x09, 0x8e, 0x21, 0x89, 0x09, 0x8e, 0x19, 0x88, 0x09, 0x8e, 0x11,
+    0x87, 0x09, 0x8e, 0x09, 0x86, 0x09, 0x8e, 0x01, 0x85, 0x09, 0x8d, 0xf9,
+    0x84, 0x09, 0x8d, 0xf1, 0x83, 0x09, 0x8d, 0xe8, 0x83, 0x09, 0x8d, 0xd0,
+    0x83, 0x09, 0x8d, 0x90, 0x84, 0x09, 0x8d, 0x79, 0x83, 0x09, 0x8d, 0x70,
+    0x83, 0x09, 0x8b, 0xa8, 0x83, 0x09, 0x8b, 0x90, 0x83, 0x09, 0x8b, 0x58,
+    0x83, 0x09, 0x8b, 0x48, 0x83, 0x09, 0x8a, 0xf0, 0x83, 0x09, 0x8a, 0xb8,
+    0x83, 0x09, 0x8a, 0x68, 0x84, 0x09, 0x8a, 0x41, 0x83, 0x09, 0x8a, 0x38,
+    0x83, 0x09, 0x8a, 0x28, 0x85, 0x09, 0x89, 0xe1, 0x84, 0x09, 0x89, 0xd9,
+    0x83, 0x09, 0x89, 0xd0, 0x83, 0x09, 0x89, 0xa8, 0x83, 0x09, 0x89, 0x98,
+    0x83, 0x09, 0x89, 0x88, 0x83, 0x09, 0x89, 0x48, 0x83, 0x09, 0x89, 0x38,
+    0x83, 0x09, 0x89, 0x00, 0x83, 0x09, 0x88, 0xa8, 0x83, 0x09, 0x88, 0x60,
+    0x83, 0x09, 0x87, 0xf8, 0x8a, 0x09, 0x86, 0x89, 0x89, 0x09, 0x86, 0x81,
+    0x88, 0x09, 0x86, 0x79, 0x87, 0x09, 0x86, 0x71, 0x86, 0x09, 0x86, 0x69,
+    0x85, 0x09, 0x86, 0x61, 0x84, 0x09, 0x86, 0x59, 0x83, 0x09, 0x86, 0x50,
+    0x83, 0x09, 0x85, 0xe0, 0x83, 0x09, 0x85, 0xc8, 0x8b, 0x09, 0x85, 0xb1,
+    0x8a, 0x09, 0x85, 0xa9, 0x89, 0x09, 0x85, 0xa1, 0x88, 0x09, 0x85, 0x99,
+    0x87, 0x09, 0x85, 0x91, 0x86, 0x09, 0x85, 0x89, 0x85, 0x09, 0x85, 0x81,
+    0x84, 0x09, 0x85, 0x79, 0x83, 0x09, 0x85, 0x70, 0x83, 0x09, 0x85, 0x58,
+    0x83, 0x09, 0x85, 0x40, 0x83, 0x09, 0x84, 0xd8, 0x83, 0x09, 0x84, 0xb8,
+    0x83, 0x09, 0x84, 0x90, 0x83, 0x09, 0x83, 0xf0, 0x83, 0x09, 0x83, 0x38,
+    0x85, 0x09, 0x82, 0xf1, 0x84, 0x09, 0x82, 0xe9, 0x83, 0x09, 0x82, 0xe0,
+    0xc6, 0x02, 0xd1, 0x0f, 0xbc, 0x49, 0xc6, 0x0b, 0x09, 0x0f, 0xbc, 0x98,
+    0xc6, 0x13, 0x52, 0x0f, 0xbd, 0x71, 0xd2, 0x4d, 0x57, 0x0f, 0xbd, 0xd0,
+    0x45, 0x56, 0x42, 0x42, 0x8b, 0xb9, 0x83, 0x00, 0x95, 0x03, 0x02, 0x8b,
+    0xe9, 0x97, 0x00, 0x95, 0x09, 0x8b, 0x00, 0x95, 0x11, 0x87, 0x00, 0x95,
+    0x2b, 0x02, 0x8b, 0xed, 0x91, 0x00, 0x95, 0x33, 0x02, 0x8b, 0xf1, 0xc2,
+    0x01, 0x4a, 0x00, 0x95, 0x38, 0x83, 0x00, 0x98, 0x58, 0x87, 0x00, 0x98,
+    0x60, 0x83, 0x00, 0x98, 0x78, 0x83, 0x00, 0x98, 0x83, 0x02, 0x8b, 0xf5,
+    0x8b, 0x00, 0x98, 0x91, 0x87, 0x00, 0x98, 0xaa, 0x02, 0x8b, 0xf9, 0x83,
+    0x00, 0x98, 0xc3, 0x02, 0x8b, 0xfd, 0x97, 0x00, 0x98, 0xc9, 0x8b, 0x00,
+    0x98, 0xd1, 0x87, 0x00, 0x98, 0xeb, 0x02, 0x8c, 0x01, 0x91, 0x00, 0x98,
+    0xf1, 0x19, 0x42, 0x8c, 0x05, 0x83, 0x01, 0x6e, 0xc3, 0x02, 0x8c, 0x17,
+    0x97, 0x01, 0x6e, 0xc9, 0x8b, 0x01, 0x6e, 0xd1, 0x87, 0x01, 0x6e, 0xeb,
+    0x02, 0x8c, 0x1b, 0x91, 0x01, 0x6e, 0xf0, 0x19, 0xc2, 0x8c, 0x1f, 0x1b,
+    0xc2, 0x8c, 0x2e, 0x83, 0x00, 0x90, 0x83, 0x02, 0x8c, 0x48, 0x97, 0x00,
+    0x90, 0x89, 0x8b, 0x00, 0x90, 0x91, 0x87, 0x00, 0x90, 0xab, 0x02, 0x8c,
+    0x4c, 0x91, 0x00, 0x90, 0xb0, 0x83, 0x00, 0x90, 0x18, 0x87, 0x00, 0x90,
+    0x20, 0x83, 0x00, 0x90, 0x38, 0x91, 0x05, 0x59, 0x71, 0x87, 0x05, 0x59,
+    0x6b, 0x02, 0x8c, 0x50, 0x83, 0x05, 0x59, 0x43, 0x02, 0x8c, 0x54, 0x8b,
+    0x05, 0x59, 0x51, 0x97, 0x05, 0x59, 0x48, 0x83, 0x00, 0x93, 0x18, 0x87,
+    0x00, 0x93, 0x20, 0x83, 0x01, 0x6c, 0x28, 0x83, 0x00, 0x93, 0x39, 0x8b,
+    0x00, 0x9c, 0x29, 0x87, 0x00, 0x9c, 0x3a, 0x02, 0x8c, 0x58, 0x0a, 0xc2,
+    0x8c, 0x5c, 0x83, 0x01, 0x6d, 0x43, 0x02, 0x8c, 0x7a, 0x97, 0x01, 0x6d,
+    0x49, 0x8b, 0x01, 0x6d, 0x51, 0x87, 0x01, 0x6d, 0x6b, 0x02, 0x8c, 0x7e,
+    0x91, 0x01, 0x6d, 0x70, 0x83, 0x00, 0x93, 0xd8, 0x87, 0x00, 0x93, 0xe0,
+    0x83, 0x01, 0x6c, 0x38, 0x83, 0x00, 0x99, 0x43, 0x02, 0x8c, 0x82, 0x97,
+    0x00, 0x99, 0x49, 0x8b, 0x00, 0x99, 0x51, 0x87, 0x00, 0x99, 0x6b, 0x02,
+    0x8c, 0x86, 0x91, 0x00, 0x99, 0x73, 0x02, 0x8c, 0x8a, 0xc2, 0x01, 0x4a,
+    0x00, 0x99, 0x78, 0x91, 0x05, 0x58, 0xb1, 0x87, 0x05, 0x58, 0xab, 0x02,
+    0x8c, 0x8e, 0xc2, 0x04, 0xc6, 0x05, 0x58, 0x99, 0x8b, 0x05, 0x58, 0x91,
+    0x97, 0x05, 0x58, 0x88, 0x0a, 0xc2, 0x8c, 0x92, 0x83, 0x00, 0x97, 0xc3,
+    0x02, 0x8c, 0xab, 0x97, 0x00, 0x97, 0xc9, 0x8b, 0x00, 0x97, 0xd1, 0x87,
+    0x00, 0x97, 0xeb, 0x02, 0x8c, 0xaf, 0x91, 0x00, 0x97, 0xf3, 0x02, 0x8c,
+    0xb3, 0xc2, 0x01, 0x4a, 0x00, 0x97, 0xf8, 0x83, 0x00, 0x97, 0x98, 0x87,
+    0x00, 0x97, 0xa0, 0x83, 0x01, 0x6c, 0x60, 0x91, 0x05, 0x58, 0x31, 0x87,
+    0x05, 0x58, 0x2b, 0x02, 0x8c, 0xb7, 0xc2, 0x04, 0xc6, 0x05, 0x58, 0x19,
+    0x8b, 0x05, 0x58, 0x11, 0x97, 0x05, 0x58, 0x08, 0x83, 0x00, 0x93, 0x98,
+    0x87, 0x00, 0x93, 0xa0, 0x83, 0x01, 0x6c, 0x30, 0x83, 0x00, 0x99, 0x03,
+    0x02, 0x8c, 0xbb, 0x97, 0x00, 0x99, 0x09, 0x8b, 0x00, 0x99, 0x11, 0x87,
+    0x00, 0x99, 0x2b, 0x02, 0x8c, 0xbf, 0x91, 0x00, 0x99, 0x33, 0x02, 0x8c,
+    0xc3, 0xc2, 0x01, 0x4a, 0x00, 0x99, 0x38, 0x83, 0x00, 0x99, 0xc3, 0x02,
+    0x8c, 0xc7, 0x97, 0x00, 0x99, 0xc9, 0x8b, 0x00, 0x99, 0xd1, 0x87, 0x00,
+    0x99, 0xeb, 0x02, 0x8c, 0xcb, 0x91, 0x00, 0x99, 0xf1, 0xc2, 0x01, 0x4a,
+    0x00, 0x99, 0xf8, 0x83, 0x00, 0x9a, 0x03, 0x02, 0x8c, 0xcf, 0x97, 0x00,
+    0x9a, 0x09, 0x8b, 0x00, 0x9a, 0x11, 0x87, 0x00, 0x9a, 0x2b, 0x02, 0x8c,
+    0xd3, 0x91, 0x00, 0x9a, 0x32, 0x02, 0x8c, 0xd7, 0x83, 0x00, 0x90, 0x58,
+    0x87, 0x00, 0x90, 0x60, 0x83, 0x01, 0x6c, 0x00, 0x83, 0x00, 0x90, 0xd8,
+    0x87, 0x00, 0x90, 0xe0, 0x83, 0x01, 0x6c, 0x08, 0x83, 0x00, 0x90, 0xf9,
+    0x8b, 0x00, 0x9c, 0x09, 0x87, 0x00, 0x9c, 0x1a, 0x02, 0x8c, 0xdb, 0x83,
+    0x00, 0x91, 0x03, 0x02, 0x8c, 0xdf, 0x97, 0x00, 0x91, 0x09, 0x8b, 0x00,
+    0x91, 0x11, 0x87, 0x00, 0x91, 0x2b, 0x02, 0x8c, 0xe3, 0x91, 0x00, 0x91,
+    0x31, 0xc2, 0x01, 0x4a, 0x00, 0x91, 0x38, 0x83, 0x00, 0x91, 0x98, 0x87,
+    0x00, 0x91, 0xa1, 0x48, 0xbd, 0x4a, 0x42, 0x8c, 0xe7, 0x83, 0x01, 0x6c,
+    0x18, 0x83, 0x00, 0x91, 0xc3, 0x02, 0x8c, 0xff, 0x97, 0x00, 0x91, 0xc9,
+    0x8b, 0x00, 0x91, 0xd1, 0x87, 0x00, 0x91, 0xeb, 0x02, 0x8d, 0x03, 0x91,
+    0x00, 0x91, 0xf3, 0x02, 0x8d, 0x07, 0xc2, 0x01, 0x4a, 0x00, 0x91, 0xf8,
+    0x83, 0x01, 0x6d, 0x03, 0x02, 0x8d, 0x0b, 0x97, 0x01, 0x6d, 0x09, 0x8b,
+    0x01, 0x6d, 0x11, 0x87, 0x01, 0x6d, 0x2b, 0x02, 0x8d, 0x0f, 0x91, 0x01,
+    0x6d, 0x30, 0x83, 0x00, 0x91, 0x58, 0x87, 0x00, 0x91, 0x60, 0x83, 0x01,
+    0x6c, 0x10, 0x83, 0x00, 0x92, 0x18, 0x87, 0x00, 0x92, 0x20, 0x83, 0x00,
+    0x92, 0x38, 0x83, 0x00, 0x92, 0x43, 0x02, 0x8d, 0x13, 0x8b, 0x00, 0x92,
+    0x51, 0x87, 0x00, 0x92, 0x6a, 0x02, 0x8d, 0x17, 0x83, 0x00, 0x92, 0x83,
+    0x02, 0x8d, 0x1b, 0x97, 0x00, 0x92, 0x89, 0x8b, 0x00, 0x92, 0x91, 0x87,
+    0x00, 0x92, 0xab, 0x02, 0x8d, 0x1f, 0x91, 0x00, 0x92, 0xb1, 0x19, 0x42,
+    0x8d, 0x23, 0x83, 0x01, 0x6e, 0x03, 0x02, 0x8d, 0x35, 0x97, 0x01, 0x6e,
+    0x09, 0x8b, 0x01, 0x6e, 0x11, 0x87, 0x01, 0x6e, 0x2b, 0x02, 0x8d, 0x39,
+    0x91, 0x01, 0x6e, 0x30, 0x83, 0x00, 0x93, 0x58, 0x87, 0x00, 0x93, 0x60,
+    0x83, 0x00, 0x94, 0x18, 0x87, 0x00, 0x94, 0x20, 0x83, 0x00, 0x94, 0x38,
+    0x83, 0x00, 0x94, 0x43, 0x02, 0x8d, 0x3d, 0x8b, 0x00, 0x94, 0x51, 0x87,
+    0x00, 0x94, 0x6a, 0x02, 0x8d, 0x41, 0x83, 0x01, 0x6e, 0x83, 0x02, 0x8d,
+    0x45, 0x97, 0x01, 0x6e, 0x89, 0x8b, 0x01, 0x6e, 0x91, 0x87, 0x01, 0x6e,
+    0xab, 0x02, 0x8d, 0x49, 0x91, 0x01, 0x6e, 0xb0, 0x83, 0x00, 0x94, 0x98,
+    0x87, 0x00, 0x94, 0xa0, 0x83, 0x01, 0x6c, 0x40, 0x83, 0x00, 0x94, 0xc3,
+    0x02, 0x8d, 0x4d, 0x97, 0x00, 0x94, 0xc9, 0x8b, 0x00, 0x94, 0xd1, 0x87,
+    0x00, 0x94, 0xeb, 0x02, 0x8d, 0x51, 0x91, 0x00, 0x94, 0xf3, 0x02, 0x8d,
+    0x55, 0xc2, 0x01, 0x4a, 0x00, 0x94, 0xf8, 0x83, 0x00, 0x95, 0x58, 0x87,
+    0x00, 0x95, 0x60, 0x83, 0x00, 0x95, 0x78, 0x83, 0x00, 0x95, 0x83, 0x02,
+    0x8d, 0x59, 0x8b, 0x00, 0x95, 0x91, 0x87, 0x00, 0x95, 0xaa, 0x02, 0x8d,
+    0x5d, 0x83, 0x00, 0x95, 0xc3, 0x02, 0x8d, 0x61, 0x97, 0x00, 0x95, 0xc9,
+    0x8b, 0x00, 0x95, 0xd1, 0x87, 0x00, 0x95, 0xeb, 0x02, 0x8d, 0x65, 0x91,
+    0x00, 0x95, 0xf1, 0x19, 0x42, 0x8d, 0x69, 0x83, 0x01, 0x6e, 0x43, 0x02,
+    0x8d, 0x7b, 0x97, 0x01, 0x6e, 0x49, 0x8b, 0x01, 0x6e, 0x51, 0x87, 0x01,
+    0x6e, 0x6b, 0x02, 0x8d, 0x7f, 0x91, 0x01, 0x6e, 0x70, 0x83, 0x00, 0x96,
+    0x58, 0x87, 0x00, 0x96, 0x60, 0x83, 0x00, 0x96, 0x78, 0x83, 0x00, 0x99,
+    0x83, 0x02, 0x8d, 0x83, 0x97, 0x00, 0x99, 0x89, 0x8b, 0x00, 0x99, 0x91,
+    0x87, 0x00, 0x99, 0xab, 0x02, 0x8d, 0x8d, 0x91, 0x00, 0x99, 0xb3, 0x02,
+    0x8d, 0x91, 0xc2, 0x01, 0x4a, 0x00, 0x99, 0xb8, 0x83, 0x00, 0x9a, 0x98,
+    0x87, 0x00, 0x9a, 0xa0, 0x83, 0x01, 0x6c, 0x90, 0x83, 0x00, 0x9a, 0xb9,
+    0x8b, 0x00, 0x9c, 0x69, 0x87, 0x00, 0x9c, 0x7a, 0x02, 0x8d, 0x95, 0x83,
+    0x00, 0x96, 0xd8, 0x87, 0x00, 0x96, 0xe0, 0x83, 0x01, 0x6c, 0x58, 0x83,
+    0x00, 0x97, 0x03, 0x02, 0x8d, 0x99, 0x97, 0x00, 0x97, 0x09, 0x8b, 0x00,
+    0x97, 0x11, 0x87, 0x00, 0x97, 0x2b, 0x02, 0x8d, 0x9d, 0x91, 0x00, 0x97,
+    0x31, 0xc2, 0x01, 0x4a, 0x00, 0x97, 0x38, 0x83, 0x01, 0x6d, 0x83, 0x02,
+    0x8d, 0xa1, 0x97, 0x01, 0x6d, 0x89, 0x8b, 0x01, 0x6d, 0x91, 0x87, 0x01,
+    0x6d, 0xab, 0x02, 0x8d, 0xa5, 0x91, 0x01, 0x6d, 0xb0, 0x83, 0x00, 0x97,
+    0x58, 0x87, 0x00, 0x97, 0x60, 0x83, 0x00, 0x97, 0x78, 0x83, 0x00, 0x98,
+    0x18, 0x87, 0x00, 0x98, 0x20, 0x83, 0x01, 0x6c, 0x70, 0x83, 0x00, 0x9a,
+    0x58, 0x87, 0x00, 0x9a, 0x60, 0x83, 0x00, 0x9a, 0x79, 0x8b, 0x00, 0x9c,
+    0x49, 0x87, 0x00, 0x9c, 0x5a, 0x02, 0x8d, 0xa9, 0xd5, 0x36, 0x47, 0x00,
+    0x9a, 0xe9, 0xc4, 0x01, 0xc3, 0x00, 0x9a, 0xf8, 0xc7, 0x09, 0x0d, 0x01,
+    0x3e, 0x91, 0xc9, 0x03, 0xc8, 0x01, 0x56, 0xc8, 0xd6, 0x2d, 0xba, 0x01,
+    0x17, 0xc9, 0xc8, 0x52, 0x09, 0x01, 0x17, 0xc1, 0xc7, 0x80, 0x70, 0x01,
+    0x17, 0xb1, 0xc9, 0x16, 0x14, 0x01, 0x17, 0xa9, 0x48, 0x00, 0x5f, 0xc2,
+    0x8d, 0xad, 0xd6, 0x2c, 0x86, 0x01, 0x17, 0x90, 0xc3, 0x77, 0x79, 0x08,
+    0x7f, 0x89, 0xc4, 0xdc, 0x2d, 0x08, 0x7f, 0x70, 0xc6, 0x06, 0xe1, 0x00,
+    0x00, 0xb8, 0xc8, 0xb7, 0x72, 0x01, 0x16, 0xf9, 0xc8, 0xbf, 0x4a, 0x01,
+    0x16, 0xf1, 0xcc, 0x07, 0xc7, 0x01, 0x16, 0xe9, 0xc9, 0x00, 0xca, 0x01,
+    0x16, 0xe0, 0x03, 0xc2, 0x8d, 0xb3, 0x45, 0x00, 0x8c, 0x42, 0x8d, 0xc2,
+    0x97, 0x08, 0xec, 0xa1, 0x8b, 0x08, 0xec, 0x89, 0x83, 0x08, 0xec, 0x50,
+    0x97, 0x08, 0xec, 0x70, 0x8b, 0x08, 0xec, 0x60, 0xc2, 0x00, 0xd0, 0x08,
+    0xec, 0x19, 0x83, 0x08, 0xec, 0x10, 0xc2, 0x00, 0xd0, 0x08, 0xeb, 0xf1,
+    0x83, 0x08, 0xeb, 0xe8, 0x83, 0x00, 0x50, 0xb1, 0xc2, 0x00, 0xd0, 0x00,
+    0x52, 0xc8, 0x83, 0x00, 0x50, 0xc1, 0xc2, 0x00, 0xd0, 0x00, 0x52, 0xd0,
+    0x83, 0x00, 0x50, 0xf9, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0x00, 0x83, 0x00,
+    0x51, 0x09, 0xc2, 0x00, 0xd0, 0x00, 0x51, 0x10, 0x94, 0x00, 0x54, 0x5b,
+    0x02, 0x8d, 0xd8, 0x8e, 0x00, 0x54, 0x62, 0x02, 0x8d, 0xdc, 0x83, 0x00,
+    0x54, 0xf9, 0xc2, 0x00, 0xd0, 0x00, 0x55, 0x00, 0x83, 0x00, 0x55, 0x09,
+    0xc2, 0x00, 0xd0, 0x00, 0x55, 0x10, 0x83, 0x00, 0x55, 0xf1, 0x8b, 0x00,
+    0x56, 0x41, 0x97, 0x00, 0x56, 0x60, 0x8b, 0x00, 0x56, 0x00, 0x97, 0x00,
+    0x56, 0x10, 0x94, 0x00, 0x56, 0x1b, 0x02, 0x8d, 0xe0, 0x8e, 0x00, 0x57,
+    0x12, 0x02, 0x8d, 0xe4, 0x87, 0x00, 0x56, 0x29, 0x91, 0x00, 0x56, 0x48,
+    0xcd, 0x7c, 0xb5, 0x0e, 0x92, 0x29, 0xcc, 0x8c, 0x0d, 0x08, 0x0c, 0x08,
+    0x5b, 0x17, 0x97, 0xc2, 0x8d, 0xe8, 0xcc, 0x81, 0x21, 0x08, 0x0c, 0x68,
+    0x55, 0x37, 0xd6, 0xc2, 0x8e, 0x10, 0xc4, 0x28, 0x48, 0x00, 0xff, 0x78,
+    0xc4, 0x59, 0x13, 0x00, 0xff, 0xf3, 0x02, 0x8e, 0x3d, 0x49, 0x63, 0xd3,
+    0xc2, 0x8e, 0x43, 0xcb, 0x9a, 0x26, 0x08, 0x0b, 0xd8, 0xc3, 0x46, 0x46,
+    0x00, 0xff, 0xe9, 0x43, 0x02, 0x6f, 0xc2, 0x8e, 0x4f, 0xc8, 0xb6, 0xa2,
+    0x08, 0x0b, 0xe1, 0xca, 0xa4, 0xf4, 0x08, 0x0c, 0x20, 0x0e, 0xc2, 0x8e,
+    0x5e, 0xca, 0x9c, 0x84, 0x00, 0x1e, 0x79, 0xcc, 0x89, 0xfd, 0x00, 0x1f,
+    0xa1, 0x49, 0x11, 0x74, 0xc2, 0x8e, 0x6a, 0xda, 0x1a, 0x64, 0x00, 0x1f,
+    0xf0, 0x45, 0x03, 0x14, 0xc2, 0x8e, 0x76, 0x56, 0x2c, 0xde, 0xc2, 0x8e,
+    0x88, 0xcc, 0x86, 0x49, 0x08, 0x0c, 0x61, 0xcd, 0x79, 0xdd, 0x08, 0x0d,
+    0x00, 0xc4, 0x7a, 0x04, 0x00, 0xfd, 0xfb, 0x02, 0x8e, 0xa6, 0xca, 0x94,
+    0x91, 0x00, 0xfe, 0x01, 0xcd, 0x42, 0x94, 0x00, 0xfd, 0xf1, 0xc8, 0x9c,
+    0x0e, 0x00, 0x1e, 0xb1, 0xc9, 0xaa, 0x9e, 0x00, 0x1e, 0xa8, 0xc6, 0x57,
+    0xbc, 0x00, 0xfd, 0xe9, 0x03, 0xc2, 0x8e, 0xac, 0xd0, 0x5b, 0xe2, 0x08,
+    0x0c, 0x10, 0x46, 0x02, 0x0f, 0xc2, 0x8e, 0xb8, 0xd1, 0x56, 0x95, 0x00,
+    0x1b, 0xa9, 0x46, 0x10, 0x38, 0xc2, 0x8e, 0xd4, 0xc9, 0xab, 0x76, 0x08,
+    0x0c, 0x18, 0xcc, 0x4a, 0x69, 0x00, 0x1b, 0xd1, 0xc8, 0xab, 0xe3, 0x08,
+    0x0b, 0xc8, 0xc4, 0x63, 0xdd, 0x00, 0x1c, 0x21, 0x0a, 0xc2, 0x8e, 0xe0,
+    0x43, 0x02, 0xa0, 0xc2, 0x8e, 0xec, 0xca, 0xa1, 0xf2, 0x08, 0x0b, 0xd1,
+    0xd1, 0x54, 0x53, 0x08, 0x0c, 0x48, 0xc9, 0xae, 0x10, 0x00, 0x1c, 0x39,
+    0x4a, 0xa2, 0x9c, 0xc2, 0x8e, 0xf8, 0x14, 0x42, 0x8f, 0x2a, 0x43, 0x60,
+    0xe8, 0xc2, 0x8f, 0x36, 0xdd, 0x10, 0x2f, 0x00, 0x1f, 0xb0, 0xce, 0x71,
+    0x84, 0x08, 0x0b, 0xf9, 0xce, 0x72, 0x64, 0x08, 0x0c, 0x00, 0xcb, 0x20,
+    0xb6, 0x00, 0x1e, 0x91, 0xd5, 0x31, 0xee, 0x00, 0x1e, 0x99, 0xd9, 0x20,
+    0xa8, 0x00, 0x1e, 0xa0, 0xca, 0x37, 0x4e, 0x01, 0x17, 0x39, 0xc5, 0x07,
+    0x62, 0x01, 0x13, 0x48, 0xc9, 0x00, 0xca, 0x01, 0x13, 0xb9, 0x43, 0x00,
+    0xe2, 0xc2, 0x8f, 0x42, 0xd0, 0x5a, 0x92, 0x01, 0x53, 0xf3, 0x02, 0x8f,
+    0x4e, 0xcb, 0x1a, 0x1a, 0x01, 0x54, 0x30, 0xc9, 0x07, 0x5e, 0x01, 0x13,
+    0x39, 0xd1, 0x51, 0x01, 0x01, 0x55, 0x20, 0xd0, 0x03, 0xb7, 0x01, 0x4b,
+    0xc1, 0x06, 0xc2, 0x8f, 0x54, 0x15, 0xc2, 0x8f, 0x5a, 0x0e, 0x42, 0x8f,
+    0x66, 0xd8, 0x24, 0x3b, 0x01, 0x54, 0x41, 0xcf, 0x62, 0xb5, 0x01, 0x54,
+    0x50, 0x8e, 0x08, 0x9b, 0x13, 0x02, 0x8f, 0x6c, 0x94, 0x08, 0x9a, 0x1a,
+    0x02, 0x8f, 0x70, 0x97, 0x08, 0x9a, 0x61, 0x8b, 0x08, 0x9a, 0x41, 0x83,
+    0x08, 0x99, 0xf0, 0x97, 0x08, 0x9a, 0x10, 0x8b, 0x08, 0x9a, 0x00, 0x47,
+    0xb2, 0x2e, 0xc2, 0x8f, 0x74, 0x45, 0x04, 0xaf, 0xc2, 0x8f, 0x82, 0x83,
+    0x08, 0x99, 0xa8, 0x83, 0x08, 0x99, 0xc1, 0xc2, 0x0d, 0xf6, 0x08, 0x99,
+    0xb9, 0xc2, 0x00, 0xd0, 0x08, 0x99, 0xb0, 0xc2, 0x00, 0xdb, 0x08, 0x99,
+    0x99, 0x83, 0x08, 0x99, 0x90, 0xc2, 0x00, 0xd0, 0x08, 0x99, 0x69, 0x83,
+    0x08, 0x99, 0x60, 0xc2, 0x00, 0xd0, 0x08, 0x99, 0x59, 0x83, 0x08, 0x99,
+    0x50, 0xc2, 0x00, 0xd0, 0x08, 0x99, 0x39, 0x83, 0x08, 0x99, 0x31, 0x06,
+    0x42, 0x8f, 0x8e, 0xc2, 0x00, 0xd0, 0x08, 0x99, 0x29, 0x16, 0xc2, 0x8f,
+    0x98, 0x83, 0x08, 0x99, 0x20, 0xc2, 0x19, 0x2c, 0x08, 0x98, 0xf1, 0xc2,
+    0x01, 0x30, 0x08, 0x98, 0xc9, 0xc2, 0x00, 0xc1, 0x08, 0x99, 0x19, 0x83,
+    0x08, 0x99, 0x40, 0xc2, 0x00, 0xd0, 0x08, 0x98, 0xe9, 0x83, 0x08, 0x98,
+    0xe0, 0xc2, 0x00, 0xd0, 0x08, 0x98, 0xd9, 0x83, 0x08, 0x98, 0xd0, 0xc2,
+    0x00, 0xd0, 0x08, 0x98, 0xc1, 0x83, 0x08, 0x98, 0xb8, 0xc2, 0x00, 0xd0,
+    0x08, 0x98, 0xb1, 0x83, 0x08, 0x98, 0xa8, 0x97, 0x08, 0x98, 0xa1, 0x8b,
+    0x08, 0x98, 0x81, 0x83, 0x08, 0x98, 0x30, 0x97, 0x08, 0x98, 0x50, 0x8b,
+    0x08, 0x98, 0x40, 0xc4, 0x1e, 0x97, 0x08, 0x9a, 0x69, 0xc5, 0x40, 0xe7,
+    0x08, 0x98, 0x18, 0xc7, 0x7a, 0x7f, 0x08, 0x99, 0xe9, 0xc7, 0x14, 0x39,
+    0x08, 0x98, 0x10, 0xca, 0x1e, 0x8a, 0x08, 0x98, 0x09, 0xd7, 0x29, 0x29,
+    0x08, 0x98, 0x00, 0x15, 0xc2, 0x8f, 0xa2, 0xdb, 0x17, 0x10, 0x0f, 0xc9,
+    0x50, 0xc9, 0xb1, 0xee, 0x00, 0xe5, 0xf9, 0x95, 0x00, 0xe4, 0xd0, 0x03,
+    0xc2, 0x8f, 0xae, 0xc2, 0x49, 0x0c, 0x00, 0xe5, 0xa9, 0xc2, 0x02, 0x0a,
+    0x00, 0xe5, 0x91, 0x87, 0x00, 0xe5, 0x88, 0xc2, 0x00, 0xc4, 0x00, 0xe5,
+    0xe9, 0xc2, 0x00, 0x74, 0x00, 0xe5, 0xd1, 0x90, 0x00, 0xe4, 0x80, 0xc9,
+    0xb1, 0x04, 0x00, 0xe5, 0xc9, 0x03, 0x42, 0x8f, 0xb9, 0xc4, 0x8c, 0x72,
+    0x00, 0xe5, 0xc1, 0x90, 0x00, 0xe4, 0xa0, 0xc3, 0x00, 0xd0, 0x00, 0xe5,
+    0x79, 0xc2, 0x00, 0x71, 0x00, 0xe5, 0x58, 0x0a, 0xc2, 0x8f, 0xc1, 0xc2,
+    0x00, 0x71, 0x00, 0xe5, 0x61, 0xc2, 0x00, 0xd1, 0x00, 0xe5, 0x50, 0xc3,
+    0x11, 0xef, 0x00, 0xe5, 0x41, 0xc2, 0x00, 0xd1, 0x00, 0xe5, 0x08, 0xc3,
+    0x00, 0xd0, 0x00, 0xe5, 0x31, 0xc2, 0x00, 0xd1, 0x00, 0xe4, 0x90, 0xc3,
+    0x01, 0x50, 0x00, 0xe5, 0x29, 0xc2, 0x00, 0xd1, 0x00, 0xe4, 0xc8, 0xc3,
+    0x01, 0x50, 0x00, 0xe5, 0x21, 0xc2, 0x00, 0xb1, 0x00, 0xe4, 0xf0, 0xc3,
+    0x01, 0x50, 0x00, 0xe4, 0xf9, 0xc2, 0x00, 0xc4, 0x00, 0xe4, 0xb0, 0x90,
+    0x00, 0x85, 0x01, 0xc2, 0x00, 0xc4, 0x00, 0x86, 0x68, 0xc2, 0x00, 0xd1,
+    0x00, 0x85, 0x11, 0xc3, 0x00, 0xd0, 0x00, 0x85, 0xb0, 0xc2, 0x00, 0xc4,
+    0x00, 0x85, 0x31, 0xc3, 0x01, 0x50, 0x00, 0x85, 0x78, 0x90, 0x00, 0x85,
+    0x39, 0x94, 0x00, 0x85, 0x90, 0xc2, 0x00, 0xd1, 0x00, 0x85, 0x49, 0xc3,
+    0x01, 0x50, 0x00, 0x85, 0xa8, 0xc2, 0x00, 0xb1, 0x00, 0x85, 0x71, 0xc3,
+    0x01, 0x50, 0x00, 0x85, 0xa0, 0xc2, 0x00, 0xd1, 0x00, 0x85, 0x89, 0xc3,
+    0x11, 0xef, 0x00, 0x85, 0xc0, 0x0a, 0xc2, 0x8f, 0xcd, 0xc2, 0x00, 0xd1,
+    0x00, 0x85, 0xd1, 0xc2, 0x00, 0x71, 0x00, 0x85, 0xe0, 0xc2, 0x00, 0x71,
+    0x00, 0x85, 0xd9, 0xc3, 0x00, 0xd0, 0x00, 0x85, 0xf8, 0x03, 0xc2, 0x8f,
+    0xd9, 0x87, 0x00, 0x86, 0x09, 0xc2, 0x02, 0x0a, 0x00, 0x86, 0x11, 0xc2,
+    0x49, 0x0c, 0x00, 0x86, 0x28, 0x90, 0x00, 0x86, 0x81, 0xc2, 0x00, 0x74,
+    0x00, 0x87, 0xd1, 0xc2, 0x00, 0xc4, 0x00, 0x87, 0xe8, 0xc2, 0x00, 0xd1,
+    0x00, 0x86, 0x91, 0xc3, 0x00, 0xd0, 0x00, 0x87, 0x30, 0x90, 0x00, 0x86,
+    0xa1, 0xc4, 0x8c, 0x72, 0x00, 0x87, 0xc0, 0xc2, 0x00, 0xc4, 0x00, 0x86,
+    0xb1, 0xc3, 0x01, 0x50, 0x00, 0x86, 0xf8, 0x03, 0xc2, 0x8f, 0xe1, 0xc9,
+    0xb1, 0x04, 0x00, 0x87, 0xc8, 0xc2, 0x00, 0xd1, 0x00, 0x86, 0xc9, 0xc3,
+    0x01, 0x50, 0x00, 0x87, 0x28, 0x95, 0x00, 0x86, 0xd1, 0xc9, 0xb1, 0xee,
+    0x00, 0x87, 0xf8, 0xc2, 0x00, 0xb1, 0x00, 0x86, 0xf1, 0xc3, 0x01, 0x50,
+    0x00, 0x87, 0x20, 0xc2, 0x00, 0xd1, 0x00, 0x87, 0x09, 0xc3, 0x11, 0xef,
+    0x00, 0x87, 0x40, 0x0a, 0xc2, 0x8f, 0xe9, 0xc2, 0x00, 0xd1, 0x00, 0x87,
+    0x51, 0xc2, 0x00, 0x71, 0x00, 0x87, 0x60, 0xc2, 0x00, 0x71, 0x00, 0x87,
+    0x59, 0xc3, 0x00, 0xd0, 0x00, 0x87, 0x78, 0x03, 0xc2, 0x8f, 0xf5, 0x87,
+    0x00, 0x87, 0x89, 0xc2, 0x02, 0x0a, 0x00, 0x87, 0x91, 0xc2, 0x49, 0x0c,
+    0x00, 0x87, 0xa8, 0x90, 0x01, 0x68, 0x01, 0xc2, 0x00, 0xc4, 0x01, 0x69,
+    0x68, 0xc2, 0x00, 0xd1, 0x01, 0x68, 0x11, 0xc3, 0x00, 0xd0, 0x01, 0x68,
+    0xb0, 0xc2, 0x00, 0xc4, 0x01, 0x68, 0x31, 0xc3, 0x01, 0x50, 0x01, 0x68,
+    0x78, 0x90, 0x01, 0x68, 0x39, 0x94, 0x01, 0x68, 0x90, 0xc2, 0x00, 0xd1,
+    0x01, 0x68, 0x49, 0xc3, 0x01, 0x50, 0x01, 0x68, 0xa8, 0xc2, 0x00, 0xb1,
+    0x01, 0x68, 0x71, 0xc3, 0x01, 0x50, 0x01, 0x68, 0xa0, 0xc2, 0x00, 0xd1,
+    0x01, 0x68, 0x89, 0xc3, 0x11, 0xef, 0x01, 0x68, 0xc0, 0x0a, 0xc2, 0x90,
+    0x00, 0xc2, 0x00, 0xd1, 0x01, 0x68, 0xd1, 0xc2, 0x00, 0x71, 0x01, 0x68,
+    0xe0, 0xc2, 0x00, 0x71, 0x01, 0x68, 0xd9, 0xc3, 0x00, 0xd0, 0x01, 0x68,
+    0xf8, 0x03, 0xc2, 0x90, 0x0c, 0x87, 0x01, 0x69, 0x09, 0xc2, 0x02, 0x0a,
+    0x01, 0x69, 0x11, 0xc2, 0x49, 0x0c, 0x01, 0x69, 0x28, 0xc3, 0xc8, 0x92,
+    0x01, 0x60, 0x09, 0xc6, 0xc8, 0x01, 0x01, 0x61, 0x40, 0xc4, 0xe4, 0x2b,
+    0x01, 0x60, 0x21, 0xc4, 0xdf, 0x03, 0x01, 0x60, 0x39, 0xc5, 0xdd, 0xb2,
+    0x01, 0x60, 0x60, 0x07, 0xc2, 0x90, 0x14, 0xc3, 0x01, 0xbd, 0x01, 0x61,
+    0x09, 0x97, 0x01, 0x61, 0x19, 0x91, 0x01, 0x61, 0x30, 0xc6, 0xd3, 0x73,
+    0x01, 0x60, 0x31, 0xc5, 0xda, 0x24, 0x01, 0x60, 0x40, 0x42, 0x25, 0xa1,
+    0xc2, 0x90, 0x1e, 0xcb, 0x98, 0x00, 0x01, 0x60, 0x51, 0x47, 0x1c, 0xa0,
+    0x42, 0x90, 0x28, 0xc6, 0xc4, 0x49, 0x01, 0x60, 0x71, 0xcf, 0x60, 0xd5,
+    0x01, 0x61, 0x70, 0xc2, 0x06, 0xc6, 0x01, 0x60, 0x89, 0xc2, 0x00, 0x16,
+    0x01, 0x60, 0xc8, 0xc5, 0xcb, 0xee, 0x01, 0x60, 0x91, 0x87, 0x01, 0x60,
+    0xd0, 0xc4, 0xe4, 0xc7, 0x01, 0x60, 0xa1, 0x0a, 0xc2, 0x90, 0x34, 0xc9,
+    0xae, 0x19, 0x01, 0x61, 0x11, 0xc8, 0xae, 0x6b, 0x01, 0x61, 0x22, 0x02,
+    0x90, 0x41, 0xc5, 0xd9, 0x52, 0x01, 0x60, 0xa9, 0xc2, 0x00, 0xba, 0x01,
+    0x60, 0xe1, 0xcb, 0x97, 0x92, 0x01, 0x61, 0x68, 0xc4, 0xac, 0x24, 0x01,
+    0x60, 0xb9, 0xc3, 0x02, 0x44, 0x01, 0x61, 0x50, 0xc5, 0x7b, 0xac, 0x01,
+    0x60, 0xe9, 0xcd, 0x7b, 0xa4, 0x01, 0x61, 0x78, 0xc3, 0xc8, 0x92, 0x01,
+    0x61, 0x89, 0xc6, 0xc8, 0x01, 0x01, 0x62, 0xc0, 0xc4, 0xe4, 0x2b, 0x01,
+    0x61, 0xa1, 0xc4, 0xdf, 0x03, 0x01, 0x61, 0xb9, 0xc5, 0xdd, 0xb2, 0x01,
+    0x61, 0xe0, 0x07, 0xc2, 0x90, 0x47, 0xc3, 0x01, 0xbd, 0x01, 0x62, 0x89,
+    0x97, 0x01, 0x62, 0x99, 0x91, 0x01, 0x62, 0xb0, 0xc6, 0xd3, 0x73, 0x01,
+    0x61, 0xb1, 0xc5, 0xda, 0x24, 0x01, 0x61, 0xc0, 0x42, 0x25, 0xa1, 0xc2,
+    0x90, 0x51, 0xcb, 0x98, 0x00, 0x01, 0x61, 0xd1, 0x47, 0x1c, 0xa0, 0x42,
+    0x90, 0x5b, 0xc6, 0xc4, 0x49, 0x01, 0x61, 0xf1, 0xcf, 0x60, 0xd5, 0x01,
+    0x62, 0xf0, 0xc2, 0x06, 0xc6, 0x01, 0x62, 0x09, 0xc2, 0x00, 0x16, 0x01,
+    0x62, 0x48, 0xc5, 0xcb, 0xee, 0x01, 0x62, 0x11, 0x87, 0x01, 0x62, 0x50,
+    0xc4, 0xe4, 0xc7, 0x01, 0x62, 0x21, 0x0a, 0xc2, 0x90, 0x67, 0xc9, 0xae,
+    0x19, 0x01, 0x62, 0x91, 0xc8, 0xae, 0x6b, 0x01, 0x62, 0xa2, 0x02, 0x90,
+    0x74, 0xc5, 0xd9, 0x52, 0x01, 0x62, 0x29, 0xc2, 0x00, 0xba, 0x01, 0x62,
+    0x61, 0xcb, 0x97, 0x92, 0x01, 0x62, 0xe8, 0xc4, 0xac, 0x24, 0x01, 0x62,
+    0x39, 0xc3, 0x02, 0x44, 0x01, 0x62, 0xd0, 0xc5, 0x7b, 0xac, 0x01, 0x62,
+    0x69, 0xcd, 0x7b, 0xa4, 0x01, 0x62, 0xf8, 0xc7, 0x14, 0x39, 0x00, 0x58,
+    0x11, 0xc7, 0x7a, 0x7f, 0x00, 0x59, 0xe8, 0xc5, 0x40, 0xe7, 0x00, 0x58,
+    0x19, 0xc4, 0x1e, 0x97, 0x00, 0x5a, 0x68, 0x83, 0x00, 0x58, 0x31, 0x8b,
+    0x00, 0x58, 0x81, 0x97, 0x00, 0x58, 0xa0, 0x8b, 0x00, 0x58, 0x40, 0x97,
+    0x00, 0x58, 0x50, 0x47, 0xb2, 0x2e, 0xc2, 0x90, 0x7a, 0x83, 0x00, 0x59,
+    0xa8, 0x83, 0x00, 0x58, 0xa9, 0xc2, 0x00, 0xd0, 0x00, 0x58, 0xb0, 0x83,
+    0x00, 0x58, 0xb9, 0xc2, 0x00, 0xd0, 0x00, 0x58, 0xc0, 0xc2, 0x01, 0x30,
+    0x00, 0x58, 0xc9, 0xc2, 0x19, 0x2c, 0x00, 0x58, 0xf1, 0xc2, 0x00, 0xc1,
+    0x00, 0x59, 0x19, 0x83, 0x00, 0x59, 0x40, 0x83, 0x00, 0x58, 0xd1, 0xc2,
+    0x00, 0xd0, 0x00, 0x58, 0xd8, 0x83, 0x00, 0x58, 0xe1, 0xc2, 0x00, 0xd0,
+    0x00, 0x58, 0xe8, 0x16, 0xc2, 0x90, 0x88, 0x83, 0x00, 0x59, 0x21, 0xc2,
+    0x00, 0xd0, 0x00, 0x59, 0x28, 0x06, 0xc2, 0x90, 0x92, 0x83, 0x00, 0x59,
+    0x31, 0xc2, 0x00, 0xd0, 0x00, 0x59, 0x38, 0x83, 0x00, 0x59, 0x51, 0xc2,
+    0x00, 0xd0, 0x00, 0x59, 0x58, 0x83, 0x00, 0x59, 0x61, 0xc2, 0x00, 0xd0,
+    0x00, 0x59, 0x68, 0x83, 0x00, 0x59, 0x79, 0xc2, 0x19, 0x2c, 0x00, 0x5a,
+    0xf8, 0x83, 0x00, 0x59, 0x81, 0xc2, 0x00, 0x39, 0x00, 0x5a, 0xe1, 0xc2,
+    0x00, 0xd0, 0x00, 0x5a, 0xe8, 0x83, 0x00, 0x59, 0x91, 0xc2, 0x00, 0xdb,
+    0x00, 0x59, 0x98, 0xc2, 0x00, 0xd0, 0x00, 0x59, 0xb1, 0xc2, 0x0d, 0xf6,
+    0x00, 0x59, 0xb9, 0x83, 0x00, 0x59, 0xc0, 0x83, 0x00, 0x59, 0xf1, 0x8b,
+    0x00, 0x5a, 0x41, 0x97, 0x00, 0x5a, 0x60, 0x8b, 0x00, 0x5a, 0x00, 0x97,
+    0x00, 0x5a, 0x10, 0x94, 0x00, 0x5a, 0x1b, 0x02, 0x90, 0x9c, 0x8e, 0x00,
+    0x5b, 0x12, 0x02, 0x90, 0xa0, 0xc2, 0x02, 0xa0, 0x00, 0x5b, 0x41, 0xc4,
+    0x02, 0xde, 0x00, 0x5b, 0x48, 0xc3, 0x09, 0x9e, 0x00, 0x5b, 0x51, 0xc3,
+    0x0d, 0x14, 0x00, 0x5b, 0x58, 0xc2, 0x22, 0xcc, 0x00, 0x5b, 0x61, 0xc4,
+    0x18, 0x10, 0x00, 0x5b, 0x68, 0xc7, 0x08, 0x79, 0x00, 0x5b, 0x91, 0xc4,
+    0x01, 0xce, 0x00, 0x5b, 0x99, 0xc9, 0x67, 0x38, 0x00, 0x5b, 0xa9, 0xc6,
+    0x06, 0xdb, 0x00, 0x5b, 0xb0, 0xc8, 0x08, 0x79, 0x00, 0x5b, 0xa1, 0xca,
+    0xa7, 0x88, 0x00, 0x5b, 0xb8, 0xc3, 0x02, 0xdf, 0x0f, 0x68, 0x1b, 0x02,
+    0x90, 0xa4, 0xc4, 0x0d, 0x0e, 0x0f, 0x68, 0x62, 0x02, 0x90, 0xa8, 0x91,
+    0x0f, 0x68, 0x13, 0x02, 0x90, 0xae, 0xc4, 0x18, 0x12, 0x0f, 0x68, 0x5a,
+    0x02, 0x90, 0xb2, 0xc9, 0x57, 0x20, 0x0f, 0x69, 0x28, 0xc2, 0x00, 0x33,
+    0x0f, 0x68, 0x23, 0x02, 0x90, 0xb8, 0xc3, 0x0d, 0x0f, 0x0f, 0x68, 0x6a,
+    0x02, 0x90, 0xbc, 0xc2, 0x00, 0x5f, 0x0f, 0x68, 0x2b, 0x02, 0x90, 0xc2,
+    0xc3, 0x45, 0x6b, 0x0f, 0x68, 0x72, 0x02, 0x90, 0xc6, 0xc7, 0x0d, 0x04,
+    0x0f, 0x68, 0x99, 0xc8, 0x4b, 0x94, 0x0f, 0x68, 0xe0, 0xc2, 0x0d, 0x10,
+    0x0f, 0x68, 0x7b, 0x02, 0x90, 0xcc, 0x00, 0x42, 0x90, 0xd2, 0xc2, 0x0d,
+    0x10, 0x0f, 0x68, 0x83, 0x02, 0x90, 0xde, 0x00, 0x42, 0x90, 0xe4, 0xc9,
+    0x57, 0x20, 0x0f, 0x69, 0x60, 0xc7, 0x0d, 0x04, 0x0f, 0x68, 0xd1, 0xc8,
+    0x4b, 0x94, 0x0f, 0x69, 0x18, 0xc9, 0x57, 0x20, 0x0f, 0x69, 0x68, 0xc7,
+    0x0d, 0x04, 0x0f, 0x68, 0xd9, 0xc8, 0x4b, 0x94, 0x0f, 0x69, 0x20, 0xc9,
+    0x57, 0x20, 0x0f, 0x69, 0xd0, 0xc9, 0x57, 0x20, 0x0f, 0x69, 0xd8, 0xc8,
+    0x0d, 0x03, 0x0f, 0x69, 0xc0, 0xc8, 0x0d, 0x03, 0x0f, 0x69, 0xc8, 0xc6,
+    0x2d, 0xd0, 0x01, 0x3e, 0x21, 0xc4, 0x0e, 0xa6, 0x01, 0x3e, 0x18, 0xd8,
+    0x21, 0x23, 0x01, 0x39, 0xe1, 0xc8, 0x0a, 0xff, 0x01, 0x39, 0x91, 0xca,
+    0x22, 0x51, 0x01, 0x39, 0x59, 0xc5, 0x0d, 0x20, 0x01, 0x38, 0xd8, 0x9a,
+    0x01, 0x21, 0x19, 0xc2, 0x01, 0x25, 0x0f, 0xa6, 0xb0, 0xc5, 0x5f, 0x98,
+    0x0f, 0xae, 0x09, 0xca, 0x9e, 0xf0, 0x0f, 0xa6, 0x10, 0xcc, 0x81, 0x81,
+    0x0f, 0xa7, 0x69, 0xcb, 0x9a, 0x5d, 0x0f, 0xa7, 0x60, 0xcd, 0x78, 0xa5,
+    0x01, 0x1c, 0x81, 0xcd, 0x7a, 0x45, 0x01, 0x1c, 0x78, 0xc9, 0x3b, 0x79,
+    0x08, 0x7c, 0x49, 0x44, 0x02, 0x9f, 0xc2, 0x90, 0xf0, 0xc3, 0x01, 0x5d,
+    0x08, 0x7c, 0x30, 0x49, 0x04, 0xf9, 0xc2, 0x90, 0xfc, 0x44, 0x05, 0x18,
+    0x42, 0x91, 0x08, 0x0e, 0xc2, 0x91, 0x14, 0xc3, 0xb5, 0x3e, 0x08, 0x7c,
+    0x01, 0xc2, 0x00, 0x67, 0x08, 0x7b, 0xe1, 0x15, 0xc2, 0x91, 0x20, 0xc3,
+    0x20, 0x18, 0x08, 0x7b, 0xd1, 0xc3, 0x00, 0x4e, 0x08, 0x7b, 0xc9, 0xc4,
+    0xe0, 0xe7, 0x08, 0x7b, 0xb9, 0xc4, 0x4a, 0xb9, 0x08, 0x7b, 0xb1, 0xca,
+    0x9b, 0x8a, 0x08, 0x7b, 0xa9, 0xc5, 0x4a, 0xb3, 0x08, 0x7b, 0xa1, 0xc3,
+    0x7e, 0x89, 0x08, 0x7b, 0x99, 0xca, 0x9c, 0xa2, 0x08, 0x7b, 0x91, 0xc4,
+    0xe3, 0x27, 0x08, 0x7b, 0x89, 0xc5, 0xa5, 0xfd, 0x08, 0x7b, 0x81, 0xc4,
+    0x5d, 0xe2, 0x08, 0x7b, 0xf0, 0xd1, 0x53, 0xa9, 0x08, 0x79, 0x31, 0x47,
+    0x34, 0x2f, 0xc2, 0x91, 0x2a, 0x0e, 0x42, 0x91, 0x3b, 0x43, 0x2f, 0x2a,
+    0xc2, 0x91, 0x47, 0x47, 0x02, 0x0e, 0x42, 0x91, 0x53, 0xc3, 0x09, 0x41,
+    0x08, 0x67, 0xe1, 0x42, 0x02, 0x09, 0xc2, 0x91, 0xb0, 0xc3, 0x05, 0x14,
+    0x08, 0x67, 0xd2, 0x02, 0x91, 0xbc, 0x97, 0x08, 0x67, 0x53, 0x02, 0x91,
+    0xc0, 0x87, 0x08, 0x66, 0x4b, 0x02, 0x91, 0xce, 0x4a, 0xa7, 0x74, 0xc2,
+    0x92, 0x2e, 0x4b, 0x95, 0x61, 0xc2, 0x92, 0x3a, 0xc8, 0xb9, 0x6a, 0x08,
+    0x67, 0x19, 0x91, 0x08, 0x66, 0xdb, 0x02, 0x92, 0x46, 0x83, 0x08, 0x66,
+    0x03, 0x02, 0x92, 0x50, 0x8b, 0x08, 0x66, 0x83, 0x02, 0x92, 0x64, 0xc7,
+    0xc9, 0x9d, 0x08, 0x66, 0x50, 0x87, 0x08, 0x64, 0x4b, 0x02, 0x92, 0x68,
+    0xc8, 0xb9, 0x6a, 0x08, 0x65, 0x19, 0x91, 0x08, 0x64, 0xdb, 0x02, 0x92,
+    0xc8, 0x4a, 0xa7, 0x74, 0xc2, 0x92, 0xd2, 0x4b, 0x95, 0x61, 0xc2, 0x92,
+    0xde, 0x97, 0x08, 0x65, 0x53, 0x02, 0x92, 0xea, 0x83, 0x08, 0x64, 0x03,
+    0x02, 0x92, 0xf8, 0x8b, 0x08, 0x64, 0x83, 0x02, 0x93, 0x0c, 0xc7, 0xc9,
+    0x9d, 0x08, 0x64, 0x50, 0xc4, 0xe1, 0xaf, 0x08, 0x62, 0x41, 0x91, 0x08,
+    0x60, 0x33, 0x02, 0x93, 0x10, 0x83, 0x08, 0x60, 0x03, 0x02, 0x93, 0x23,
+    0x07, 0xc2, 0x93, 0x52, 0x8b, 0x08, 0x60, 0x1a, 0x02, 0x93, 0x72, 0x83,
+    0x08, 0x60, 0x0b, 0x02, 0x93, 0x7a, 0x87, 0x08, 0x60, 0x2b, 0x02, 0x93,
+    0xad, 0x11, 0xc2, 0x93, 0xbf, 0x8b, 0x08, 0x60, 0x22, 0x02, 0x93, 0xca,
+    0x16, 0xc2, 0x93, 0xce, 0xc3, 0x05, 0x14, 0x08, 0x54, 0xe8, 0x42, 0x02,
+    0x1c, 0xc2, 0x93, 0xda, 0x16, 0xc2, 0x93, 0xe4, 0xc3, 0x2b, 0xb9, 0x08,
+    0x54, 0xd1, 0x09, 0xc2, 0x93, 0xf4, 0x42, 0x0e, 0x9a, 0xc2, 0x94, 0x00,
+    0x43, 0xe6, 0x2c, 0xc2, 0x94, 0x08, 0xc3, 0x7e, 0x89, 0x08, 0x54, 0x29,
+    0xc3, 0x0f, 0x9a, 0x08, 0x54, 0x21, 0xc4, 0x19, 0x60, 0x08, 0x54, 0x19,
+    0x0a, 0xc2, 0x94, 0x14, 0xc3, 0x0d, 0xff, 0x08, 0x54, 0x09, 0xc3, 0x72,
+    0xf0, 0x08, 0x54, 0x39, 0xc3, 0x85, 0xf5, 0x08, 0x54, 0x41, 0x0d, 0xc2,
+    0x94, 0x20, 0xc4, 0x3a, 0x01, 0x08, 0x54, 0x61, 0xc3, 0x0d, 0xf6, 0x08,
+    0x54, 0x71, 0xc3, 0xb1, 0x0d, 0x08, 0x54, 0x81, 0x03, 0x42, 0x94, 0x2c,
+    0xcd, 0x7a, 0xa0, 0x0f, 0xad, 0x99, 0x44, 0x19, 0xb0, 0x42, 0x94, 0x38,
+    0xc2, 0x00, 0xd1, 0x08, 0x1a, 0x81, 0xc3, 0x2b, 0x88, 0x08, 0x1a, 0x89,
+    0xc3, 0x46, 0xf6, 0x08, 0x1a, 0x91, 0x06, 0xc2, 0x94, 0x4a, 0x87, 0x08,
+    0x1a, 0xa3, 0x02, 0x94, 0x54, 0x1c, 0xc2, 0x94, 0x58, 0x8b, 0x08, 0x1a,
+    0xcb, 0x02, 0x94, 0x64, 0xc4, 0xe0, 0xb3, 0x08, 0x1a, 0xd1, 0xc3, 0x39,
+    0xa6, 0x08, 0x1a, 0xd9, 0xc5, 0xdb, 0x19, 0x08, 0x1a, 0xe1, 0xc5, 0xdb,
+    0x6e, 0x08, 0x1a, 0xe9, 0x18, 0xc2, 0x94, 0x6c, 0xc4, 0xcf, 0x74, 0x08,
+    0x1a, 0xf9, 0xc3, 0x26, 0x92, 0x08, 0x1b, 0x01, 0x15, 0xc2, 0x94, 0x78,
+    0x16, 0xc2, 0x94, 0x82, 0x97, 0x08, 0x1b, 0x19, 0xc5, 0xdd, 0x1c, 0x08,
+    0x1b, 0x21, 0x1b, 0xc2, 0x94, 0x8e, 0x91, 0x08, 0x1b, 0x4b, 0x02, 0x94,
+    0xa8, 0xc2, 0x00, 0xd0, 0x08, 0x1b, 0x60, 0xc2, 0x00, 0x51, 0x08, 0x18,
+    0x09, 0x0d, 0xc2, 0x94, 0xac, 0xc2, 0x00, 0x06, 0x08, 0x18, 0x19, 0x87,
+    0x08, 0x18, 0x23, 0x02, 0x94, 0xbe, 0xc2, 0x00, 0x5f, 0x08, 0x18, 0x29,
+    0xc2, 0x0a, 0xe2, 0x08, 0x18, 0x31, 0xc2, 0x01, 0x7f, 0x08, 0x18, 0x39,
+    0x16, 0xc2, 0x94, 0xe2, 0x8b, 0x08, 0x18, 0x4b, 0x02, 0x94, 0xec, 0x83,
+    0x08, 0x18, 0x01, 0x91, 0x08, 0x18, 0x79, 0x12, 0xc2, 0x94, 0xf0, 0x15,
+    0xc2, 0x94, 0xfa, 0x97, 0x08, 0x18, 0xb3, 0x02, 0x95, 0x06, 0xc3, 0x28,
+    0x28, 0x08, 0x18, 0xe1, 0xc2, 0x0c, 0x43, 0x08, 0x19, 0x69, 0xcc, 0x82,
+    0xc5, 0x08, 0x19, 0x70, 0xc3, 0x05, 0x14, 0x08, 0x19, 0x01, 0x42, 0x02,
+    0x09, 0xc2, 0x95, 0x0a, 0xc3, 0x09, 0x41, 0x08, 0x19, 0x10, 0x83, 0x00,
+    0xe2, 0xf8, 0x99, 0x00, 0xe3, 0x19, 0x8f, 0x00, 0xe3, 0x11, 0x8c, 0x00,
+    0xe3, 0x09, 0x8d, 0x00, 0xe3, 0x00, 0xc7, 0x56, 0x8e, 0x01, 0x5d, 0xd1,
+    0xd1, 0x56, 0x84, 0x01, 0x5d, 0xd8, 0x90, 0x08, 0x25, 0x90, 0xc3, 0x1c,
+    0x63, 0x08, 0x25, 0xb1, 0xc2, 0x02, 0x2b, 0x08, 0x25, 0xe9, 0xc2, 0x00,
+    0xb0, 0x08, 0x26, 0x29, 0x16, 0x42, 0x95, 0x16, 0x83, 0x08, 0x26, 0x51,
+    0xc2, 0x00, 0xd0, 0x08, 0x26, 0x60, 0x90, 0x08, 0x26, 0xd0, 0xc3, 0x1c,
+    0x63, 0x08, 0x26, 0xf1, 0xc2, 0x02, 0x2b, 0x08, 0x27, 0x29, 0xc2, 0x00,
+    0xb0, 0x08, 0x27, 0x69, 0x16, 0x42, 0x95, 0x20, 0x83, 0x08, 0x27, 0x91,
+    0xc2, 0x00, 0xd0, 0x08, 0x27, 0xa0, 0x0d, 0xc2, 0x95, 0x2a, 0xcb, 0x93,
+    0x7d, 0x0e, 0x7d, 0x89, 0xc8, 0x4e, 0x4b, 0x0e, 0x7d, 0x80, 0xc6, 0xca,
+    0xa9, 0x0e, 0x7a, 0x88, 0x0d, 0xc2, 0x95, 0x36, 0x16, 0xc2, 0x95, 0x42,
+    0x44, 0xe0, 0x6b, 0xc2, 0x95, 0x4e, 0x49, 0x75, 0xe7, 0xc2, 0x95, 0x5b,
+    0xce, 0x69, 0xa0, 0x0e, 0x7c, 0xb9, 0x12, 0xc2, 0x95, 0x68, 0xce, 0x6d,
+    0xa2, 0x0e, 0x7c, 0x98, 0x00, 0x42, 0x95, 0x72, 0x00, 0x42, 0x95, 0x87,
+    0x42, 0x00, 0x97, 0xc2, 0x95, 0x93, 0xc8, 0xb8, 0x72, 0x0e, 0x7b, 0xf8,
+    0xcb, 0x87, 0x3a, 0x0e, 0x7b, 0xe1, 0xce, 0x69, 0xa0, 0x0e, 0x7b, 0xd9,
+    0xc8, 0x4e, 0x4b, 0x0e, 0x7b, 0xd1, 0xc8, 0xbf, 0x6a, 0x0e, 0x7b, 0xc8,
+    0x45, 0x4e, 0x46, 0xc2, 0x95, 0x9f, 0xce, 0x69, 0xa0, 0x0e, 0x7b, 0xb8,
+    0xc6, 0x6d, 0xaa, 0x0e, 0x7b, 0xa1, 0xca, 0x93, 0x7e, 0x0e, 0x7b, 0x98,
+    0xcc, 0x84, 0x51, 0x0e, 0x7d, 0x59, 0xc7, 0xc8, 0x69, 0x0e, 0x7d, 0x51,
+    0xc3, 0xe5, 0x9c, 0x0e, 0x7d, 0x48, 0xc8, 0xb8, 0x12, 0x0e, 0x79, 0x68,
+    0xc8, 0xbb, 0xe2, 0x0e, 0x79, 0xc8, 0xc9, 0x78, 0xd9, 0x0e, 0x78, 0xc1,
+    0x43, 0x01, 0x55, 0x42, 0x95, 0xab, 0xc5, 0x00, 0x2c, 0x0e, 0x78, 0x89,
+    0xc4, 0x00, 0x49, 0x0e, 0x78, 0x28, 0xc7, 0x93, 0xee, 0x0e, 0x79, 0xb3,
+    0x02, 0x95, 0xb7, 0xc6, 0xcb, 0x33, 0x0e, 0x79, 0x30, 0x15, 0xc2, 0x95,
+    0xbd, 0x43, 0x01, 0x55, 0x42, 0x95, 0xc9, 0xc3, 0xe5, 0x2d, 0x0e, 0x79,
+    0x51, 0xc2, 0x01, 0xc8, 0x0e, 0x79, 0x00, 0x43, 0x01, 0x55, 0xc2, 0x95,
+    0xd5, 0x4d, 0x78, 0xd9, 0x42, 0x95, 0xe1, 0xc6, 0x42, 0x68, 0x0e, 0x78,
+    0xf1, 0x42, 0x00, 0xe7, 0x42, 0x95, 0xed, 0xc5, 0x00, 0x2c, 0x0e, 0x78,
+    0x91, 0xc4, 0x00, 0x49, 0x0e, 0x78, 0x30, 0xc6, 0x78, 0xdc, 0x0e, 0x78,
+    0xe9, 0x4b, 0x8e, 0xfa, 0x42, 0x95, 0xf9, 0xc5, 0x00, 0x2c, 0x0e, 0x78,
+    0xa1, 0xc4, 0x00, 0x49, 0x0e, 0x78, 0x40, 0xc5, 0x00, 0x2c, 0x0e, 0x78,
+    0x81, 0xc4, 0x00, 0x49, 0x0e, 0x78, 0x20, 0xc5, 0x00, 0x2c, 0x0e, 0x78,
+    0x69, 0xc4, 0x00, 0x49, 0x0e, 0x78, 0x08, 0xce, 0x1e, 0x74, 0x08, 0xd1,
+    0xb0, 0xc3, 0x0d, 0x18, 0x05, 0x4e, 0x53, 0x02, 0x96, 0x05, 0xc4, 0xe3,
+    0x8f, 0x05, 0x4e, 0x18, 0xc6, 0xcd, 0xfd, 0x05, 0x4e, 0x39, 0xc6, 0x45,
+    0xa6, 0x05, 0x4e, 0x60, 0x17, 0xc2, 0x96, 0x0b, 0xc5, 0x3a, 0xbc, 0x05,
+    0x4e, 0x40, 0xc6, 0xcb, 0x27, 0x05, 0x4c, 0x98, 0x42, 0x00, 0x4d, 0x42,
+    0x96, 0x17, 0xc6, 0xcb, 0x21, 0x05, 0x4d, 0x60, 0xc6, 0xcb, 0x27, 0x05,
+    0x4d, 0x40, 0x00, 0x42, 0x96, 0x23, 0x83, 0x05, 0x4d, 0x23, 0x02, 0x96,
+    0x2f, 0xc2, 0x19, 0x2c, 0x05, 0x4c, 0xd3, 0x02, 0x96, 0x35, 0xc2, 0x01,
+    0x30, 0x05, 0x4c, 0xa2, 0x02, 0x96, 0x3b, 0x83, 0x05, 0x4d, 0x13, 0x02,
+    0x96, 0x44, 0xc2, 0x0e, 0x9a, 0x05, 0x4c, 0xea, 0x02, 0x96, 0x4a, 0x83,
+    0x05, 0x4d, 0x03, 0x02, 0x96, 0x50, 0xc2, 0x01, 0x6f, 0x05, 0x4c, 0xda,
+    0x02, 0x96, 0x56, 0xca, 0x60, 0x26, 0x05, 0x4c, 0xc8, 0xc6, 0xcb, 0x27,
+    0x05, 0x4c, 0xb0, 0x00, 0x42, 0x96, 0x5c, 0x8b, 0x05, 0x4c, 0x68, 0x8b,
+    0x05, 0x4c, 0x39, 0xc5, 0xd5, 0x2e, 0x05, 0x4c, 0x28, 0xc4, 0x04, 0x15,
+    0x05, 0x4d, 0xd1, 0xc4, 0xdf, 0x53, 0x05, 0x4d, 0xa0, 0xcf, 0x6a, 0xe9,
+    0x01, 0x2c, 0xf2, 0x02, 0x96, 0x68, 0x45, 0x02, 0x9a, 0x42, 0x96, 0x6e,
+    0x97, 0x05, 0x22, 0xdb, 0x02, 0x96, 0x7a, 0x91, 0x05, 0x22, 0xbb, 0x02,
+    0x96, 0x8d, 0x8b, 0x05, 0x22, 0x62, 0x02, 0x96, 0x99, 0x9b, 0x05, 0x22,
+    0x33, 0x02, 0x96, 0xac, 0x97, 0x05, 0x22, 0x03, 0x02, 0x96, 0xbf, 0x91,
+    0x05, 0x21, 0xeb, 0x02, 0x96, 0xd5, 0x8b, 0x05, 0x21, 0x9a, 0x02, 0x96,
+    0xe1, 0x9b, 0x05, 0x1d, 0x3b, 0x02, 0x96, 0xf4, 0x97, 0x05, 0x1d, 0x0b,
+    0x02, 0x97, 0x07, 0x87, 0x05, 0x1c, 0xeb, 0x02, 0x97, 0x1a, 0x91, 0x05,
+    0x1c, 0xcb, 0x02, 0x97, 0x26, 0x83, 0x05, 0x1c, 0xb2, 0x02, 0x97, 0x2e,
+    0xc2, 0x02, 0x0a, 0x05, 0x12, 0xf3, 0x02, 0x97, 0x3a, 0x83, 0x05, 0x13,
+    0x13, 0x02, 0x97, 0x42, 0xc2, 0x01, 0xba, 0x05, 0x13, 0x33, 0x02, 0x97,
+    0x4e, 0x91, 0x05, 0x13, 0x4b, 0x02, 0x97, 0x56, 0x87, 0x05, 0x13, 0x62,
+    0x02, 0x97, 0x62, 0x8b, 0x05, 0x17, 0x7b, 0x02, 0x97, 0x6a, 0x83, 0x05,
+    0x17, 0xb3, 0x02, 0x97, 0x7d, 0x97, 0x05, 0x17, 0xfb, 0x02, 0x97, 0x89,
+    0x11, 0xc2, 0x97, 0x9f, 0x87, 0x05, 0x17, 0xeb, 0x02, 0x97, 0xa7, 0x9b,
+    0x05, 0x18, 0x2a, 0x02, 0x97, 0xab, 0x8b, 0x05, 0x03, 0xc3, 0x02, 0x97,
+    0xbe, 0x83, 0x05, 0x03, 0xfb, 0x02, 0x97, 0xd1, 0x91, 0x05, 0x04, 0x1b,
+    0x02, 0x97, 0xdd, 0x97, 0x05, 0x04, 0x3b, 0x02, 0x97, 0xe9, 0x9b, 0x05,
+    0x04, 0x6a, 0x02, 0x97, 0xfc, 0x8b, 0x05, 0x0a, 0x9b, 0x02, 0x98, 0x0f,
+    0x83, 0x05, 0x0a, 0xcb, 0x02, 0x98, 0x22, 0x91, 0x05, 0x0a, 0xeb, 0x02,
+    0x98, 0x2e, 0x87, 0x05, 0x0b, 0x03, 0x02, 0x98, 0x3a, 0x97, 0x05, 0x0b,
+    0x22, 0x02, 0x98, 0x42, 0x96, 0x05, 0x0b, 0xe9, 0x9a, 0x05, 0x0b, 0xf1,
+    0x92, 0x05, 0x0c, 0x01, 0x87, 0x05, 0x0c, 0x12, 0x02, 0x98, 0x55, 0x9a,
+    0x05, 0x0c, 0x21, 0x92, 0x05, 0x0c, 0x30, 0x91, 0x05, 0x0c, 0x43, 0x02,
+    0x98, 0x5d, 0x96, 0x05, 0x0c, 0x89, 0x9a, 0x05, 0x0c, 0x91, 0x92, 0x05,
+    0x0c, 0xa1, 0x94, 0x05, 0x0c, 0xb2, 0x02, 0x98, 0x65, 0x96, 0x05, 0x0c,
+    0x51, 0x9a, 0x05, 0x0c, 0x59, 0x92, 0x05, 0x0c, 0x68, 0x9a, 0x05, 0x0c,
+    0x71, 0x92, 0x05, 0x0c, 0x80, 0x9b, 0x05, 0x21, 0x7b, 0x02, 0x98, 0x69,
+    0x97, 0x05, 0x21, 0x4b, 0x02, 0x98, 0x75, 0x91, 0x05, 0x21, 0x2b, 0x02,
+    0x98, 0x8f, 0x8b, 0x05, 0x20, 0xd2, 0x02, 0x98, 0x9b, 0x94, 0x05, 0x1f,
+    0xdb, 0x02, 0x98, 0xae, 0x92, 0x05, 0x1f, 0xc9, 0x9a, 0x05, 0x1f, 0xb9,
+    0x96, 0x05, 0x1f, 0xb0, 0x94, 0x05, 0x1f, 0xab, 0x02, 0x98, 0xb2, 0x92,
+    0x05, 0x1f, 0x99, 0x9a, 0x05, 0x1f, 0x89, 0x96, 0x05, 0x1f, 0x81, 0x91,
+    0x05, 0x1f, 0x52, 0x02, 0x98, 0xb6, 0x92, 0x05, 0x1f, 0x79, 0x9a, 0x05,
+    0x1f, 0x69, 0x96, 0x05, 0x1f, 0x60, 0x87, 0x05, 0x1f, 0x33, 0x02, 0x98,
+    0xc2, 0x92, 0x05, 0x1f, 0x19, 0x9a, 0x05, 0x1f, 0x09, 0x96, 0x05, 0x1f,
+    0x00, 0x94, 0x05, 0x20, 0xbb, 0x02, 0x98, 0xce, 0x92, 0x05, 0x20, 0xa9,
+    0x9a, 0x05, 0x20, 0x99, 0x96, 0x05, 0x20, 0x90, 0x94, 0x05, 0x20, 0x8b,
+    0x02, 0x98, 0xd2, 0x92, 0x05, 0x20, 0x79, 0x9a, 0x05, 0x20, 0x69, 0x96,
+    0x05, 0x20, 0x61, 0x91, 0x05, 0x20, 0x32, 0x02, 0x98, 0xd6, 0x92, 0x05,
+    0x20, 0x59, 0x9a, 0x05, 0x20, 0x49, 0x96, 0x05, 0x20, 0x40, 0x87, 0x05,
+    0x20, 0x13, 0x02, 0x98, 0xe2, 0x92, 0x05, 0x1f, 0xf9, 0x9a, 0x05, 0x1f,
+    0xe9, 0x96, 0x05, 0x1f, 0xe0, 0x94, 0x05, 0x1e, 0xfb, 0x02, 0x98, 0xee,
+    0x92, 0x05, 0x1e, 0xe9, 0x9a, 0x05, 0x1e, 0xd9, 0x96, 0x05, 0x1e, 0xd0,
+    0x94, 0x05, 0x1e, 0xcb, 0x02, 0x98, 0xf2, 0x92, 0x05, 0x1e, 0xb9, 0x9a,
+    0x05, 0x1e, 0xa9, 0x96, 0x05, 0x1e, 0xa1, 0x91, 0x05, 0x1e, 0x5a, 0x02,
+    0x98, 0xf6, 0x92, 0x05, 0x1e, 0x99, 0x9a, 0x05, 0x1e, 0x88, 0x92, 0x05,
+    0x1e, 0x81, 0x9a, 0x05, 0x1e, 0x71, 0x96, 0x05, 0x1e, 0x68, 0x92, 0x05,
+    0x1e, 0x49, 0x9a, 0x05, 0x1e, 0x39, 0x96, 0x05, 0x1e, 0x30, 0x9b, 0x05,
+    0x1c, 0x83, 0x02, 0x98, 0xfe, 0x97, 0x05, 0x1c, 0x53, 0x02, 0x99, 0x11,
+    0x87, 0x05, 0x1c, 0x33, 0x02, 0x99, 0x2b, 0x91, 0x05, 0x1c, 0x13, 0x02,
+    0x99, 0x37, 0x83, 0x05, 0x1b, 0xea, 0x02, 0x99, 0x43, 0x9b, 0x05, 0x1e,
+    0x13, 0x02, 0x99, 0x47, 0x97, 0x05, 0x1d, 0xe3, 0x02, 0x99, 0x5a, 0x87,
+    0x05, 0x1d, 0xc3, 0x02, 0x99, 0x74, 0x91, 0x05, 0x1d, 0xa3, 0x02, 0x99,
+    0x80, 0x83, 0x05, 0x1d, 0x6a, 0x02, 0x99, 0x8c, 0x9b, 0x05, 0x1a, 0x13,
+    0x02, 0x99, 0x98, 0x8b, 0x05, 0x19, 0x63, 0x02, 0x99, 0xab, 0x83, 0x05,
+    0x19, 0x9b, 0x02, 0x99, 0xbe, 0x91, 0x05, 0x19, 0xbb, 0x02, 0x99, 0xca,
+    0x87, 0x05, 0x19, 0xd3, 0x02, 0x99, 0xd6, 0x97, 0x05, 0x19, 0xf2, 0x02,
+    0x99, 0xde, 0x96, 0x05, 0x18, 0x49, 0x9a, 0x05, 0x18, 0x51, 0x92, 0x05,
+    0x18, 0x61, 0x87, 0x05, 0x18, 0x72, 0x02, 0x99, 0xea, 0x96, 0x05, 0x18,
+    0x81, 0x9a, 0x05, 0x18, 0x89, 0x92, 0x05, 0x18, 0x98, 0x91, 0x05, 0x18,
+    0xab, 0x02, 0x99, 0xf2, 0x96, 0x05, 0x18, 0xf1, 0x9a, 0x05, 0x18, 0xf9,
+    0x92, 0x05, 0x19, 0x09, 0x94, 0x05, 0x19, 0x1a, 0x02, 0x99, 0xfa, 0x96,
+    0x05, 0x18, 0xb9, 0x9a, 0x05, 0x18, 0xc1, 0x92, 0x05, 0x18, 0xd0, 0x9a,
+    0x05, 0x18, 0xd9, 0x92, 0x05, 0x18, 0xe8, 0x96, 0x05, 0x19, 0x21, 0x9a,
+    0x05, 0x19, 0x29, 0x92, 0x05, 0x19, 0x39, 0x94, 0x05, 0x19, 0x4a, 0x02,
+    0x99, 0xfe, 0x9b, 0x05, 0x1b, 0xc3, 0x02, 0x9a, 0x02, 0x97, 0x05, 0x1b,
+    0x93, 0x02, 0x9a, 0x15, 0x87, 0x05, 0x1b, 0x7b, 0x02, 0x9a, 0x2b, 0x91,
+    0x05, 0x1b, 0x5b, 0x02, 0x9a, 0x37, 0x83, 0x05, 0x1b, 0x1a, 0x02, 0x9a,
+    0x43, 0x94, 0x05, 0x16, 0x7b, 0x02, 0x9a, 0x4f, 0x96, 0x05, 0x16, 0x51,
+    0x9a, 0x05, 0x16, 0x59, 0x92, 0x05, 0x16, 0x68, 0x92, 0x05, 0x16, 0x19,
+    0x9a, 0x05, 0x16, 0x08, 0x96, 0x05, 0x16, 0x21, 0x9a, 0x05, 0x16, 0x29,
+    0x92, 0x05, 0x16, 0x39, 0x94, 0x05, 0x16, 0x4b, 0x02, 0x9a, 0x53, 0x91,
+    0x05, 0x15, 0xda, 0x02, 0x9a, 0x57, 0x96, 0x05, 0x15, 0x71, 0x9a, 0x05,
+    0x15, 0x79, 0x92, 0x05, 0x15, 0x89, 0x87, 0x05, 0x15, 0xa2, 0x02, 0x9a,
+    0x5f, 0x96, 0x05, 0x15, 0xb1, 0x9a, 0x05, 0x15, 0xb9, 0x92, 0x05, 0x15,
+    0xc8, 0x96, 0x05, 0x15, 0xe9, 0x9a, 0x05, 0x15, 0xf1, 0x92, 0x05, 0x16,
+    0x00, 0x9a, 0x05, 0x14, 0xf9, 0x92, 0x05, 0x15, 0x08, 0x92, 0x05, 0x14,
+    0xf1, 0x9a, 0x05, 0x14, 0xe1, 0x96, 0x05, 0x14, 0xd8, 0x91, 0x05, 0x14,
+    0xcb, 0x02, 0x9a, 0x6b, 0x96, 0x05, 0x15, 0x11, 0x9a, 0x05, 0x15, 0x19,
+    0x92, 0x05, 0x15, 0x29, 0x94, 0x05, 0x15, 0x3a, 0x02, 0x9a, 0x73, 0x92,
+    0x05, 0x14, 0xb9, 0x9a, 0x05, 0x14, 0xa9, 0x96, 0x05, 0x14, 0xa0, 0x87,
+    0x05, 0x14, 0x93, 0x02, 0x9a, 0x77, 0x92, 0x05, 0x14, 0x81, 0x9a, 0x05,
+    0x14, 0x71, 0x96, 0x05, 0x14, 0x68, 0x91, 0x05, 0x16, 0xeb, 0x02, 0x9a,
+    0x7f, 0x83, 0x05, 0x16, 0xd3, 0x02, 0x9a, 0x87, 0x8b, 0x05, 0x16, 0x93,
+    0x02, 0x9a, 0x93, 0x87, 0x05, 0x17, 0x03, 0x02, 0x9a, 0xa6, 0x97, 0x05,
+    0x17, 0x1b, 0x02, 0x9a, 0xae, 0x9b, 0x05, 0x17, 0x4a, 0x02, 0x9a, 0xbd,
+    0x9b, 0x05, 0x1a, 0xeb, 0x02, 0x9a, 0xd0, 0x97, 0x05, 0x1a, 0xbb, 0x02,
+    0x9a, 0xe3, 0x87, 0x05, 0x1a, 0x9b, 0x02, 0x9a, 0xfd, 0x91, 0x05, 0x1a,
+    0x7b, 0x02, 0x9b, 0x09, 0x83, 0x05, 0x1a, 0x42, 0x02, 0x9b, 0x15, 0x96,
+    0x05, 0x15, 0x41, 0x9a, 0x05, 0x15, 0x49, 0x92, 0x05, 0x15, 0x59, 0x94,
+    0x05, 0x15, 0x6a, 0x02, 0x9b, 0x21, 0x92, 0x05, 0x14, 0x61, 0x9a, 0x05,
+    0x14, 0x50, 0x92, 0x05, 0x14, 0x49, 0x9a, 0x05, 0x14, 0x38, 0x91, 0x05,
+    0x14, 0x2a, 0x02, 0x9b, 0x25, 0x92, 0x05, 0x14, 0x19, 0x9a, 0x05, 0x14,
+    0x09, 0x96, 0x05, 0x14, 0x00, 0x92, 0x05, 0x13, 0xf9, 0x9a, 0x05, 0x13,
+    0xe8, 0x87, 0x05, 0x12, 0xdb, 0x02, 0x9b, 0x2d, 0x91, 0x05, 0x12, 0xc3,
+    0x02, 0x9b, 0x35, 0xc2, 0x01, 0xba, 0x05, 0x12, 0xa3, 0x02, 0x9b, 0x41,
+    0x83, 0x05, 0x12, 0x83, 0x02, 0x9b, 0x4d, 0x8b, 0x05, 0x12, 0x42, 0x02,
+    0x9b, 0x59, 0x96, 0x05, 0x13, 0x71, 0x87, 0x05, 0x13, 0x82, 0x02, 0x9b,
+    0x6c, 0x96, 0x05, 0x13, 0x89, 0x9a, 0x05, 0x13, 0x91, 0x92, 0x05, 0x13,
+    0xa0, 0x96, 0x05, 0x13, 0xa9, 0x9a, 0x05, 0x13, 0xb1, 0x92, 0x05, 0x13,
+    0xc0, 0x96, 0x05, 0x13, 0xc9, 0x9a, 0x05, 0x13, 0xd1, 0x92, 0x05, 0x13,
+    0xe0, 0x8b, 0x05, 0x04, 0x9b, 0x02, 0x9b, 0x70, 0x83, 0x05, 0x04, 0xd3,
+    0x02, 0x9b, 0x83, 0x97, 0x05, 0x05, 0x2b, 0x02, 0x9b, 0x8f, 0x91, 0x05,
+    0x05, 0x0b, 0x02, 0x9b, 0xa9, 0x9b, 0x05, 0x05, 0x52, 0x02, 0x9b, 0xb5,
+    0x8b, 0x05, 0x0b, 0x53, 0x02, 0x9b, 0xc4, 0x83, 0x05, 0x0b, 0x93, 0x02,
+    0x9b, 0xd7, 0x17, 0xc2, 0x9b, 0xe3, 0x11, 0xc2, 0x9b, 0xee, 0x87, 0x05,
+    0x0b, 0xd2, 0x02, 0x9b, 0xfa, 0x8b, 0x05, 0x0c, 0xcb, 0x02, 0x9c, 0x02,
+    0x83, 0x05, 0x0d, 0x03, 0x02, 0x9c, 0x15, 0x97, 0x05, 0x0d, 0x6b, 0x02,
+    0x9c, 0x21, 0x91, 0x05, 0x0d, 0x33, 0x02, 0x9c, 0x3b, 0x87, 0x05, 0x0d,
+    0x4b, 0x02, 0x9c, 0x43, 0x9b, 0x05, 0x0d, 0x9a, 0x02, 0x9c, 0x4b, 0x87,
+    0x05, 0x23, 0xbb, 0x02, 0x9c, 0x5e, 0x92, 0x05, 0x23, 0xa1, 0x9a, 0x05,
+    0x23, 0x91, 0x96, 0x05, 0x23, 0x88, 0x91, 0x05, 0x23, 0xdb, 0x02, 0x9c,
+    0x6a, 0x96, 0x05, 0x24, 0x09, 0x9a, 0x05, 0x24, 0x11, 0x92, 0x05, 0x24,
+    0x21, 0x94, 0x05, 0x24, 0x32, 0x02, 0x9c, 0x76, 0x96, 0x05, 0x23, 0xe9,
+    0x9a, 0x05, 0x23, 0xf1, 0x92, 0x05, 0x24, 0x00, 0x96, 0x05, 0x24, 0x39,
+    0x9a, 0x05, 0x24, 0x41, 0x92, 0x05, 0x24, 0x51, 0x94, 0x05, 0x24, 0x62,
+    0x02, 0x9c, 0x7a, 0x94, 0x05, 0x23, 0x83, 0x02, 0x9c, 0x7e, 0x92, 0x05,
+    0x23, 0x71, 0x9a, 0x05, 0x23, 0x61, 0x96, 0x05, 0x23, 0x58, 0x96, 0x05,
+    0x22, 0xe9, 0x9a, 0x05, 0x22, 0xf1, 0x92, 0x05, 0x23, 0x01, 0x87, 0x05,
+    0x23, 0x1a, 0x02, 0x9c, 0x82, 0x9a, 0x05, 0x23, 0x41, 0x92, 0x05, 0x23,
+    0x51, 0x96, 0x05, 0x23, 0x38, 0x9a, 0x05, 0x23, 0x28, 0x97, 0x05, 0x12,
+    0x13, 0x02, 0x9c, 0x8e, 0xc2, 0x02, 0x0a, 0x05, 0x11, 0x8b, 0x02, 0x9c,
+    0xa8, 0x83, 0x05, 0x11, 0xa3, 0x02, 0x9c, 0xac, 0x91, 0x05, 0x11, 0xdb,
+    0x02, 0x9c, 0xb8, 0x87, 0x05, 0x11, 0xf2, 0x02, 0x9c, 0xc4, 0x96, 0x05,
+    0x05, 0x71, 0x9a, 0x05, 0x05, 0x79, 0x92, 0x05, 0x05, 0x89, 0x87, 0x05,
+    0x05, 0x9a, 0x02, 0x9c, 0xcc, 0x96, 0x05, 0x05, 0xa9, 0x9a, 0x05, 0x05,
+    0xb1, 0x92, 0x05, 0x05, 0xc0, 0x91, 0x05, 0x05, 0xdb, 0x02, 0x9c, 0xd4,
+    0x96, 0x05, 0x06, 0x19, 0x9a, 0x05, 0x06, 0x21, 0x92, 0x05, 0x06, 0x31,
+    0x94, 0x05, 0x06, 0x42, 0x02, 0x9c, 0xe0, 0x96, 0x05, 0x05, 0xe9, 0x9a,
+    0x05, 0x05, 0xf1, 0x92, 0x05, 0x06, 0x00, 0x9a, 0x05, 0x06, 0x08, 0x96,
+    0x05, 0x06, 0x49, 0x9a, 0x05, 0x06, 0x51, 0x92, 0x05, 0x06, 0x60, 0xcc,
+    0x1c, 0x94, 0x05, 0x00, 0xa8, 0x96, 0x05, 0x00, 0x21, 0x9a, 0x05, 0x00,
+    0x29, 0x92, 0x05, 0x00, 0x38, 0x96, 0x05, 0x00, 0xb1, 0x9a, 0x05, 0x00,
+    0xb9, 0x92, 0x05, 0x00, 0xc9, 0x87, 0x05, 0x00, 0xe2, 0x02, 0x9c, 0xe4,
+    0x96, 0x05, 0x00, 0xf1, 0x9a, 0x05, 0x00, 0xf9, 0x92, 0x05, 0x01, 0x08,
+    0x91, 0x05, 0x01, 0x1b, 0x02, 0x9c, 0xf0, 0x96, 0x05, 0x01, 0x61, 0x9a,
+    0x05, 0x01, 0x69, 0x92, 0x05, 0x01, 0x79, 0x94, 0x05, 0x01, 0x8a, 0x02,
+    0x9c, 0xf8, 0x96, 0x05, 0x01, 0x29, 0x9a, 0x05, 0x01, 0x31, 0x92, 0x05,
+    0x01, 0x40, 0x9a, 0x05, 0x01, 0x49, 0x92, 0x05, 0x01, 0x58, 0x96, 0x05,
+    0x01, 0x91, 0x9a, 0x05, 0x01, 0x99, 0x92, 0x05, 0x01, 0xa9, 0x94, 0x05,
+    0x01, 0xba, 0x02, 0x9c, 0xfc, 0x8b, 0x05, 0x02, 0xc3, 0x02, 0x9d, 0x00,
+    0x83, 0x05, 0x03, 0x03, 0x02, 0x9d, 0x13, 0x97, 0x05, 0x03, 0x73, 0x02,
+    0x9d, 0x1f, 0x91, 0x05, 0x03, 0x3b, 0x02, 0x9d, 0x39, 0x87, 0x05, 0x03,
+    0x53, 0x02, 0x9d, 0x45, 0x9b, 0x05, 0x03, 0xa2, 0x02, 0x9d, 0x4d, 0x96,
+    0x05, 0x01, 0xc1, 0x9a, 0x05, 0x01, 0xc9, 0x92, 0x05, 0x01, 0xd9, 0x87,
+    0x05, 0x01, 0xea, 0x02, 0x9d, 0x59, 0x96, 0x05, 0x01, 0xf9, 0x9a, 0x05,
+    0x02, 0x01, 0x92, 0x05, 0x02, 0x10, 0x91, 0x05, 0x02, 0x23, 0x02, 0x9d,
+    0x61, 0x96, 0x05, 0x02, 0x51, 0x9a, 0x05, 0x02, 0x59, 0x92, 0x05, 0x02,
+    0x69, 0x94, 0x05, 0x02, 0x7a, 0x02, 0x9d, 0x69, 0x96, 0x05, 0x02, 0x31,
+    0x9a, 0x05, 0x02, 0x39, 0x92, 0x05, 0x02, 0x48, 0x96, 0x05, 0x02, 0x81,
+    0x9a, 0x05, 0x02, 0x89, 0x92, 0x05, 0x02, 0x99, 0x94, 0x05, 0x02, 0xaa,
+    0x02, 0x9d, 0x6d, 0x96, 0x05, 0x06, 0x69, 0x9a, 0x05, 0x06, 0x71, 0x92,
+    0x05, 0x06, 0x80, 0x96, 0x05, 0x06, 0x89, 0x9a, 0x05, 0x06, 0x91, 0x92,
+    0x05, 0x06, 0xa0, 0x9a, 0x05, 0x06, 0xa9, 0x92, 0x05, 0x06, 0xb8, 0x96,
+    0x05, 0x06, 0xc1, 0x9a, 0x05, 0x06, 0xc9, 0x92, 0x05, 0x06, 0xd9, 0x94,
+    0x05, 0x06, 0xea, 0x02, 0x9d, 0x71, 0x96, 0x05, 0x06, 0xf1, 0x9a, 0x05,
+    0x06, 0xf9, 0x92, 0x05, 0x07, 0x08, 0x96, 0x05, 0x07, 0x11, 0x9a, 0x05,
+    0x07, 0x19, 0x92, 0x05, 0x07, 0x29, 0x87, 0x05, 0x07, 0x42, 0x02, 0x9d,
+    0x75, 0x96, 0x05, 0x07, 0x51, 0x9a, 0x05, 0x07, 0x59, 0x92, 0x05, 0x07,
+    0x68, 0x96, 0x05, 0x07, 0x71, 0x9a, 0x05, 0x07, 0x79, 0x92, 0x05, 0x07,
+    0x88, 0x9a, 0x05, 0x07, 0x91, 0x92, 0x05, 0x07, 0x98, 0x96, 0x05, 0x07,
+    0xa1, 0x9a, 0x05, 0x07, 0xa9, 0x92, 0x05, 0x07, 0xb9, 0x94, 0x05, 0x07,
+    0xca, 0x02, 0x9d, 0x81, 0x96, 0x05, 0x07, 0xd1, 0x9a, 0x05, 0x07, 0xd9,
+    0x92, 0x05, 0x07, 0xe9, 0x94, 0x05, 0x07, 0xfa, 0x02, 0x9d, 0x85, 0x96,
+    0x05, 0x08, 0x01, 0x9a, 0x05, 0x08, 0x09, 0x92, 0x05, 0x08, 0x19, 0x87,
+    0x05, 0x08, 0x2a, 0x02, 0x9d, 0x89, 0x96, 0x05, 0x08, 0x39, 0x9a, 0x05,
+    0x08, 0x41, 0x92, 0x05, 0x08, 0x50, 0x91, 0x05, 0x08, 0x63, 0x02, 0x9d,
+    0x91, 0x96, 0x05, 0x08, 0xa1, 0x9a, 0x05, 0x08, 0xa9, 0x92, 0x05, 0x08,
+    0xb9, 0x94, 0x05, 0x08, 0xca, 0x02, 0x9d, 0x95, 0x96, 0x05, 0x08, 0x69,
+    0x9a, 0x05, 0x08, 0x71, 0x92, 0x05, 0x08, 0x80, 0x9a, 0x05, 0x08, 0x89,
+    0x92, 0x05, 0x08, 0x98, 0x8b, 0x05, 0x09, 0xc3, 0x02, 0x9d, 0x99, 0x83,
+    0x05, 0x09, 0xfb, 0x02, 0x9d, 0xac, 0x97, 0x05, 0x0a, 0x6b, 0x02, 0x9d,
+    0xb8, 0x91, 0x05, 0x0a, 0x33, 0x02, 0x9d, 0xd2, 0x87, 0x05, 0x0a, 0x4a,
+    0x02, 0x9d, 0xde, 0x96, 0x05, 0x08, 0xd1, 0x9a, 0x05, 0x08, 0xd9, 0x92,
+    0x05, 0x08, 0xe9, 0x87, 0x05, 0x08, 0xfa, 0x02, 0x9d, 0xe6, 0x96, 0x05,
+    0x09, 0x09, 0x9a, 0x05, 0x09, 0x11, 0x92, 0x05, 0x09, 0x20, 0x91, 0x05,
+    0x09, 0x3b, 0x02, 0x9d, 0xee, 0x96, 0x05, 0x09, 0x81, 0x9a, 0x05, 0x09,
+    0x89, 0x92, 0x05, 0x09, 0x99, 0x94, 0x05, 0x09, 0xaa, 0x02, 0x9d, 0xfa,
+    0x96, 0x05, 0x09, 0x49, 0x9a, 0x05, 0x09, 0x51, 0x92, 0x05, 0x09, 0x60,
+    0x9a, 0x05, 0x09, 0x69, 0x92, 0x05, 0x09, 0x78, 0x96, 0x05, 0x0d, 0xb9,
+    0x9a, 0x05, 0x0d, 0xc1, 0x92, 0x05, 0x0d, 0xd1, 0x87, 0x05, 0x0d, 0xea,
+    0x02, 0x9d, 0xfe, 0x96, 0x05, 0x0d, 0xf9, 0x9a, 0x05, 0x0e, 0x01, 0x92,
+    0x05, 0x0e, 0x10, 0x91, 0x05, 0x0e, 0x2b, 0x02, 0x9e, 0x0a, 0x96, 0x05,
+    0x0e, 0x71, 0x9a, 0x05, 0x0e, 0x79, 0x92, 0x05, 0x0e, 0x89, 0x94, 0x05,
+    0x0e, 0x9a, 0x02, 0x9e, 0x16, 0x96, 0x05, 0x0e, 0x39, 0x9a, 0x05, 0x0e,
+    0x41, 0x92, 0x05, 0x0e, 0x50, 0x9a, 0x05, 0x0e, 0x59, 0x92, 0x05, 0x0e,
+    0x68, 0x96, 0x05, 0x0e, 0xa1, 0x9a, 0x05, 0x0e, 0xa9, 0x92, 0x05, 0x0e,
+    0xb9, 0x94, 0x05, 0x0e, 0xca, 0x02, 0x9e, 0x1a, 0x96, 0x05, 0x0e, 0xd1,
+    0x9a, 0x05, 0x0e, 0xd9, 0x92, 0x05, 0x0e, 0xe9, 0x87, 0x05, 0x0f, 0x02,
+    0x02, 0x9e, 0x1e, 0x96, 0x05, 0x0f, 0x11, 0x9a, 0x05, 0x0f, 0x19, 0x92,
+    0x05, 0x0f, 0x28, 0x91, 0x05, 0x0f, 0x43, 0x02, 0x9e, 0x2a, 0x96, 0x05,
+    0x0f, 0x91, 0x9a, 0x05, 0x0f, 0x99, 0x92, 0x05, 0x0f, 0xa9, 0x94, 0x05,
+    0x0f, 0xba, 0x02, 0x9e, 0x36, 0x96, 0x05, 0x0f, 0x51, 0x9a, 0x05, 0x0f,
+    0x59, 0x92, 0x05, 0x0f, 0x68, 0x96, 0x05, 0x0f, 0x71, 0x9a, 0x05, 0x0f,
+    0x79, 0x92, 0x05, 0x0f, 0x88, 0x8b, 0x05, 0x10, 0xb3, 0x02, 0x9e, 0x3a,
+    0x83, 0x05, 0x10, 0xe3, 0x02, 0x9e, 0x49, 0x97, 0x05, 0x11, 0x63, 0x02,
+    0x9e, 0x55, 0x91, 0x05, 0x11, 0x23, 0x02, 0x9e, 0x6f, 0x87, 0x05, 0x11,
+    0x42, 0x02, 0x9e, 0x7b, 0x96, 0x05, 0x0f, 0xc1, 0x9a, 0x05, 0x0f, 0xc9,
+    0x92, 0x05, 0x0f, 0xd9, 0x87, 0x05, 0x0f, 0xea, 0x02, 0x9e, 0x87, 0x96,
+    0x05, 0x0f, 0xf9, 0x9a, 0x05, 0x10, 0x01, 0x92, 0x05, 0x10, 0x10, 0x91,
+    0x05, 0x10, 0x23, 0x02, 0x9e, 0x8f, 0x96, 0x05, 0x10, 0x71, 0x9a, 0x05,
+    0x10, 0x79, 0x92, 0x05, 0x10, 0x89, 0x94, 0x05, 0x10, 0x9a, 0x02, 0x9e,
+    0x97, 0x96, 0x05, 0x10, 0x31, 0x9a, 0x05, 0x10, 0x39, 0x92, 0x05, 0x10,
+    0x48, 0x96, 0x05, 0x10, 0x51, 0x9a, 0x05, 0x10, 0x59, 0x92, 0x05, 0x10,
+    0x68, 0x87, 0x05, 0x25, 0xd8, 0xc2, 0x00, 0x7e, 0x05, 0x24, 0x99, 0xc2,
+    0x00, 0x11, 0x05, 0x25, 0x38, 0x92, 0x05, 0x24, 0xa1, 0x96, 0x05, 0x25,
+    0x18, 0x9b, 0x05, 0x25, 0x81, 0xc2, 0x00, 0x33, 0x05, 0x25, 0xd1, 0xc2,
+    0x00, 0xfe, 0x05, 0x26, 0x01, 0xc2, 0x00, 0x11, 0x05, 0x26, 0x10, 0xc2,
+    0x00, 0x11, 0x05, 0x24, 0xb1, 0xc2, 0x01, 0xba, 0x05, 0x25, 0x30, 0xc2,
+    0x00, 0x8d, 0x05, 0x24, 0xc9, 0xc2, 0x01, 0xba, 0x05, 0x24, 0xf9, 0xc2,
+    0x00, 0x11, 0x05, 0x25, 0xf8, 0x92, 0x05, 0x25, 0x11, 0x94, 0x05, 0x26,
+    0x08, 0xc2, 0x00, 0xa4, 0x05, 0x25, 0x51, 0x9b, 0x05, 0x25, 0xa9, 0xc2,
+    0x02, 0x0a, 0x05, 0x25, 0xb8, 0x8e, 0x08, 0x74, 0x60, 0xc3, 0x32, 0xce,
+    0x08, 0x74, 0x41, 0xc2, 0x03, 0x4e, 0x08, 0x74, 0x38, 0x44, 0xe1, 0x77,
+    0x42, 0x9e, 0x9b, 0x8b, 0x00, 0xa7, 0x70, 0x91, 0x00, 0xa8, 0xeb, 0x02,
+    0x9e, 0xb9, 0x83, 0x00, 0xa9, 0x0b, 0x02, 0x9e, 0xc1, 0x8b, 0x00, 0xa8,
+    0xcb, 0x02, 0x9e, 0xc5, 0x87, 0x00, 0xa8, 0xb8, 0x9b, 0x00, 0xc6, 0x09,
+    0x83, 0x00, 0xa8, 0xb0, 0x9b, 0x00, 0xc6, 0x01, 0x91, 0x00, 0xa8, 0xa0,
+    0x8b, 0x00, 0xa8, 0x90, 0xc2, 0x16, 0x1c, 0x00, 0xa4, 0x29, 0xc2, 0x14,
+    0x77, 0x00, 0xa4, 0x31, 0xc2, 0x38, 0x2a, 0x00, 0xa4, 0x39, 0xc2, 0x02,
+    0x98, 0x00, 0xa4, 0x40, 0x83, 0x00, 0xa8, 0x10, 0x8b, 0x00, 0xa7, 0xd0,
+    0x91, 0x00, 0xa7, 0xf0, 0x43, 0x67, 0xcd, 0xc2, 0x9e, 0xc9, 0x0a, 0x42,
+    0x9e, 0xde, 0xc4, 0xdf, 0x5b, 0x00, 0xa9, 0xe9, 0x19, 0xc2, 0x9e, 0xf3,
+    0x15, 0xc2, 0x9e, 0xff, 0xc4, 0xe0, 0xc3, 0x00, 0xa4, 0x11, 0xc4, 0xe3,
+    0x43, 0x00, 0xa5, 0x01, 0xc4, 0xda, 0xeb, 0x00, 0xa5, 0xd1, 0xc4, 0xe4,
+    0x67, 0x00, 0xa6, 0x79, 0xc4, 0xde, 0xb6, 0x00, 0xa3, 0x28, 0x8b, 0x00,
+    0xa6, 0x08, 0x91, 0x00, 0xc6, 0x60, 0x8b, 0x00, 0xc6, 0x40, 0x83, 0x00,
+    0xa6, 0x68, 0x83, 0x00, 0xb3, 0xb0, 0x91, 0x00, 0xb3, 0xa0, 0x8b, 0x00,
+    0xb3, 0x90, 0x8b, 0x00, 0xb3, 0x81, 0x83, 0x00, 0xac, 0xa2, 0x02, 0x9f,
+    0x26, 0x91, 0x00, 0xac, 0x90, 0x8b, 0x00, 0xac, 0x80, 0x83, 0x00, 0xab,
+    0xcb, 0x02, 0x9f, 0x2a, 0x91, 0x00, 0xab, 0xbb, 0x02, 0x9f, 0x2e, 0x8b,
+    0x00, 0xab, 0xab, 0x02, 0x9f, 0x32, 0x87, 0x00, 0xab, 0xa0, 0x8b, 0x00,
+    0xab, 0x18, 0x06, 0xc2, 0x9f, 0x36, 0x0c, 0xc2, 0x9f, 0x46, 0x09, 0xc2,
+    0x9f, 0x67, 0x16, 0xc2, 0x9f, 0x89, 0x42, 0x11, 0xee, 0xc2, 0x9f, 0x99,
+    0x1b, 0xc2, 0x9f, 0xb0, 0x0f, 0xc2, 0x9f, 0xc7, 0x10, 0xc2, 0x9f, 0xde,
+    0x0d, 0xc2, 0x9f, 0xf9, 0x92, 0x00, 0xaf, 0x73, 0x02, 0xa0, 0x04, 0x8a,
+    0x00, 0xa2, 0x5b, 0x02, 0xa0, 0x1b, 0x19, 0xc2, 0xa0, 0x29, 0x14, 0xc2,
+    0xa0, 0x40, 0x0e, 0xc2, 0xa0, 0x57, 0xc2, 0x02, 0xe0, 0x00, 0xa0, 0x41,
+    0x8b, 0x00, 0xa0, 0x4b, 0x02, 0xa0, 0x72, 0x9c, 0x00, 0xb2, 0x33, 0x02,
+    0xa0, 0x78, 0x15, 0x42, 0xa0, 0x8f, 0x8b, 0x00, 0xa4, 0x50, 0x91, 0x00,
+    0xa4, 0xd0, 0x8b, 0x00, 0xa4, 0xb0, 0x83, 0x00, 0xa4, 0xf0, 0x83, 0x00,
+    0xad, 0xb9, 0x91, 0x00, 0xad, 0xb1, 0x8b, 0x00, 0xad, 0xa9, 0x87, 0x00,
+    0xad, 0xa0, 0x83, 0x00, 0xad, 0xf9, 0x91, 0x00, 0xad, 0xf1, 0x8b, 0x00,
+    0xad, 0xe9, 0x87, 0x00, 0xad, 0xe0, 0x83, 0x00, 0xad, 0xd9, 0x91, 0x00,
+    0xad, 0xd1, 0x8b, 0x00, 0xad, 0xc9, 0x87, 0x00, 0xad, 0xc0, 0x91, 0x00,
+    0xc7, 0x48, 0x83, 0x00, 0xab, 0x73, 0x02, 0xa0, 0xad, 0x91, 0x00, 0xab,
+    0x6b, 0x02, 0xa0, 0xb1, 0xc2, 0x00, 0x28, 0x00, 0xc7, 0x29, 0x8b, 0x00,
+    0xab, 0x61, 0x87, 0x00, 0xab, 0x58, 0x83, 0x00, 0xc7, 0x23, 0x02, 0xa0,
+    0xb5, 0x87, 0x00, 0xc7, 0x18, 0x83, 0x00, 0xad, 0x63, 0x02, 0xa0, 0xb9,
+    0x91, 0x00, 0xad, 0x53, 0x02, 0xa0, 0xbd, 0x8b, 0x00, 0xad, 0x43, 0x02,
+    0xa0, 0xc1, 0x87, 0x00, 0xad, 0x38, 0x83, 0x00, 0xab, 0x38, 0x91, 0x00,
+    0xab, 0x28, 0x8b, 0x00, 0xab, 0x10, 0x8b, 0x00, 0xa2, 0x68, 0x91, 0x00,
+    0xa2, 0xf8, 0x8b, 0x00, 0xa2, 0xd8, 0x83, 0x00, 0xa3, 0x18, 0x46, 0x92,
+    0x9a, 0xc2, 0xa0, 0xc5, 0xc5, 0xbc, 0x9d, 0x00, 0xc6, 0xe8, 0x48, 0xba,
+    0x1a, 0x42, 0xa1, 0x0c, 0x83, 0x00, 0xaa, 0x70, 0x91, 0x00, 0xc6, 0x90,
+    0x8b, 0x00, 0xc6, 0x80, 0x8b, 0x00, 0xaa, 0x28, 0x14, 0xc2, 0xa1, 0x1b,
+    0x15, 0xc2, 0xa1, 0x25, 0xc5, 0x31, 0xee, 0x00, 0xa0, 0xf9, 0xc5, 0x1f,
+    0x0c, 0x00, 0xa1, 0x01, 0xd0, 0x58, 0x02, 0x00, 0xa1, 0x09, 0xcd, 0x7f,
+    0x3f, 0x00, 0xa1, 0x11, 0x42, 0x00, 0x58, 0xc2, 0xa1, 0x31, 0xca, 0x3b,
+    0x06, 0x00, 0xa1, 0x39, 0xc4, 0x25, 0xd5, 0x00, 0xa1, 0x48, 0x8b, 0x00,
+    0xaa, 0xa0, 0x8a, 0x00, 0xc6, 0xd8, 0x19, 0x42, 0xa1, 0x3d, 0x8b, 0x00,
+    0xa9, 0x38, 0x83, 0x00, 0xa9, 0xd8, 0x91, 0x00, 0xa9, 0xb8, 0x8b, 0x00,
+    0xa9, 0x98, 0xc3, 0x14, 0x72, 0x00, 0xa2, 0x41, 0xc2, 0x01, 0x24, 0x00,
+    0xa1, 0xa8, 0x8b, 0x00, 0xa6, 0xa0, 0x83, 0x00, 0xad, 0x28, 0x91, 0x00,
+    0xad, 0x18, 0x8b, 0x00, 0xad, 0x08, 0x8b, 0x00, 0xa7, 0x00, 0x91, 0x00,
+    0xa7, 0x20, 0x83, 0x00, 0xa7, 0x40, 0x8b, 0x00, 0xa5, 0x20, 0x94, 0x00,
+    0xaa, 0x91, 0x8e, 0x00, 0xa7, 0x60, 0xca, 0xa5, 0x8a, 0x00, 0xa8, 0x48,
+    0x8b, 0x00, 0xa5, 0x80, 0x91, 0x00, 0xa5, 0xa0, 0x83, 0x00, 0xa5, 0xc0,
+    0x9b, 0x00, 0xc5, 0xc9, 0x83, 0x00, 0xa4, 0x00, 0x8b, 0x00, 0xa3, 0xc0,
+    0x91, 0x00, 0xa3, 0xe0, 0x8b, 0x00, 0xa3, 0x60, 0x9b, 0x00, 0xc5, 0xb1,
+    0x91, 0x00, 0xa2, 0x10, 0x83, 0x00, 0xa2, 0x30, 0x8b, 0x00, 0xa1, 0xf0,
+    0x8b, 0x00, 0xa1, 0x80, 0x8b, 0x00, 0xab, 0xf0, 0x97, 0x08, 0x15, 0xd9,
+    0x9f, 0x08, 0x16, 0x41, 0xa0, 0x08, 0x16, 0x80, 0xc3, 0x4b, 0x13, 0x08,
+    0x2a, 0x79, 0xc2, 0x0c, 0x42, 0x08, 0x2a, 0xa8, 0xc2, 0x00, 0x71, 0x08,
+    0x29, 0xb9, 0x83, 0x08, 0x29, 0xd8, 0x83, 0x08, 0x29, 0xcb, 0x02, 0xa1,
+    0x4b, 0xc2, 0x69, 0xa6, 0x08, 0x2a, 0x49, 0x8b, 0x08, 0x2a, 0x50, 0x94,
+    0x08, 0x2a, 0x11, 0xc2, 0x17, 0xb6, 0x08, 0x2b, 0x00, 0x9b, 0x08, 0x2a,
+    0x59, 0x99, 0x08, 0x2a, 0xf8, 0x83, 0x08, 0x29, 0xeb, 0x02, 0xa1, 0x4f,
+    0xc2, 0x69, 0xa6, 0x08, 0x2a, 0xe8, 0xc2, 0x02, 0xa0, 0x01, 0x74, 0x19,
+    0xc4, 0x02, 0xde, 0x01, 0x74, 0x20, 0xce, 0x70, 0x88, 0x01, 0x75, 0x31,
+    0xc3, 0x00, 0xbf, 0x01, 0x76, 0x30, 0xc3, 0xac, 0xc1, 0x01, 0x76, 0x61,
+    0xc4, 0x8e, 0x34, 0x01, 0x77, 0x40, 0x89, 0x01, 0x8f, 0x08, 0x83, 0x05,
+    0x5b, 0xb1, 0x87, 0x05, 0x5b, 0xc1, 0x8b, 0x05, 0x5b, 0xc9, 0x91, 0x05,
+    0x5b, 0xd1, 0x97, 0x05, 0x5b, 0xd9, 0x98, 0x05, 0x5b, 0xe0, 0x83, 0x05,
+    0x5d, 0xf9, 0x87, 0x00, 0x9f, 0xc1, 0x8b, 0x00, 0x9f, 0xc9, 0x91, 0x00,
+    0x9f, 0xd1, 0x97, 0x00, 0x9f, 0xd9, 0x98, 0x00, 0x9f, 0xe0, 0x98, 0x05,
+    0x5d, 0xf1, 0x97, 0x05, 0x5d, 0xe9, 0x91, 0x05, 0x5d, 0xe1, 0x8b, 0x05,
+    0x5d, 0xd9, 0x87, 0x05, 0x5d, 0xd1, 0x83, 0x05, 0x5d, 0xc8, 0x15, 0xc2,
+    0xa1, 0x53, 0x0e, 0xc2, 0xa1, 0x6b, 0x83, 0x05, 0x5d, 0x21, 0x8b, 0x05,
+    0x5d, 0x41, 0x87, 0x05, 0x5d, 0x30, 0x91, 0x05, 0x5c, 0x99, 0x8b, 0x05,
+    0x5c, 0x91, 0x87, 0x05, 0x5c, 0x89, 0x83, 0x05, 0x5c, 0x73, 0x02, 0xa1,
+    0x83, 0x97, 0x05, 0x5c, 0xa1, 0x98, 0x05, 0x5c, 0xa8, 0xc2, 0x00, 0xc1,
+    0x05, 0x5c, 0x79, 0x83, 0x05, 0x5b, 0xe9, 0x87, 0x05, 0x5b, 0xf1, 0x8b,
+    0x05, 0x5b, 0xf9, 0x91, 0x05, 0x5c, 0x01, 0x97, 0x05, 0x5c, 0x09, 0x98,
+    0x05, 0x5c, 0x10, 0x97, 0x05, 0x5c, 0x69, 0x91, 0x05, 0x5c, 0x61, 0x8b,
+    0x05, 0x5c, 0x59, 0x87, 0x05, 0x5c, 0x51, 0x83, 0x05, 0x5c, 0x49, 0x98,
+    0x00, 0x9f, 0xe8, 0x98, 0x05, 0x5c, 0x41, 0x97, 0x05, 0x5c, 0x39, 0x91,
+    0x05, 0x5c, 0x31, 0x8b, 0x05, 0x5c, 0x29, 0x87, 0x05, 0x5c, 0x21, 0x83,
+    0x05, 0x5c, 0x18, 0x83, 0x05, 0x5c, 0xb1, 0x87, 0x05, 0x5c, 0xb9, 0x8b,
+    0x05, 0x5c, 0xc1, 0x91, 0x05, 0x5c, 0xc9, 0x97, 0x05, 0x5c, 0xd1, 0x98,
+    0x05, 0x5c, 0xd8, 0x83, 0x05, 0x5c, 0xe1, 0x87, 0x05, 0x5c, 0xf1, 0x8b,
+    0x05, 0x5c, 0xf9, 0x91, 0x05, 0x5d, 0x01, 0x97, 0x05, 0x5d, 0x09, 0x98,
+    0x05, 0x5d, 0x10, 0x83, 0x05, 0x5d, 0x19, 0x87, 0x05, 0x5d, 0x29, 0x8b,
+    0x05, 0x5d, 0x39, 0x91, 0x05, 0x5d, 0x49, 0x97, 0x05, 0x5d, 0x51, 0x98,
+    0x05, 0x5d, 0x59, 0xc2, 0x00, 0xdb, 0x05, 0x5d, 0x60, 0x83, 0x00, 0x9d,
+    0x31, 0x87, 0x00, 0x9d, 0x41, 0x8b, 0x00, 0x9d, 0x49, 0x91, 0x00, 0x9d,
+    0x51, 0x97, 0x00, 0x9d, 0x59, 0x98, 0x00, 0x9d, 0x60, 0x83, 0x00, 0x9d,
+    0x69, 0x87, 0x00, 0x9d, 0x71, 0x8b, 0x00, 0x9d, 0x79, 0x91, 0x00, 0x9d,
+    0x81, 0x97, 0x00, 0x9d, 0x89, 0x98, 0x00, 0x9d, 0x91, 0xc2, 0x00, 0xc1,
+    0x00, 0x9d, 0xf8, 0x83, 0x00, 0x9d, 0x99, 0x87, 0x00, 0x9d, 0xa1, 0x8b,
+    0x00, 0x9d, 0xa9, 0x91, 0x00, 0x9d, 0xb1, 0x97, 0x00, 0x9d, 0xb9, 0x98,
+    0x00, 0x9d, 0xc0, 0x83, 0x00, 0x9d, 0xc9, 0x87, 0x00, 0x9d, 0xd1, 0x8b,
+    0x00, 0x9d, 0xd9, 0x91, 0x00, 0x9d, 0xe1, 0x97, 0x00, 0x9d, 0xe9, 0x98,
+    0x00, 0x9f, 0xa8, 0x83, 0x00, 0x9d, 0xf3, 0x02, 0xa1, 0x87, 0x87, 0x00,
+    0x9e, 0x09, 0x8b, 0x00, 0x9e, 0x11, 0x91, 0x00, 0x9e, 0x19, 0x97, 0x00,
+    0x9e, 0x21, 0x98, 0x00, 0x9e, 0x28, 0x83, 0x00, 0x9e, 0x31, 0x87, 0x00,
+    0x9e, 0x39, 0x8b, 0x00, 0x9e, 0x41, 0x91, 0x00, 0x9e, 0x49, 0x97, 0x00,
+    0x9e, 0x51, 0x98, 0x00, 0x9e, 0x58, 0x83, 0x00, 0x9e, 0x61, 0x87, 0x00,
+    0x9e, 0x71, 0x8b, 0x00, 0x9e, 0x79, 0x91, 0x00, 0x9e, 0x81, 0x97, 0x00,
+    0x9e, 0x89, 0x98, 0x00, 0x9e, 0x90, 0x83, 0x00, 0x9e, 0x99, 0x87, 0x00,
+    0x9e, 0xa9, 0x8b, 0x00, 0x9e, 0xb9, 0x91, 0x00, 0x9e, 0xc9, 0x97, 0x00,
+    0x9e, 0xd1, 0x98, 0x00, 0x9e, 0xd9, 0xc2, 0x00, 0xdb, 0x00, 0x9e, 0xe0,
+    0x83, 0x00, 0x9e, 0xa1, 0x87, 0x00, 0x9e, 0xb1, 0x8b, 0x00, 0x9e, 0xc1,
+    0x0e, 0xc2, 0xa1, 0x8b, 0x15, 0x42, 0xa1, 0xa3, 0x83, 0x00, 0x9f, 0x49,
+    0x87, 0x00, 0x9f, 0x51, 0x8b, 0x00, 0x9f, 0x59, 0x91, 0x00, 0x9f, 0x61,
+    0x97, 0x00, 0x9f, 0x69, 0x98, 0x00, 0x9f, 0x70, 0x83, 0x00, 0x9f, 0x79,
+    0x87, 0x00, 0x9f, 0x81, 0x8b, 0x00, 0x9f, 0x89, 0x91, 0x00, 0x9f, 0x91,
+    0x97, 0x00, 0x9f, 0x99, 0x98, 0x00, 0x9f, 0xa0, 0xc3, 0x0e, 0xa7, 0x00,
+    0x04, 0x41, 0xd2, 0x49, 0x55, 0x00, 0x04, 0x48, 0xc3, 0x39, 0x6e, 0x08,
+    0x88, 0xa1, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x98, 0xc3, 0x39, 0x6e, 0x08,
+    0x88, 0x91, 0xc2, 0x04, 0xc6, 0x08, 0x88, 0x88, 0x8b, 0x08, 0x8a, 0x30,
+    0x83, 0x08, 0x8a, 0x29, 0x97, 0x08, 0x89, 0x79, 0x8b, 0x08, 0x89, 0x68,
+    0x8b, 0x08, 0x89, 0x80, 0x97, 0x08, 0x89, 0x58, 0x8b, 0x08, 0x89, 0x48,
+    0xc4, 0x18, 0x10, 0x08, 0x89, 0xe9, 0xc2, 0x22, 0xcc, 0x08, 0x89, 0xe0,
+    0xc3, 0x0d, 0x14, 0x08, 0x89, 0xd9, 0xc3, 0x09, 0x9e, 0x08, 0x89, 0xd0,
+    0xc4, 0x02, 0xde, 0x08, 0x89, 0xc9, 0xc2, 0x02, 0xa0, 0x08, 0x89, 0xc0,
+    0xc2, 0x0f, 0xe1, 0x05, 0x50, 0x51, 0x83, 0x05, 0x50, 0x58, 0xc2, 0x25,
+    0x3b, 0x05, 0x50, 0x91, 0x83, 0x05, 0x50, 0x89, 0xc2, 0x0f, 0xe1, 0x05,
+    0x50, 0x80, 0x89, 0x05, 0x52, 0x10, 0xc4, 0x18, 0x12, 0x08, 0x7e, 0x51,
+    0x91, 0x08, 0x7e, 0x30, 0xd7, 0x27, 0x74, 0x0f, 0xaa, 0x08, 0xce, 0x74,
+    0x24, 0x01, 0x72, 0x81, 0xcd, 0x79, 0x5b, 0x01, 0x72, 0x88, 0xc3, 0x02,
+    0x44, 0x0f, 0x01, 0x51, 0xc4, 0xac, 0x24, 0x0f, 0x00, 0xb8, 0x47, 0x1c,
+    0xa0, 0xc2, 0xa1, 0xbb, 0xcb, 0x98, 0x00, 0x0f, 0x00, 0x51, 0xc3, 0x78,
+    0xde, 0x0f, 0x00, 0x48, 0xc6, 0xc8, 0x01, 0x0f, 0x01, 0x41, 0xc3, 0xc8,
+    0x92, 0x0f, 0x00, 0x08, 0x91, 0x0f, 0x01, 0x31, 0x97, 0x0f, 0x01, 0x19,
+    0xc3, 0x01, 0xbd, 0x0f, 0x01, 0x09, 0x07, 0x42, 0xa1, 0xc7, 0xc8, 0xae,
+    0x6b, 0x0f, 0x01, 0x21, 0x0a, 0xc2, 0xa1, 0xd1, 0xc4, 0xe4, 0xc7, 0x0f,
+    0x00, 0xa0, 0xc2, 0x00, 0xba, 0x0f, 0x00, 0xe1, 0xc5, 0xd9, 0x52, 0x0f,
+    0x00, 0xa8, 0xc5, 0xdd, 0xb2, 0x0f, 0x00, 0x61, 0xc4, 0xe4, 0x2b, 0x0f,
+    0x00, 0x20, 0xc5, 0xda, 0x24, 0x0f, 0x00, 0x41, 0xc6, 0xd3, 0x73, 0x0f,
+    0x00, 0x30, 0x48, 0x23, 0x26, 0xc2, 0xa1, 0xdb, 0xcb, 0x94, 0x90, 0x00,
+    0x1a, 0x11, 0xc7, 0xc8, 0xd9, 0x00, 0x1a, 0x19, 0xcf, 0x63, 0xd2, 0x00,
+    0x1a, 0x21, 0xcd, 0x4a, 0x68, 0x00, 0x1a, 0x28, 0x45, 0xda, 0x51, 0xc2,
+    0xa1, 0xe5, 0x42, 0x00, 0x5f, 0xc2, 0xa1, 0xf1, 0xcc, 0x85, 0x59, 0x00,
+    0x1a, 0x78, 0xcc, 0x89, 0x25, 0x01, 0x06, 0xd1, 0xcb, 0x02, 0x5c, 0x01,
+    0x06, 0xa0, 0xcb, 0x8e, 0xe4, 0x00, 0xee, 0x49, 0xc6, 0x60, 0xb1, 0x00,
+    0xee, 0x38, 0xc6, 0x09, 0x01, 0x00, 0x18, 0x0b, 0x02, 0xa1, 0xf9, 0xc9,
+    0x2b, 0x5f, 0x00, 0x1a, 0x08, 0x00, 0xc2, 0xa1, 0xff, 0x19, 0x42, 0xa2,
+    0x17, 0xc7, 0x20, 0x88, 0x01, 0x06, 0xc1, 0xc5, 0x00, 0xd4, 0x00, 0x18,
+    0x51, 0xc5, 0x05, 0x02, 0x00, 0x19, 0x28, 0xd0, 0x2c, 0x60, 0x01, 0x07,
+    0x29, 0xcd, 0x52, 0x59, 0x00, 0x18, 0xa0, 0x03, 0xc2, 0xa2, 0x1d, 0x4c,
+    0x02, 0x56, 0xc2, 0xa2, 0x29, 0x42, 0x00, 0xd0, 0xc2, 0xa2, 0x35, 0x4c,
+    0x1a, 0x50, 0xc2, 0xa2, 0x41, 0xca, 0x9a, 0x3d, 0x00, 0x18, 0xc0, 0xdb,
+    0x0b, 0x6c, 0x01, 0x07, 0x69, 0xcd, 0x7a, 0x38, 0x01, 0x07, 0x50, 0xd6,
+    0x2c, 0x5a, 0x01, 0x07, 0x59, 0xd5, 0x36, 0x86, 0x01, 0x06, 0x91, 0x15,
+    0x42, 0xa2, 0x4d, 0x97, 0x00, 0x1b, 0x3b, 0x02, 0xa2, 0x59, 0x91, 0x00,
+    0x1b, 0x33, 0x02, 0xa2, 0x5f, 0x83, 0x00, 0x1b, 0x1b, 0x02, 0xa2, 0x65,
+    0x99, 0x00, 0xef, 0x8b, 0x02, 0xa2, 0x7d, 0x87, 0x00, 0x1b, 0x23, 0x02,
+    0xa2, 0x83, 0x92, 0x00, 0xef, 0x71, 0x8e, 0x00, 0xee, 0xeb, 0x02, 0xa2,
+    0x8f, 0x88, 0x00, 0xef, 0x5b, 0x02, 0xa2, 0x9b, 0x95, 0x00, 0xef, 0x23,
+    0x02, 0xa2, 0xa1, 0x84, 0x00, 0xef, 0x43, 0x02, 0xa2, 0xa7, 0x9c, 0x00,
+    0xef, 0x31, 0x94, 0x00, 0x1b, 0x63, 0x02, 0xa2, 0xad, 0x90, 0x00, 0xef,
+    0x01, 0x8d, 0x00, 0xee, 0xe1, 0x89, 0x00, 0xee, 0xd1, 0x8b, 0x00, 0x1b,
+    0x2b, 0x02, 0xa2, 0xb1, 0x85, 0x00, 0x1b, 0x43, 0x02, 0xa2, 0xb7, 0x96,
+    0x00, 0x1b, 0x6b, 0x02, 0xa2, 0xbd, 0x86, 0x00, 0x1b, 0x49, 0x8a, 0x00,
+    0x1b, 0x51, 0x8f, 0x00, 0x1b, 0x59, 0x98, 0x00, 0x1b, 0x71, 0x9a, 0x00,
+    0x1b, 0x78, 0x94, 0x00, 0xef, 0x11, 0x90, 0x00, 0xef, 0x09, 0x8f, 0x00,
+    0xee, 0xf9, 0x8e, 0x00, 0xee, 0xf1, 0x89, 0x00, 0xee, 0xd8, 0xc9, 0x0f,
+    0x6e, 0x07, 0xf1, 0x03, 0x02, 0xa2, 0xc3, 0xca, 0x09, 0xb7, 0x07, 0xf1,
+    0x0a, 0x02, 0xa2, 0xc9, 0xc5, 0x05, 0x02, 0x00, 0x19, 0x81, 0xc7, 0x20,
+    0x88, 0x00, 0x19, 0xa1, 0xcf, 0x66, 0x57, 0x07, 0xf1, 0x49, 0xd0, 0x5d,
+    0x42, 0x07, 0xf1, 0x50, 0x00, 0xc2, 0xa2, 0xcf, 0xd3, 0x41, 0x5e, 0x00,
+    0xd5, 0x80, 0x00, 0xc2, 0xa3, 0x1f, 0x44, 0x00, 0xde, 0x42, 0xa3, 0x31,
+    0xcb, 0x03, 0xbc, 0x00, 0xd5, 0x99, 0xcb, 0x9a, 0x3c, 0x00, 0x18, 0xf0,
+    0xcd, 0x7a, 0x79, 0x05, 0x47, 0x89, 0x47, 0x02, 0x0e, 0xc2, 0xa3, 0x3d,
+    0x46, 0x09, 0x97, 0x42, 0xa3, 0x63, 0xc5, 0x50, 0xb1, 0x01, 0x07, 0x11,
+    0xc5, 0x0b, 0x0a, 0x01, 0x06, 0xf0, 0xca, 0x02, 0xfd, 0x01, 0x07, 0x00,
+    0xce, 0x74, 0xb0, 0x00, 0x24, 0x41, 0xcd, 0x33, 0xee, 0x05, 0x33, 0x88,
+    0xc7, 0xc8, 0xee, 0x00, 0x24, 0x39, 0xcd, 0x7a, 0x04, 0x00, 0x24, 0x31,
+    0x03, 0x42, 0xa3, 0x87, 0xc4, 0x90, 0x77, 0x00, 0x24, 0x1b, 0x02, 0xa3,
+    0x93, 0xd0, 0x5c, 0xc2, 0x05, 0x33, 0x81, 0xd5, 0x33, 0xe6, 0x05, 0x33,
+    0x90, 0x07, 0xc2, 0xa3, 0x97, 0x8b, 0x05, 0x33, 0xab, 0x02, 0xa3, 0xb2,
+    0x97, 0x05, 0x33, 0xbb, 0x02, 0xa3, 0xbc, 0x1b, 0xc2, 0xa3, 0xc2, 0xc2,
+    0x00, 0xd0, 0x01, 0x6f, 0x7b, 0x02, 0xa3, 0xd6, 0x15, 0xc2, 0xa3, 0xdc,
+    0x91, 0x01, 0x6f, 0x53, 0x02, 0xa3, 0xe6, 0x04, 0xc2, 0xa3, 0xec, 0xc2,
+    0x00, 0x5f, 0x01, 0x6f, 0x09, 0xc3, 0xc0, 0x19, 0x01, 0x6f, 0x11, 0x06,
+    0xc2, 0xa3, 0xf6, 0x1c, 0xc2, 0xa4, 0x00, 0xc2, 0x02, 0x2b, 0x01, 0x6f,
+    0x31, 0xc2, 0x00, 0x67, 0x01, 0x6f, 0x59, 0x16, 0xc2, 0xa4, 0x0a, 0xc3,
+    0x28, 0x28, 0x01, 0x6f, 0x89, 0xc4, 0xe0, 0x1b, 0x01, 0x6f, 0xa1, 0x83,
+    0x01, 0x6f, 0xb1, 0xcc, 0x82, 0x05, 0x01, 0x6f, 0xc9, 0xca, 0x51, 0x7f,
+    0x01, 0x6f, 0xe8, 0xc6, 0x05, 0x01, 0x00, 0x19, 0x60, 0xc5, 0x00, 0xd4,
+    0x00, 0x18, 0x9b, 0x02, 0xa4, 0x14, 0xc5, 0x05, 0x02, 0x00, 0x19, 0x30,
+    0xc6, 0x05, 0x01, 0x07, 0xf1, 0x68, 0xcd, 0x42, 0x35, 0x00, 0x19, 0xa9,
+    0xce, 0x2c, 0x62, 0x00, 0x19, 0xb8, 0xc7, 0xc1, 0x31, 0x00, 0xee, 0x59,
+    0xc6, 0x05, 0x01, 0x00, 0x19, 0x70, 0xc5, 0x05, 0x02, 0x00, 0x19, 0x51,
+    0xc5, 0x00, 0xd4, 0x00, 0x1a, 0x30, 0xc5, 0x00, 0xd4, 0x00, 0xef, 0xa9,
+    0xc5, 0x05, 0x02, 0x00, 0x18, 0xe8, 0x4c, 0x83, 0x6d, 0xc2, 0xa4, 0x1a,
+    0x42, 0x00, 0x38, 0x42, 0xa4, 0x26, 0xc5, 0x1d, 0x88, 0x00, 0xee, 0x61,
+    0xc5, 0x1f, 0x0c, 0x00, 0xee, 0x31, 0xc5, 0x31, 0xee, 0x00, 0xee, 0x20,
+    0xc5, 0x05, 0x02, 0x00, 0x19, 0x89, 0xc9, 0x0f, 0x6e, 0x07, 0xf1, 0x23,
+    0x02, 0xa4, 0x35, 0xca, 0x09, 0xb7, 0x07, 0xf1, 0x2a, 0x02, 0xa4, 0x3b,
+    0xc7, 0x20, 0x88, 0x00, 0xd5, 0xf1, 0xc5, 0x05, 0x02, 0x00, 0xd5, 0xe9,
+    0xc5, 0x00, 0xd4, 0x00, 0xd5, 0xd8, 0xc4, 0x18, 0x10, 0x0e, 0x9b, 0x79,
+    0xc2, 0x22, 0xcc, 0x0e, 0x9b, 0x70, 0xc3, 0x0d, 0x14, 0x0e, 0x9b, 0x69,
+    0xc3, 0x09, 0x9e, 0x0e, 0x9b, 0x60, 0xc4, 0x02, 0xde, 0x0e, 0x9b, 0x59,
+    0xc2, 0x02, 0xa0, 0x0e, 0x9b, 0x50, 0xc4, 0x18, 0x10, 0x0e, 0x9b, 0x31,
+    0xc2, 0x22, 0xcc, 0x0e, 0x9b, 0x28, 0xc3, 0x0d, 0x14, 0x0e, 0x9b, 0x21,
+    0xc3, 0x09, 0x9e, 0x0e, 0x9b, 0x18, 0xc4, 0x02, 0xde, 0x0e, 0x9b, 0x11,
+    0xc2, 0x02, 0xa0, 0x0e, 0x9b, 0x08, 0xe0, 0x0a, 0x07, 0x01, 0x17, 0xd8,
+    0xcc, 0x23, 0x9f, 0x01, 0x15, 0xa8, 0x0a, 0xc2, 0xa4, 0x41, 0xc3, 0x0b,
+    0x65, 0x01, 0x64, 0xa9, 0xc2, 0x00, 0xba, 0x01, 0x64, 0xe8, 0xc3, 0x01,
+    0x69, 0x00, 0x1f, 0x49, 0xc3, 0x00, 0xfe, 0x01, 0x64, 0x78, 0xc4, 0xd0,
+    0x3f, 0x00, 0x1f, 0x59, 0xc3, 0x0a, 0x8c, 0x01, 0x64, 0x28, 0x0a, 0xc2,
+    0xa4, 0x4b, 0xc2, 0x00, 0x59, 0x01, 0x64, 0x59, 0xc3, 0x07, 0x4a, 0x01,
+    0x65, 0x29, 0xc4, 0x87, 0xf5, 0x01, 0x66, 0x08, 0xc2, 0x06, 0xdb, 0x00,
+    0x1f, 0x79, 0xc4, 0xe2, 0x73, 0x01, 0x64, 0x39, 0x49, 0xa9, 0x00, 0x42,
+    0xa4, 0x57, 0xc3, 0xe5, 0xe7, 0x01, 0x64, 0x09, 0xcc, 0x8c, 0x3d, 0x01,
+    0x66, 0x48, 0xc5, 0xd6, 0xd7, 0x01, 0x64, 0x89, 0xc2, 0x20, 0xec, 0x01,
+    0x65, 0x38, 0xc4, 0xe1, 0xcf, 0x01, 0x64, 0xb9, 0xca, 0xa7, 0x7e, 0x01,
+    0x66, 0x88, 0xc2, 0x00, 0x59, 0x01, 0x65, 0x89, 0x43, 0x1d, 0xbb, 0x42,
+    0xa4, 0x6f, 0x8b, 0x01, 0x65, 0x09, 0xc2, 0x00, 0xba, 0x01, 0x65, 0x78,
+    0x8b, 0x01, 0x65, 0x59, 0xc2, 0x06, 0xdb, 0x00, 0x1f, 0x28, 0x4c, 0x1d,
+    0xdd, 0xc2, 0xa4, 0x7b, 0xca, 0x9b, 0xa8, 0x01, 0x66, 0x18, 0xc2, 0x02,
+    0xfa, 0x01, 0x67, 0x21, 0xc5, 0xd6, 0xe1, 0x01, 0x67, 0x48, 0xc6, 0xd1,
+    0x21, 0x01, 0x67, 0x39, 0xc9, 0xa9, 0x75, 0x01, 0x67, 0x50, 0xc3, 0x01,
+    0x69, 0x00, 0x1f, 0x41, 0xc3, 0x00, 0xfe, 0x01, 0x64, 0x70, 0xc4, 0xd0,
+    0x3f, 0x00, 0x1f, 0x51, 0xc3, 0x0a, 0x8c, 0x01, 0x64, 0x20, 0x0a, 0xc2,
+    0xa4, 0x93, 0xc2, 0x00, 0x59, 0x01, 0x64, 0x51, 0xc3, 0x07, 0x4a, 0x01,
+    0x65, 0x21, 0xc4, 0x87, 0xf5, 0x01, 0x66, 0x00, 0xc2, 0x06, 0xdb, 0x00,
+    0x1f, 0x71, 0xc4, 0xe2, 0x73, 0x01, 0x64, 0x31, 0x49, 0xa9, 0x00, 0x42,
+    0xa4, 0x9f, 0xc3, 0xe5, 0xe7, 0x01, 0x64, 0x01, 0xcc, 0x8c, 0x3d, 0x01,
+    0x66, 0x40, 0xc5, 0xd6, 0xd7, 0x01, 0x64, 0x81, 0xc2, 0x20, 0xec, 0x01,
+    0x65, 0x30, 0xc3, 0x0b, 0x65, 0x01, 0x64, 0xa1, 0xc2, 0x00, 0xba, 0x01,
+    0x64, 0xe1, 0x0a, 0x42, 0xa4, 0xb7, 0xc4, 0xe1, 0xcf, 0x01, 0x64, 0xb1,
+    0xca, 0xa7, 0x7e, 0x01, 0x66, 0x80, 0xc2, 0x00, 0x59, 0x01, 0x65, 0x81,
+    0x43, 0x1d, 0xbb, 0x42, 0xa4, 0xc1, 0x8b, 0x01, 0x65, 0x01, 0xc2, 0x00,
+    0xba, 0x01, 0x65, 0x70, 0x8b, 0x01, 0x65, 0x51, 0xc2, 0x06, 0xdb, 0x00,
+    0x1f, 0x20, 0x4c, 0x1d, 0xdd, 0xc2, 0xa4, 0xcd, 0xca, 0x9b, 0xa8, 0x01,
+    0x66, 0x10, 0xc5, 0xd6, 0xc8, 0x01, 0x67, 0x81, 0xc5, 0x3b, 0x5e, 0x01,
+    0x67, 0x88, 0xc2, 0x02, 0xa0, 0x08, 0x17, 0x11, 0xc4, 0x02, 0xde, 0x08,
+    0x17, 0x18, 0xc3, 0x09, 0x9e, 0x08, 0x17, 0x21, 0xc3, 0x0d, 0x14, 0x08,
+    0x17, 0x28, 0xc2, 0x22, 0xcc, 0x08, 0x17, 0x31, 0xc4, 0x18, 0x10, 0x08,
+    0x17, 0x38, 0xc2, 0x00, 0xc4, 0x08, 0x17, 0x51, 0x19, 0xc2, 0xa4, 0xe5,
+    0x0a, 0x42, 0xa4, 0xf1, 0x11, 0xc2, 0xa4, 0xfd, 0x0b, 0x42, 0xa5, 0x09,
+    0x42, 0x22, 0xcc, 0xc2, 0xa5, 0x15, 0x44, 0x18, 0x10, 0x42, 0xa5, 0x21,
+    0x9b, 0x08, 0x17, 0x89, 0xc8, 0x0d, 0x03, 0x08, 0x17, 0xd0, 0xc2, 0x0d,
+    0x10, 0x08, 0x17, 0x91, 0xc8, 0x0d, 0x03, 0x08, 0x17, 0xd8, 0xd2, 0x4a,
+    0x09, 0x01, 0x52, 0x80, 0xcc, 0x23, 0x9f, 0x01, 0x56, 0x88, 0xcc, 0x23,
+    0x9f, 0x01, 0x56, 0x90, 0xe0, 0x05, 0x67, 0x0f, 0xa8, 0x0a, 0x02, 0xa5,
+    0x2d, 0x44, 0x22, 0x44, 0xc2, 0xa5, 0x33, 0x11, 0x42, 0xa5, 0x3f, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x29, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xc8, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xaa, 0xf1, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0x90, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x31, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xd0, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x19, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xb8, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x11, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xb0, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x09, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xa8, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xab, 0x01, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0xa0, 0xc7,
+    0xc1, 0xd9, 0x0f, 0xaa, 0xf9, 0xc7, 0xc7, 0x6d, 0x0f, 0xaa, 0x98, 0x00,
+    0xc2, 0xa5, 0x4b, 0xc9, 0xae, 0xe8, 0x01, 0x36, 0x90, 0x0d, 0xc2, 0xa5,
+    0x5a, 0xc5, 0xd9, 0x61, 0x01, 0x93, 0x0b, 0x02, 0xa5, 0x6c, 0x16, 0xc2,
+    0xa5, 0x72, 0xc5, 0xd6, 0x8c, 0x01, 0x93, 0x1b, 0x02, 0xa5, 0x84, 0xc5,
+    0xda, 0xe7, 0x01, 0x93, 0x23, 0x02, 0xa5, 0x8a, 0x12, 0xc2, 0xa5, 0x90,
+    0xc4, 0xad, 0x2b, 0x01, 0x93, 0x33, 0x02, 0xa5, 0xa2, 0xc5, 0xb7, 0x9d,
+    0x01, 0x93, 0x3b, 0x02, 0xa5, 0xa8, 0x05, 0xc2, 0xa5, 0xac, 0xc5, 0x90,
+    0xe4, 0x01, 0x93, 0x6a, 0x02, 0xa5, 0xbe, 0xc4, 0x0e, 0x6a, 0x01, 0x39,
+    0x51, 0xc6, 0x1c, 0xb4, 0x01, 0x4d, 0xf0, 0x44, 0x09, 0x99, 0xc2, 0xa5,
+    0xc4, 0x48, 0x30, 0xf3, 0x42, 0xa5, 0xe8, 0xca, 0x30, 0xb2, 0x01, 0x14,
+    0xc9, 0x0e, 0x42, 0xa5, 0xf4, 0x4d, 0x29, 0xb9, 0xc2, 0xa5, 0xfa, 0x4f,
+    0x0b, 0x17, 0x42, 0xa6, 0x62, 0x42, 0x00, 0x28, 0xc2, 0xa6, 0xca, 0x44,
+    0x0d, 0x0d, 0xc2, 0xa6, 0xd9, 0xc2, 0x00, 0xc4, 0x01, 0x23, 0x4a, 0x02,
+    0xa6, 0xe6, 0x44, 0x00, 0x2d, 0xc2, 0xa6, 0xec, 0xc5, 0x66, 0xb1, 0x01,
+    0x23, 0x50, 0x45, 0x18, 0x10, 0xc2, 0xa6, 0xf8, 0x43, 0x22, 0xcc, 0x42,
+    0xa7, 0x04, 0x43, 0x14, 0x07, 0xc2, 0xa7, 0x10, 0x11, 0x42, 0xa7, 0x1d,
+    0xc5, 0x03, 0xc7, 0x01, 0x1c, 0x50, 0xd6, 0x30, 0xe8, 0x01, 0x4d, 0xe1,
+    0xc6, 0x01, 0xa1, 0x0f, 0x88, 0x70, 0xe0, 0x08, 0xe7, 0x01, 0x51, 0xb0,
+    0x03, 0xc2, 0xa7, 0x2c, 0xc8, 0x2c, 0xb2, 0x01, 0x92, 0x21, 0x0d, 0xc2,
+    0xa7, 0x44, 0x15, 0xc2, 0xa7, 0x50, 0xc3, 0x05, 0x14, 0x01, 0x94, 0x01,
+    0x16, 0xc2, 0xa7, 0x74, 0x08, 0xc2, 0xa7, 0x86, 0x07, 0xc2, 0xa7, 0x96,
+    0x10, 0xc2, 0xa7, 0xae, 0x0f, 0xc2, 0xa7, 0xb8, 0x19, 0xc2, 0xa7, 0xc8,
+    0x0a, 0xc2, 0xa7, 0xd4, 0x05, 0xc2, 0xa7, 0xe0, 0x0e, 0xc2, 0xa7, 0xea,
+    0xc5, 0xb9, 0xbc, 0x01, 0x94, 0xf1, 0xc4, 0xaa, 0xbb, 0x01, 0x95, 0x01,
+    0x14, 0x42, 0xa7, 0xfc, 0x85, 0x0f, 0x89, 0x59, 0x94, 0x0f, 0x89, 0x60,
+    0xc6, 0xcd, 0xf7, 0x01, 0x93, 0xe1, 0xc5, 0xde, 0x34, 0x01, 0x93, 0xe8,
+    0x83, 0x01, 0x96, 0x81, 0x8b, 0x01, 0x96, 0x89, 0x97, 0x01, 0x96, 0x91,
+    0x87, 0x01, 0x96, 0x99, 0x91, 0x01, 0x96, 0xa1, 0x0d, 0xc2, 0xa8, 0x06,
+    0x15, 0xc2, 0xa8, 0x1a, 0x16, 0xc2, 0xa8, 0x2e, 0x10, 0xc2, 0xa8, 0x42,
+    0x0a, 0xc2, 0xa8, 0x56, 0x0f, 0xc2, 0xa8, 0x6a, 0x1b, 0xc2, 0xa8, 0x7e,
+    0x14, 0xc2, 0xa8, 0x8a, 0x19, 0x42, 0xa8, 0x9e, 0xe0, 0x02, 0xa7, 0x01,
+    0x2e, 0xa8, 0xd4, 0x3d, 0x7c, 0x01, 0x2e, 0xa1, 0xca, 0x1e, 0x5f, 0x01,
+    0x2e, 0x98, 0xcf, 0x63, 0x2d, 0x01, 0x2e, 0x91, 0xce, 0x66, 0x67, 0x01,
+    0x2e, 0x80, 0xe0, 0x01, 0x67, 0x01, 0x4e, 0x18, 0xd8, 0x24, 0x83, 0x01,
+    0x4e, 0x11, 0xcd, 0x76, 0x90, 0x01, 0x4d, 0xd8, 0x47, 0x03, 0x4c, 0x42,
+    0xa8, 0xae, 0xd1, 0x51, 0xcd, 0x09, 0x1a, 0xf9, 0xc4, 0x58, 0xf5, 0x09,
+    0x1a, 0xf0, 0xca, 0xa1, 0x20, 0x09, 0x1b, 0x38, 0x47, 0x03, 0x4c, 0xc2,
+    0xa8, 0xb8, 0xc2, 0x0e, 0x9a, 0x09, 0x1a, 0x7a, 0x02, 0xa8, 0xfb, 0x00,
+    0x42, 0xa9, 0x01, 0xa0, 0x09, 0x19, 0xb0, 0xc7, 0x6c, 0xd0, 0x09, 0x19,
+    0x51, 0xcb, 0x94, 0x0c, 0x09, 0x19, 0x48, 0xc2, 0x02, 0xad, 0x09, 0x18,
+    0x68, 0xda, 0x1b, 0x68, 0x09, 0x18, 0x81, 0xcc, 0x8b, 0x59, 0x09, 0x18,
+    0x79, 0xd7, 0x29, 0x9c, 0x09, 0x18, 0x70, 0xc2, 0x00, 0x4e, 0x09, 0x1c,
+    0xc3, 0x02, 0xa9, 0x0d, 0x97, 0x09, 0x19, 0x09, 0xc4, 0x55, 0x25, 0x09,
+    0x19, 0x01, 0xc5, 0x03, 0x47, 0x09, 0x18, 0xf0, 0x47, 0x03, 0x4c, 0x42,
+    0xa9, 0x13, 0xcd, 0x80, 0x84, 0x09, 0x1a, 0xd8, 0xc4, 0x38, 0xb4, 0x09,
+    0x1a, 0xa9, 0xc2, 0x05, 0x52, 0x09, 0x1a, 0x9b, 0x02, 0xa9, 0x1f, 0x83,
+    0x09, 0x1a, 0x90, 0xc7, 0x6c, 0xd0, 0x09, 0x18, 0xd3, 0x02, 0xa9, 0x23,
+    0xc4, 0x39, 0xc8, 0x09, 0x18, 0xc9, 0x46, 0x03, 0x4d, 0xc2, 0xa9, 0x29,
+    0xc6, 0xd0, 0x97, 0x09, 0x18, 0xa0, 0x47, 0x03, 0x4c, 0x42, 0xa9, 0x3e,
+    0xd4, 0x39, 0x58, 0x09, 0x18, 0x50, 0xc9, 0xac, 0x18, 0x09, 0x29, 0xc8,
+    0x47, 0x03, 0x4c, 0x42, 0xa9, 0x4a, 0x00, 0x42, 0xa9, 0x68, 0xc4, 0x39,
+    0xc8, 0x09, 0x17, 0x79, 0x46, 0x03, 0x4d, 0xc2, 0xa9, 0x74, 0xc8, 0x0a,
+    0xff, 0x09, 0x17, 0x60, 0x00, 0x42, 0xa9, 0x80, 0xca, 0x38, 0xae, 0x09,
+    0x29, 0xc1, 0xc4, 0x39, 0xc8, 0x09, 0x16, 0xe0, 0xa1, 0x09, 0x16, 0xf2,
+    0x02, 0xa9, 0x8f, 0x9f, 0x09, 0x16, 0xcb, 0x02, 0xa9, 0x95, 0xc3, 0x2b,
+    0x88, 0x09, 0x16, 0xd1, 0xd2, 0x47, 0x27, 0x09, 0x16, 0xc0, 0x00, 0xc2,
+    0xa9, 0x9b, 0xc2, 0x01, 0xe2, 0x09, 0x16, 0x03, 0x02, 0xa9, 0xb0, 0x90,
+    0x09, 0x15, 0xf9, 0xc2, 0xe6, 0xab, 0x09, 0x15, 0xf0, 0xa3, 0x09, 0x15,
+    0xbb, 0x02, 0xa9, 0xba, 0xc2, 0x38, 0x6a, 0x09, 0x15, 0xc9, 0xc2, 0xe5,
+    0x8e, 0x09, 0x15, 0xc1, 0xa0, 0x09, 0x15, 0x72, 0x02, 0xa9, 0xc0, 0xc2,
+    0x01, 0x6f, 0x09, 0x16, 0xb1, 0x94, 0x09, 0x16, 0x9b, 0x02, 0xa9, 0xc6,
+    0xc3, 0x56, 0xa5, 0x09, 0x16, 0x91, 0x8f, 0x09, 0x16, 0x33, 0x02, 0xa9,
+    0xca, 0x86, 0x09, 0x16, 0x1a, 0x02, 0xa9, 0xd0, 0x00, 0x42, 0xa9, 0xd6,
+    0xd1, 0x56, 0xb7, 0x09, 0x15, 0x50, 0xa6, 0x09, 0x17, 0x50, 0xc3, 0x02,
+    0x2c, 0x09, 0x17, 0x40, 0x9f, 0x09, 0x17, 0x28, 0xc3, 0xe4, 0xe2, 0x09,
+    0x12, 0x93, 0x02, 0xa9, 0xf1, 0xa6, 0x09, 0x1c, 0x80, 0x49, 0x38, 0x6c,
+    0x42, 0xa9, 0xf7, 0x00, 0x42, 0xaa, 0x03, 0xc2, 0x4d, 0x4c, 0x09, 0x13,
+    0x6b, 0x02, 0xaa, 0x15, 0x00, 0x42, 0xaa, 0x19, 0x9f, 0x09, 0x12, 0x39,
+    0xc8, 0xb7, 0xa2, 0x09, 0x12, 0x28, 0x94, 0x09, 0x12, 0x21, 0x00, 0x42,
+    0xaa, 0x34, 0xc7, 0x6c, 0xd0, 0x09, 0x12, 0x59, 0x46, 0x03, 0x4d, 0x42,
+    0xaa, 0x46, 0x00, 0xc2, 0xaa, 0x50, 0xa0, 0x09, 0x11, 0xca, 0x02, 0xaa,
+    0x65, 0xc5, 0x39, 0xc7, 0x09, 0x11, 0x78, 0x8a, 0x09, 0x1c, 0x60, 0x9f,
+    0x09, 0x11, 0x38, 0xc4, 0x39, 0xc8, 0x09, 0x11, 0x11, 0xca, 0x38, 0xae,
+    0x09, 0x11, 0x08, 0x00, 0x42, 0xaa, 0x69, 0xc9, 0xac, 0xa8, 0x09, 0x10,
+    0xf2, 0x02, 0xaa, 0x83, 0x00, 0x42, 0xaa, 0x89, 0x24, 0xc2, 0xaa, 0x93,
+    0x23, 0xc2, 0xaa, 0x9f, 0xc3, 0xe5, 0x7e, 0x09, 0x27, 0xf9, 0x21, 0xc2,
+    0xaa, 0xbd, 0x20, 0xc2, 0xaa, 0xd5, 0x1f, 0xc2, 0xaa, 0xe3, 0x1e, 0xc2,
+    0xaa, 0xf5, 0x1d, 0x42, 0xab, 0x01, 0x84, 0x09, 0x0d, 0xc3, 0x02, 0xab,
+    0x2b, 0x94, 0x09, 0x0f, 0x62, 0x02, 0xab, 0x2f, 0xca, 0x51, 0xd4, 0x09,
+    0x0f, 0xaa, 0x02, 0xab, 0x33, 0xca, 0x8c, 0xf6, 0x09, 0x0f, 0x98, 0x97,
+    0x09, 0x0c, 0x3b, 0x02, 0xab, 0x39, 0x0d, 0xc2, 0xab, 0x5a, 0x04, 0xc2,
+    0xab, 0x68, 0x16, 0xc2, 0xab, 0x74, 0x15, 0xc2, 0xab, 0x7e, 0x12, 0xc2,
+    0xab, 0x95, 0x0e, 0xc2, 0xab, 0x9d, 0xcd, 0x05, 0x5a, 0x09, 0x1c, 0x11,
+    0x09, 0xc2, 0xab, 0xa8, 0x83, 0x09, 0x0a, 0xc3, 0x02, 0xab, 0xbd, 0xc2,
+    0x2e, 0x48, 0x09, 0x0c, 0x61, 0xc2, 0x17, 0x99, 0x09, 0x0b, 0xe9, 0x10,
+    0xc2, 0xab, 0xd0, 0x0f, 0xc2, 0xab, 0xda, 0x0b, 0xc2, 0xab, 0xe8, 0x07,
+    0x42, 0xab, 0xf2, 0x00, 0x42, 0xab, 0xfe, 0xa1, 0x09, 0x0c, 0xd9, 0x9f,
+    0x09, 0x0c, 0xd0, 0x00, 0x42, 0xac, 0x0a, 0xcf, 0x6a, 0x17, 0x09, 0x0c,
+    0xb0, 0xa2, 0x09, 0x0c, 0x9b, 0x02, 0xac, 0x16, 0xa1, 0x09, 0x0c, 0x91,
+    0xa0, 0x09, 0x0c, 0x89, 0x9f, 0x09, 0x0c, 0x80, 0xcd, 0x7b, 0x8a, 0x09,
+    0x0c, 0x70, 0xcd, 0x7a, 0x5f, 0x09, 0x0d, 0xa0, 0xc5, 0x39, 0xc7, 0x09,
+    0x0d, 0x88, 0xcd, 0x77, 0xe2, 0x09, 0x0d, 0x70, 0xe0, 0x05, 0x47, 0x09,
+    0x0d, 0x58, 0xc3, 0x68, 0xd0, 0x09, 0x0d, 0x43, 0x02, 0xac, 0x1c, 0x8a,
+    0x09, 0x0d, 0x39, 0xc2, 0x00, 0x65, 0x09, 0x0d, 0x30, 0x97, 0x09, 0x0d,
+    0x13, 0x02, 0xac, 0x22, 0xc3, 0x62, 0x19, 0x09, 0x0d, 0x08, 0xc3, 0x02,
+    0x2c, 0x09, 0x09, 0x73, 0x02, 0xac, 0x26, 0x97, 0x09, 0x09, 0xb1, 0xc3,
+    0x04, 0x65, 0x09, 0x09, 0xa9, 0xc3, 0x20, 0x18, 0x09, 0x09, 0xa1, 0xc3,
+    0x56, 0x1d, 0x09, 0x09, 0x99, 0xc3, 0x1a, 0xe7, 0x09, 0x09, 0x91, 0xc4,
+    0x04, 0x59, 0x09, 0x09, 0x89, 0xc3, 0x62, 0x19, 0x09, 0x09, 0x80, 0xc4,
+    0x58, 0xf5, 0x09, 0x09, 0x53, 0x02, 0xac, 0x30, 0xc4, 0x39, 0xc8, 0x09,
+    0x09, 0x58, 0x47, 0x03, 0x4c, 0x42, 0xac, 0x36, 0x00, 0x42, 0xac, 0x54,
+    0x00, 0x42, 0xac, 0x66, 0x17, 0xc2, 0xac, 0x72, 0xa4, 0x09, 0x09, 0x30,
+    0xca, 0xa6, 0x48, 0x09, 0x09, 0x20, 0x8a, 0x09, 0x08, 0x8b, 0x02, 0xac,
+    0x7c, 0xc2, 0x00, 0x65, 0x09, 0x08, 0x80, 0xa0, 0x09, 0x08, 0x53, 0x02,
+    0xac, 0x80, 0x9f, 0x09, 0x08, 0x42, 0x02, 0xac, 0x86, 0x00, 0x42, 0xac,
+    0x8c, 0xcb, 0x47, 0xaa, 0x09, 0x08, 0x19, 0x46, 0x03, 0x4d, 0x42, 0xac,
+    0x98, 0x47, 0x03, 0x4c, 0x42, 0xac, 0xa0, 0x00, 0x42, 0xac, 0xaa, 0x00,
+    0x42, 0xac, 0xb6, 0xa0, 0x09, 0x07, 0xe0, 0x9f, 0x09, 0x07, 0xba, 0x02,
+    0xac, 0xc2, 0xc2, 0x00, 0xc2, 0x09, 0x07, 0xa1, 0xda, 0x1a, 0xe6, 0x09,
+    0x07, 0x98, 0xd6, 0x1a, 0xea, 0x09, 0x07, 0x88, 0x46, 0x03, 0x4d, 0xc2,
+    0xac, 0xc6, 0x4e, 0x6c, 0xd0, 0x42, 0xad, 0x01, 0xc2, 0x5c, 0x27, 0x09,
+    0x25, 0x58, 0xc3, 0x0b, 0x64, 0x09, 0x25, 0x51, 0xc3, 0x51, 0xdb, 0x09,
+    0x25, 0x49, 0x97, 0x09, 0x04, 0x99, 0x15, 0xc2, 0xad, 0x2b, 0xc2, 0x02,
+    0x2f, 0x09, 0x04, 0x81, 0xc3, 0x1a, 0xf4, 0x09, 0x04, 0x79, 0xd1, 0x4e,
+    0xe1, 0x09, 0x04, 0x70, 0xc7, 0x0b, 0x09, 0x09, 0x04, 0xe9, 0xcb, 0x96,
+    0xed, 0x09, 0x04, 0xe1, 0xcb, 0x94, 0x38, 0x09, 0x04, 0xd9, 0x46, 0x03,
+    0x4d,